RPSBLAST alignment for GI: 254780576 and conserved domain: PRK13409

>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional. Length = 590
 Score = 56.0 bits (136), Expect = 3e-08
 Identities = 50/187 (26%), Positives = 83/187 (44%), Gaps = 39/187 (20%)

Query: 389 IGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLR-QTIGIIPQDTILFNDTL 447
           +G +G+GK+T AKLL        G++  D  ++    K S + Q I      T+      
Sbjct: 371 VGPNGIGKTTFAKLL-------AGVLKPDEGEVDPELKISYKPQYIKPDYDGTV------ 417

Query: 448 RYNILYGNPNASDQELCAAVEVAQLKSFIMK---LPNGYDTVVGERGLKLSGGEKQRVSI 504
             ++L    +               KS I+K   L    D  V +    LSGGE QRV+I
Sbjct: 418 -EDLLRSITDDLGSS--------YYKSEIIKPLQLERLLDKNVKD----LSGGELQRVAI 464

Query: 505 ARAILKNPPIIIFDEATSSLDIITERHIQTALA----TLSKNRTTLVIAHRLSTITD--A 558
           A  + ++  + + DE ++ LD+  E+ +  A A       +  T LV+ H +  I D  +
Sbjct: 465 AACLSRDADLYLLDEPSAHLDV--EQRLAVAKAIRRIAEEREATALVVDHDIYMI-DYIS 521

Query: 559 DNIIVFD 565
           D ++VF+
Sbjct: 522 DRLMVFE 528