RPSBLAST alignment for GI: 254780576 and conserved domain: COG4988

>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 559
 Score =  262 bits (670), Expect = 3e-70
 Identities = 160/568 (28%), Positives = 263/568 (46%), Gaps = 21/568 (3%)

Query: 31  IIGAMFSVIASKFVILGIPFLLKWVTESLIEQSTASKTTSYLTIGIVILITSYGTMRVVN 90
           +I A+ +V++    I+    LL  +   LIE          L + ++ L        V+ 
Sbjct: 3   VISALLAVLSG-IAIIAQAALLADILTKLIEGQLFQSLLPLLILLLIAL--------VLR 53

Query: 91  LISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFHINYKVGKLSSAISNGIRSIEMI 150
                +R+ L          +L   V+  + KL   F      G  ++    GI  +E  
Sbjct: 54  AFLAWLRERLGYRAAAKVRASLRQLVLDKLAKLGPAFIAQKPAGSAATLALEGIEQLEPY 113

Query: 151 I-RIIVVHLIPTILEFAISMAFLWYSYGDIYVSIMAVTVILYVWFTIITSNWRVGLSKKM 209
             R +    +  I+   I +A  ++++      I+ +T  L   F I+        S+K 
Sbjct: 114 YARYLPQMFLSAIVPLLILIAIFFFNWAAAL--ILLITAPLIPLFMILVGLAAKDASEKQ 171

Query: 210 NNLLHECHAKVFDTLINFETIQYFNSEKFEINRLEKYISKYKESAISVAT----SLGWLN 265
            + L        D L   ET++ F   +    R+ K    ++++ +SV      S   L 
Sbjct: 172 FSALARLSGHFLDRLRGLETLRAFGRTEATEERIRKDSEDFRKATMSVLRIAFLSSAVLE 231

Query: 266 FGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFINTLLTQLAIPLNILGTIYRDSRQSF 325
           F   L  SI +V   I        G+ T+   +F+  L  +   PL  LG+ +  +    
Sbjct: 232 FFAYL--SIALVAVYIGFRLLGE-GDLTLFAGLFVLILAPEFFQPLRDLGSFFHAAAAGE 288

Query: 326 IEIEELLNILNEKIEIQNAVNSKDLKIKNG-HIVFNNVSFSYNHHNCIFKGISFEIAPSK 384
              ++L  +L   +    +    ++  +    I   N+SF Y         ++  I   +
Sbjct: 289 AAADKLFTLLESPVATPGSGEKAEVANEPPIEISLENLSFRYPDGKPALSDLNLTIKAGQ 348

Query: 385 KTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTILFN 444
            TAL+G SG GKST+  LL        G I ++G D++ ++ E+ R+ I  + Q+  LF 
Sbjct: 349 LTALVGASGAGKSTLLNLLLGFLAPTQGEIRVNGIDLRDLSPEAWRKQISWVSQNPYLFA 408

Query: 445 DTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSI 504
            T+R NIL   P+ASD+E+ AA++ A L  F+ K P+G DTV+GE G  LSGG+ QR+++
Sbjct: 409 GTIRENILLARPDASDEEIIAALDQAGLLEFVPK-PDGLDTVIGEGGAGLSGGQAQRLAL 467

Query: 505 ARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAHRLSTITDADNIIVF 564
           ARA+L    +++ DE T+ LD  TE+ I  AL  L+K +T LVI HRL    DAD I+V 
Sbjct: 468 ARALLSPASLLLLDEPTAHLDAETEQIILQALQELAKQKTVLVITHRLEDAADADRIVVL 527

Query: 565 DQGTVVESGSHENLISQGGIYTSMWKKQ 592
           D G +VE G+HE L  + G+Y ++ K+Q
Sbjct: 528 DNGRLVEQGTHEELSEKQGLYANLLKQQ 555