RPSBLAST alignment for GI: 254780576 and conserved domain: COG1129

>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]. Length = 500
 Score =  105 bits (264), Expect = 3e-23
 Identities = 61/227 (26%), Positives = 105/227 (46%), Gaps = 21/227 (9%)

Query: 374 KGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKIT-KESLRQT 432
            G+S  + P +  AL+GE+G GKST+ K+L  +Y    G I IDG+ +   + +++L   
Sbjct: 25  DGVSLTVRPGEVHALLGENGAGKSTLMKILSGVYPPDSGEILIDGKPVAFSSPRDALAAG 84

Query: 433 IGIIPQDTILFND-TLRYNILYGNPNAS-----DQELCAAVEVAQLKSFIMKLPNGYDTV 486
           I  + Q+  L  + ++  NI  G          D++         L    + L    DT+
Sbjct: 85  IATVHQELSLVPNLSVAENIFLGREPTRRFGLIDRKAMRRRARELLAR--LGLDIDPDTL 142

Query: 487 VGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATL----SKN 542
           VG+    LS  ++Q V IARA+  +  ++I DE T++L   T +  +     +    ++ 
Sbjct: 143 VGD----LSIAQRQMVEIARALSFDARVLILDEPTAAL---TVKETERLFDLIRRLKAQG 195

Query: 543 RTTLVIAHRLSTITD-ADNIIVFDQGTVVESGSHENLISQGGIYTSM 588
              + I+HRL  + + AD I V   G VV +       S+  +   M
Sbjct: 196 VAIIYISHRLDEVFEIADRITVLRDGRVVGTRPTAAETSEDELVRLM 242