RPSBLAST alignment for GI: 254780576 and conserved domain: PRK11160

>gnl|CDD|183003 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed. Length = 574
 Score =  223 bits (571), Expect = 1e-58
 Identities = 97/265 (36%), Positives = 154/265 (58%), Gaps = 3/265 (1%)

Query: 329 EELLNILNEKIEIQNAVNSKDLKIKNGHIVFNNVSFSY-NHHNCIFKGISFEIAPSKKTA 387
             +  I  +K E+     S         +  NNVSF+Y +    + KG+S +I   +K A
Sbjct: 312 RRINEITEQKPEVTFPTTST-AAADQVSLTLNNVSFTYPDQPQPVLKGLSLQIKAGEKVA 370

Query: 388 LIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTILFNDTL 447
           L+G +G GKST+ +LL R +D + G I ++GQ I   ++ +LRQ I ++ Q   LF+ TL
Sbjct: 371 LLGRTGCGKSTLLQLLTRAWDPQQGEILLNGQPIADYSEAALRQAISVVSQRVHLFSATL 430

Query: 448 RYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARA 507
           R N+L   PNASD+ L   ++   L+  + +   G +  +GE G +LSGGE++R+ IARA
Sbjct: 431 RDNLLLAAPNASDEALIEVLQQVGLEKLL-EDDKGLNAWLGEGGRQLSGGEQRRLGIARA 489

Query: 508 ILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAHRLSTITDADNIIVFDQG 567
           +L + P+++ DE T  LD  TER I   LA  ++N+T L+I HRL+ +   D I V D G
Sbjct: 490 LLHDAPLLLLDEPTEGLDAETERQILELLAEHAQNKTVLMITHRLTGLEQFDRICVMDNG 549

Query: 568 TVVESGSHENLISQGGIYTSMWKKQ 592
            ++E G+H+ L++Q G Y  + ++ 
Sbjct: 550 QIIEQGTHQELLAQQGRYYQLKQRL 574