RPSBLAST alignment for GI: 254780576 and conserved domain: COG4133

>gnl|CDD|33889 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]. Length = 209
 Score = 59.9 bits (145), Expect = 2e-09
 Identities = 44/164 (26%), Positives = 75/164 (45%), Gaps = 24/164 (14%)

Query: 370 NCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESL 429
             +F  +SF +   +   + G +G GK+T+ ++L  L     G +   G+ I+ + +ES 
Sbjct: 15  RTLFSDLSFTLNAGEALQITGPNGAGKTTLLRILAGLLRPDAGEVYWQGEPIQNV-RESY 73

Query: 430 RQTI-------GIIPQDTILFNDTLR-YNILYGNPNASDQELCAAVEVAQLKSFIMKLPN 481
            Q +       GI  + T L N  L  +   +G+ NA+   +  A+    L      LP 
Sbjct: 74  HQALLYLGHQPGIKTELTALEN--LHFWQRFHGSGNAAT--IWEALAQVGLAGLE-DLPV 128

Query: 482 GYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLD 525
           G           LS G+++RV++AR  L   P+ I DE  ++LD
Sbjct: 129 GQ----------LSAGQQRRVALARLWLSPAPLWILDEPFTALD 162