RPSBLAST alignment for GI: 254780576 and conserved domain: COG2884

>gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning]. Length = 223
 Score =  124 bits (312), Expect = 9e-29
 Identities = 66/233 (28%), Positives = 109/233 (46%), Gaps = 23/233 (9%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI 416
           I F NVS +Y       + +SF I   +   L G SG GKST+ KL+Y       G I +
Sbjct: 2   IRFENVSKAYPGGREALRDVSFHIPKGEFVFLTGPSGAGKSTLLKLIYGEERPTRGKILV 61

Query: 417 DGQDIKKITKES---LRQTIGIIPQD-------TILFNDTLRYNILYGNPNASDQELCAA 466
           +G D+ ++       LR+ IG++ QD       T+  N  L   ++   P    + +   
Sbjct: 62  NGHDLSRLKGREIPFLRRQIGVVFQDFRLLPDRTVYENVALPLRVIGKPPREIRRRVSEV 121

Query: 467 VEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDI 526
           +++  LK     LP+           +LSGGE+QRV+IARAI+  P +++ DE T +LD 
Sbjct: 122 LDLVGLKHKARALPS-----------QLSGGEQQRVAIARAIVNQPAVLLADEPTGNLDP 170

Query: 527 ITERHIQTALATLSKNRTTLVIA-HRLSTITDADN-IIVFDQGTVVESGSHEN 577
                I      +++  TT+++A H L  +    + ++  + G +V   S   
Sbjct: 171 DLSWEIMRLFEEINRLGTTVLMATHDLELVNRMRHRVLALEDGRLVRDESRGV 223