RPSBLAST alignment for GI: 254780576 and conserved domain: PRK15134

>gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional. Length = 529
 Score = 94.8 bits (236), Expect = 6e-20
 Identities = 75/229 (32%), Positives = 109/229 (47%), Gaps = 32/229 (13%)

Query: 369 HNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKES 428
           HN + K ISF + P +   L+GESG GKST    L RL + +G I   DGQ +  + +  
Sbjct: 298 HNVVVKNISFTLRPGETLGLVGESGSGKSTTGLALLRLINSQGEI-WFDGQPLHNLNRRQ 356

Query: 429 L---RQTIGIIPQDTILFNDTLRYNILYGNPNASDQE------------LCAAVEVAQLK 473
           L   R  I ++ QD    N +L       NP  +  +            L AA    Q+ 
Sbjct: 357 LLPVRHRIQVVFQDP---NSSL-------NPRLNVLQIIEEGLRVHQPTLSAAQREQQVI 406

Query: 474 SFIMKLPNGYDTVVGER-GLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHI 532
           + + ++  G D     R   + SGG++QR++IARA++  P +II DE TSSLD   +  I
Sbjct: 407 AVMEEV--GLDPETRHRYPAEFSGGQRQRIAIARALILKPSLIILDEPTSSLDKTVQAQI 464

Query: 533 QTALATLSKNR--TTLVIAHRLSTITD-ADNIIVFDQGTVVESGSHENL 578
              L +L +      L I+H L  +      +IV  QG VVE G  E +
Sbjct: 465 LALLKSLQQKHQLAYLFISHDLHVVRALCHQVIVLRQGEVVEQGDCERV 513