RPSBLAST alignment for GI: 254780576 and conserved domain: COG1126

>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]. Length = 240
 Score =  125 bits (317), Expect = 3e-29
 Identities = 70/229 (30%), Positives = 112/229 (48%), Gaps = 9/229 (3%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI 416
           I   N+S S+     + KGIS  +   +   +IG SG GKST+ + L  L +   G IT+
Sbjct: 3   IEIKNLSKSF-GDKEVLKGISLSVEKGEVVVIIGPSGSGKSTLLRCLNGLEEPDSGSITV 61

Query: 417 DGQDI-KKITKESLRQTIGIIPQDTILF-NDTLRYNILYGNPNASDQELCAAVEVAQLKS 474
           DG+D+  K     LR+ +G++ Q   LF + T+  N+              A E A    
Sbjct: 62  DGEDVGDKKDILKLRRKVGMVFQQFNLFPHLTVLENVTLAPVKVKKLSKAEAREKALELL 121

Query: 475 FIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQT 534
             + L +  D    +    LSGG++QRV+IARA+  +P +++FDE TS+LD      +  
Sbjct: 122 EKVGLADKADAYPAQ----LSGGQQQRVAIARALAMDPKVMLFDEPTSALDPELVGEVLD 177

Query: 535 ALATLSKNRTTLVIA-HRLSTITD-ADNIIVFDQGTVVESGSHENLISQ 581
            +  L++   T++I  H +    + AD +I  DQG ++E G  E     
Sbjct: 178 VMKDLAEEGMTMIIVTHEMGFAREVADRVIFMDQGKIIEEGPPEEFFDN 226