RPSBLAST alignment for GI: 254780576 and conserved domain: COG4598

>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]. Length = 256
 Score = 77.3 bits (190), Expect = 1e-14
 Identities = 61/238 (25%), Positives = 111/238 (46%), Gaps = 21/238 (8%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI 416
           +   ++   Y  H  + KG+S +       ++IG SG GKST  + +  L     G I +
Sbjct: 7   LEVEDLHKRYGEHE-VLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSAGSIRV 65

Query: 417 DGQDIKKITK-------------ESLRQTIGIIPQDTILFND-TLRYNILYGNPNASDQE 462
           +G++I+                 + LR  +G++ Q   L++  T+  N++    +     
Sbjct: 66  NGEEIRLKRDKDGQLKPADKRQLQRLRTRLGMVFQHFNLWSHMTVLENVIEAPVHVLGVS 125

Query: 463 LCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATS 522
              A+E A+   ++ K+  G           LSGG++QRV+IARA+   P +++FDE TS
Sbjct: 126 KAEAIERAE--KYLAKV--GIAEKADAYPAHLSGGQQQRVAIARALAMEPEVMLFDEPTS 181

Query: 523 SLDIITERHIQTALATLSKN-RTTLVIAHRLSTITDADNIIVF-DQGTVVESGSHENL 578
           +LD      +   +  L++  RT +V+ H +    D  + ++F  QG + E G  E +
Sbjct: 182 ALDPELVGEVLKVMQDLAEEGRTMVVVTHEMGFARDVSSHVIFLHQGKIEEEGPPEQV 239