RPSBLAST alignment for GI: 254780576 and conserved domain: COG4170

>gnl|CDD|33911 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 330
 Score = 64.6 bits (157), Expect = 6e-11
 Identities = 65/240 (27%), Positives = 99/240 (41%), Gaps = 48/240 (20%)

Query: 375 GISFEIAPSKKTALIGESGVGKSTVAKLL--------------YRLYDIKGGIIT----- 415
            +S  +   +   L+GESG GKS +AK +               R  DI    ++     
Sbjct: 25  RVSMTLNEGEIRGLVGESGSGKSLIAKAICGVNKDNWRVTADRMRFDDIDLLRLSPRERR 84

Query: 416 -IDGQDIKKITKESL----------RQTIGIIPQDTILFNDTLRYNILYGNPNASDQELC 464
            + G ++  I +E            RQ I  IP  T       R+   +G       EL 
Sbjct: 85  KLVGHNVSMIFQEPQSCLDPSERVGRQLIQNIPAWTY----KGRWWQRFGWRKRRAIELL 140

Query: 465 AAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSL 524
             V +   K  +   P            +L+ GE Q+V IA A+   P ++I DE T+S+
Sbjct: 141 HRVGIKDHKDIMRSYPY-----------ELTEGECQKVMIAIALANQPRLLIADEPTNSM 189

Query: 525 DIITERHIQTALATLSKNRTT--LVIAHRLSTITD-ADNIIVFDQGTVVESGSHENLISQ 581
           +  T+  I   L+ L++N  T  L+I+H L  I+  AD I V   G  VES   E L++ 
Sbjct: 190 EPTTQAQIFRLLSRLNQNSNTTILLISHDLQMISQWADKINVLYCGQTVESAPSEELVTM 249