RPSBLAST alignment for GI: 254780576 and conserved domain: COG1122

>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235
 Score =  133 bits (337), Expect = 1e-31
 Identities = 68/240 (28%), Positives = 110/240 (45%), Gaps = 23/240 (9%)

Query: 354 NGHIVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGI 413
              I   N+SF Y       K +S EI   ++  LIG +G GKST+ KLL  L     G 
Sbjct: 1   LRMIEAENLSFRYPGRKAALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGLLKPTSGE 60

Query: 414 ITIDGQDIK-KITKESLRQTIGIIPQ--DTILFNDTLRYNILYGNPNASDQELCAAVEVA 470
           + +DG D   + +   LRQ +G++ Q  D  LF  T+   + +G  N         +   
Sbjct: 61  VLVDGLDTSSEKSLLELRQKVGLVFQNPDDQLFGPTVEDEVAFGLEN-------LGLPRE 113

Query: 471 QLKSFIMKLPNGYDTVVGERGLK------LSGGEKQRVSIARAILKNPPIIIFDEATSSL 524
           +++  +         +VG   L       LSGG+KQRV+IA  +   P I++ DE T+ L
Sbjct: 114 EIEERV----AEALELVGLEELLDRPPFNLSGGQKQRVAIAGVLAMGPEILLLDEPTAGL 169

Query: 525 DIITERHIQTALATLSK--NRTTLVIAHRLSTITD-ADNIIVFDQGTVVESGSHENLISQ 581
           D    R +   L  L +   +T +++ H L  + + AD ++V D G ++  G    + + 
Sbjct: 170 DPKGRRELLELLKKLKEEGGKTIIIVTHDLELVLEYADRVVVLDDGKILADGDPAEIFND 229