RPSBLAST alignment for GI: 254780576 and conserved domain: PRK11247

>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional. Length = 257
 Score = 64.7 bits (158), Expect = 6e-11
 Identities = 57/219 (26%), Positives = 99/219 (45%), Gaps = 25/219 (11%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI 416
           ++ N VS  Y     +   +   I   +  A++G SG GKST+ +LL  L     G + +
Sbjct: 13  LLLNAVSKRY-GERTVLNQLDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLETPSAGEL-L 70

Query: 417 DGQDIKKITKESLR---QTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLK 473
            G       +E  R   Q   ++P   ++ N  L    L G    +  +  AAV      
Sbjct: 71  AGTAPLAEAREDTRLMFQDARLLPWKKVIDNVGLG---LKGQWRDAALQALAAV------ 121

Query: 474 SFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQ 533
                   G      E    LSGG+KQRV++ARA++  P +++ DE   +LD +T   +Q
Sbjct: 122 --------GLADRANEWPAALSGGQKQRVALARALIHRPGLLLLDEPLGALDALTRIEMQ 173

Query: 534 TALATLSKNR--TTLVIAHRLS-TITDADNIIVFDQGTV 569
             + +L +    T L++ H +S  +  AD +++ ++G +
Sbjct: 174 DLIESLWQQHGFTVLLVTHDVSEAVAMADRVLLIEEGKI 212