RPSBLAST alignment for GI: 254780576 and conserved domain: PRK13409

>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional. Length = 590
 Score = 59.8 bits (146), Expect = 2e-09
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 16/94 (17%)

Query: 483 YDTVVGERGLK---------LSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQ 533
            D VV   GL+         LSGGE QRV+IA A+L++     FDE TS LD I +R + 
Sbjct: 193 LDEVVERLGLENILDRDISELSGGELQRVAIAAALLRDADFYFFDEPTSYLD-IRQR-LN 250

Query: 534 TALA--TLSKNRTTLVIAHRLSTITD--ADNIIV 563
            A     L++ +  LV+ H L  + D  ADN+ +
Sbjct: 251 VARLIRELAEGKYVLVVEHDL-AVLDYLADNVHI 283