RPSBLAST alignment for GI: 254780576 and conserved domain: PRK14264

>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional. Length = 305
 Score = 97.6 bits (243), Expect = 8e-21
 Identities = 71/236 (30%), Positives = 113/236 (47%), Gaps = 41/236 (17%)

Query: 374 KGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYD-IKG----GIITIDGQDIKK--ITK 426
           KG+S +I     TALIG SG GKST  + L R+ D IK     G + +DGQDI +  +  
Sbjct: 62  KGVSMDIPEKSVTALIGPSGCGKSTFLRCLNRMNDRIKAARIDGSVELDGQDIYQDGVNL 121

Query: 427 ESLRQTIGIIPQDTILFNDTLRYNILYG-------------------NPNASDQELCAAV 467
             LR+ +G++ Q    F  ++R NI YG                   + +A D+ +  ++
Sbjct: 122 VELRKRVGMVFQSPNPFPKSIRENISYGPRKHGDINTGLLARLLGRDDKDAEDELVERSL 181

Query: 468 EVAQLKSFIMKLPNGYDTV---VGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSL 524
             A L          +D V   + +  L LSGG++QR+ IAR +  +P +I+ DE  S+L
Sbjct: 182 RQAAL----------WDEVNDRLDDNALGLSGGQQQRLCIARCLAVDPEVILMDEPASAL 231

Query: 525 DIITERHIQTALATLSKNRTTLVIAHRLSTITD-ADNIIVF-DQGTVVESGSHENL 578
           D I    I+  +  L++  T +V+ H +      +D   VF   G +VE    + +
Sbjct: 232 DPIATSKIEDLIEELAEEYTVVVVTHNMQQAARISDQTAVFLTGGELVEYDDTDKI 287