RPSBLAST alignment for GI: 254780576 and conserved domain: PRK13649

>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 280
 Score = 87.1 bits (216), Expect = 1e-17
 Identities = 65/233 (27%), Positives = 119/233 (51%), Gaps = 22/233 (9%)

Query: 357 IVFNNVSFSYNHHNCIFKG-----ISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKG 411
           I   NVS++Y      F+G     ++  I     TA IG +G GKST+ +LL  L+    
Sbjct: 3   INLQNVSYTY-QAGTPFEGRALFDVNLTIEDGSYTAFIGHTGSGKSTIMQLLNGLHVPTQ 61

Query: 412 GIITIDGQDIKKITK----ESLRQTIGIIPQ--DTILFNDTLRYNILYGNPN--ASDQEL 463
           G + +D   I   +K    + +R+ +G++ Q  ++ LF +T+  ++ +G  N   S +E 
Sbjct: 62  GSVRVDDTLITSTSKNKDIKQIRKKVGLVFQFPESQLFEETVLKDVAFGPQNFGVSQEE- 120

Query: 464 CAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSS 523
             A  +A+ K   + L    +++  +   +LSGG+ +RV+IA  +   P I++ DE T+ 
Sbjct: 121 --AEALAREK---LALVGISESLFEKNPFELSGGQMRRVAIAGILAMEPKILVLDEPTAG 175

Query: 524 LDIITERHIQTALATLSKNRTTLV-IAHRLSTITD-ADNIIVFDQGTVVESGS 574
           LD    + + T    L ++  T+V + H +  + + AD + V ++G +V SG 
Sbjct: 176 LDPKGRKELMTLFKKLHQSGMTIVLVTHLMDDVANYADFVYVLEKGKLVLSGK 228