RPSBLAST alignment for GI: 254780576 and conserved domain: PRK11607

>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional. Length = 377
 Score = 70.2 bits (172), Expect = 1e-12
 Identities = 64/250 (25%), Positives = 116/250 (46%), Gaps = 42/250 (16%)

Query: 339 IEIQNAVNSKDLKIKNGHIVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKST 398
           +EI+N   S D     G    ++VS +      I+KG  F        AL+G SG GKST
Sbjct: 20  LEIRNLTKSFD-----GQHAVDDVSLT------IYKGEIF--------ALLGASGCGKST 60

Query: 399 VAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTILF-NDTLRYNILYG--N 455
           + ++L        G I +DG D+  +     ++ I ++ Q   LF + T+  NI +G   
Sbjct: 61  LLRMLAGFEQPTAGQIMLDGVDLSHVP--PYQRPINMMFQSYALFPHMTVEQNIAFGLKQ 118

Query: 456 PNASDQELCAAVE----VAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKN 511
                 E+ + V     +  ++ F  + P+           +LSGG++QRV++AR++ K 
Sbjct: 119 DKLPKAEIASRVNEMLGLVHMQEFAKRKPH-----------QLSGGQRQRVALARSLAKR 167

Query: 512 PPIIIFDEATSSLDIITERHIQTALATLSK--NRTTLVIAH-RLSTITDADNIIVFDQGT 568
           P +++ DE   +LD      +Q  +  + +    T +++ H +   +T A  I + ++G 
Sbjct: 168 PKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGK 227

Query: 569 VVESGSHENL 578
            V+ G  E +
Sbjct: 228 FVQIGEPEEI 237