RPSBLAST alignment for GI: 254780576 and conserved domain: PRK11288

>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional. Length = 501
 Score = 40.3 bits (95), Expect = 0.002
 Identities = 53/220 (24%), Positives = 94/220 (42%), Gaps = 29/220 (13%)

Query: 376 ISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIK-KITKESLRQTI- 433
           ISF +   +   L G  G G+S + KLLY       G + +DG+ I  +  ++++R  I 
Sbjct: 272 ISFSVRAGEIVGLFGLVGAGRSELMKLLYGATRRTAGQVYLDGKPIDIRSPRDAIRAGIM 331

Query: 434 ---------GIIP----QDTILFNDTLRYNILYGNP--NASDQELCAAVEVAQLKSFIMK 478
                    GIIP     D I  N + R + L      N   +   A   +  L    +K
Sbjct: 332 LCPEDRKAEGIIPVHSVADNI--NISARRHHLRAGCLINNRWEAENADRFIRSLN---IK 386

Query: 479 LPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALAT 538
            P+  + ++      LSGG +Q+  + R + ++  +I+ DE T  +D+  +  I   +  
Sbjct: 387 TPSR-EQLIM----NLSGGNQQKAILGRWLSEDMKVILLDEPTRGIDVGAKHEIYNVIYE 441

Query: 539 LSKN-RTTLVIAHRLSTITD-ADNIIVFDQGTVVESGSHE 576
           L+      L ++  L  +   AD I+V  +G +    + E
Sbjct: 442 LAAQGVAVLFVSSDLPEVLGVADRIVVMREGRIAGELARE 481