RPSBLAST alignment for GI: 254780576 and conserved domain: COG2274

>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]. Length = 709
 Score =  343 bits (882), Expect = 7e-95
 Identities = 180/592 (30%), Positives = 293/592 (49%), Gaps = 32/592 (5%)

Query: 10  RTLKKLWPYMWPANRWDLKVRIIGAMFSVIASKFVILGIPFLLKWVTESLIEQSTASKTT 69
             L    P ++   R   +V +   +  ++A     L  P   + V + ++    +  T 
Sbjct: 140 FGLSWFIPLLFKYRRLLFEVLLASLLLQLLA-----LATPLFSQIVIDKVL-PDASRSTL 193

Query: 70  SYLTIGIVILITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFHI 129
           + L IG+++         +   +   +R +L   +G+     L  +   H+ +L   +  
Sbjct: 194 TVLAIGLLLAA-------LFEALLRLLRTYLIAHLGKRLDLELSGRFFRHLLRLPLSYFE 246

Query: 130 NYKVGKLSSAISNGIRSIEMIIRIIVVHLIPTILEFAISMAFL----WYSYGDIYVSIMA 185
              VG++ S +    R +E I   +   ++  I++   ++ FL     YS+    + +  
Sbjct: 247 KRSVGEIISRV----RELEQIREFLTGSILTLIIDLLFALIFLAVMFLYSWKLTLIVL-- 300

Query: 186 VTVILYVWFTIITSNWRVGLSKKMNNLLHECHAKVFDTLINF----ETIQYFNSEKFEIN 241
             + L V  T+I       L ++    L E  A+    L+      ET++   +E    +
Sbjct: 301 AAIPLNVLITLIFQP----LLRRKTRKLIEESAEQQSFLVETIKGIETVKALAAEPRFRS 356

Query: 242 RLEKYISKYKESAISVATSLGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFIN 301
           + +  ++K              LN  + L+  +  V+ +   +  V  GE T+G  V  N
Sbjct: 357 QWDNRLAKQVNIGFKTEKLALILNTIKSLLQQLSSVLILWFGAILVLEGELTLGQLVAFN 416

Query: 302 TLLTQLAIPLNILGTIYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLKIKNGHIVFNN 361
            L      P+  L  ++ D +Q+ + +E L +IL+   E +       L    G I F N
Sbjct: 417 MLAGYFISPITRLSQLWTDFQQAKVALERLGDILDTPPEQEGDKTLIHLPKLQGEIEFEN 476

Query: 362 VSFSYNHH-NCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQD 420
           VSF Y      + + +S EI P +K A++G SG GKST+ KLL  LY  + G I +DG D
Sbjct: 477 VSFRYGPDDPPVLEDLSLEIPPGEKVAIVGRSGSGKSTLLKLLLGLYKPQQGRILLDGVD 536

Query: 421 IKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLP 480
           +  I   SLR+ +G + QD  LF+ ++R NI  GNP A+D+E+  A ++A    FI  LP
Sbjct: 537 LNDIDLASLRRQVGYVLQDPFLFSGSIRENIALGNPEATDEEIIEAAQLAGAHEFIENLP 596

Query: 481 NGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLS 540
            GYDT VGE G  LSGG++QR+++ARA+L  P I++ DEATS+LD  TE  I   L  + 
Sbjct: 597 MGYDTPVGEGGANLSGGQRQRLALARALLSKPKILLLDEATSALDPETEAIILQNLLQIL 656

Query: 541 KNRTTLVIAHRLSTITDADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQ 592
           + RT ++IAHRLSTI  AD IIV DQG +VE GSHE L++QGG+Y  ++++Q
Sbjct: 657 QGRTVIIIAHRLSTIRSADRIIVLDQGKIVEQGSHEELLAQGGLYARLYQQQ 708