RPSBLAST alignment for GI: 254780576 and conserved domain: COG4107

>gnl|CDD|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258
 Score = 68.4 bits (167), Expect = 6e-12
 Identities = 62/229 (27%), Positives = 99/229 (43%), Gaps = 44/229 (19%)

Query: 373 FKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI---DGQDIKKIT-KES 428
            + +SF++ P +   ++GESG GK+T+ K +        G +T    DGQ     T  E+
Sbjct: 22  CRDVSFDLYPGEVLGIVGESGSGKTTLLKCISGRLTPDAGTVTYRMRDGQPRDLYTMSEA 81

Query: 429 LRQTI-----GIIPQDTILFNDTLRYNIL----------------YGNPNASDQELCAAV 467
            R+ +     G + Q+     D LR  +                 YGN  A  Q+    V
Sbjct: 82  ERRRLLRTEWGFVHQNPR---DGLRMQVSAGGNIGERLMAIGARHYGNIRAEAQDWLEEV 138

Query: 468 EVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDII 527
           E+   +  I  LP  +           SGG +QR+ IAR ++  P ++  DE T  LD+ 
Sbjct: 139 EIDLDR--IDDLPRTF-----------SGGMQQRLQIARNLVTRPRLVFMDEPTGGLDVS 185

Query: 528 TERHIQTALATLSKNR--TTLVIAHRLSTIT-DADNIIVFDQGTVVESG 573
            +  +   L  L +      +++ H L+     AD ++V  QG VVESG
Sbjct: 186 VQARLLDLLRGLVRELGLAVVIVTHDLAVARLLADRLMVMKQGQVVESG 234