RPSBLAST alignment for GI: 254780576 and conserved domain: PRK15439

>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional. Length = 510
 Score = 64.3 bits (157), Expect = 8e-11
 Identities = 56/208 (26%), Positives = 99/208 (47%), Gaps = 20/208 (9%)

Query: 373 FKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKI-TKESLRQ 431
           F+ IS E+   +   L G  G G++ +A+ LY L   +GG I ++G++I  + T + L +
Sbjct: 279 FRNISLEVRAGEILGLAGVVGAGRTELAETLYGLRPARGGRIMLNGKEINALSTAQRLAR 338

Query: 432 TIGIIPQD---TILFNDT-LRYNI---LYGNPNASDQELCAAVEVAQLKSFIMKLP---N 481
            +  +P+D   + L+ D  L +N+    +       +    A E A L+ +   L    N
Sbjct: 339 GLVYLPEDRQSSGLYLDAPLAWNVCALTHNRRGFWIKP---ARENAVLERYRRALNIKFN 395

Query: 482 GYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSK 541
             +         LSGG +Q+V IA+ +  +P ++I DE T  +D+     I   + +++ 
Sbjct: 396 HAEQAAR----TLSGGNQQKVLIAKCLEASPQLLIVDEPTRGVDVSARNDIYQLIRSIAA 451

Query: 542 -NRTTLVIAHRLSTITD-ADNIIVFDQG 567
            N   L I+  L  I   AD ++V  QG
Sbjct: 452 QNVAVLFISSDLEEIEQMADRVLVMHQG 479