RPSBLAST alignment for GI: 254780576 and conserved domain: PRK13648

>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 269
 Score =  107 bits (268), Expect = 1e-23
 Identities = 80/239 (33%), Positives = 118/239 (49%), Gaps = 18/239 (7%)

Query: 353 KNGHIVFNNVSFSYNHHNCI-FKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKG 411
           KN  IVF NVSF Y        K +SF I   + T+++G +G GKST+AKL+  +  +K 
Sbjct: 4   KNSIIVFKNVSFQYQSDASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEKVKS 63

Query: 412 GIITIDGQDIKKITKESLRQTIGIIPQ--DTILFNDTLRYNILYGNPNASDQELCAAVEV 469
           G I  + Q I     E LR+ IGI+ Q  D       ++Y++ +G  N +         V
Sbjct: 64  GEIFYNNQAITDDNFEKLRKHIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPYDEMHRRV 123

Query: 470 AQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITE 529
           ++     +K  +  +    E    LSGG+KQRV+IA  +  NP +II DEATS LD    
Sbjct: 124 SE----ALKQVDMLERADYEPN-ALSGGQKQRVAIAGVLALNPSVIILDEATSMLD---- 174

Query: 530 RHIQTALATL------SKNRTTLVIAHRLSTITDADNIIVFDQGTVVESGSHENLISQG 582
              +  L  L        N T + I H LS   +AD++IV ++GTV + G+   +    
Sbjct: 175 PDARQNLLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVYKEGTPTEIFDHA 233