RPSBLAST alignment for GI: 254780576 and conserved domain: KOG0055

>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228
 Score =  327 bits (840), Expect = 5e-90
 Identities = 172/591 (29%), Positives = 288/591 (48%), Gaps = 25/591 (4%)

Query: 11   TLKKLWPYMWPANRWDLKVRIIGAMFSVIA-SKFVILGIPFLLKWVTESLIEQSTASKTT 69
            +  +++    P    +    ++G++ + I  + + +     +   V E+           
Sbjct: 651  SFWRIFKLNKP----EWPYLLLGSLGAAIRGATYPLFAY--VFSQVLEAFYPPD--DDEL 702

Query: 70   SYLTIGIVILITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFHI 129
                    ++    G   +V+ I+N ++ + +   G+  T  L   +   + +    +  
Sbjct: 703  KREVRAWALIFLGLG---IVSGITNFLQHYFFGIAGEKLTKRLRSMMFRALLRQEVGWFD 759

Query: 130  NYK-VGKLSSAISNGIRSIEMII--RIIVVHLIPTILEFAISMAFLWYSYGDIYVSIMAV 186
            + +  G LSS ++    ++   +  R+ +V      +   I +AF+   YG     ++  
Sbjct: 760  DPENSGALSSRLATDASNVRAAVGDRLSLVVQNIAAVIIGIIIAFI---YGWRLALVVLA 816

Query: 187  TVILYVWFTIITSNWRVGLSKKMNNLLHECHAKVFDTLINFETIQYFNSEKFEINRLEKY 246
            T  L +    +   +  G SK       E      + + N  T+    +E+  +   ++ 
Sbjct: 817  TFPLLILSGYLQKKFLKGFSKDDKKAYEEASKIAIEAVSNIRTVAALCAEEKFMELYKEE 876

Query: 247  ISKYKESAI--SVATSLGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFINTLL 304
            + K ++S+    + + LG   F Q L+F +   ++    +  +  GE T  D   +   L
Sbjct: 877  LEKPRKSSFKRGLISGLG-FGFSQSLLFFV-YALSFWYGARLISNGEMTFEDVFRVFMAL 934

Query: 305  TQLAIPLNILGTIYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLK-IKNGHIVFNNVS 363
            +  A+ L    +   D  ++ I    +  IL+ K  I     S        G I F NVS
Sbjct: 935  SFTAMALGQASSYAPDISKAKIAAGSIFEILDRKPTIDPDSTSGGKLPNVKGDIEFRNVS 994

Query: 364  FSY--NHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDI 421
            F+Y       +   +S  I   +  AL+G SG GKSTV  LL R YD   G + IDG DI
Sbjct: 995  FAYPTRPDVPVLNNLSLSIRAGQTVALVGPSGSGKSTVISLLERFYDPDAGKVKIDGVDI 1054

Query: 422  KKITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPN 481
            K +  + LR+ IG++ Q+ +LFN T+R NI YG+   S++E+  A ++A   +FI  LP 
Sbjct: 1055 KDLNLKWLRKQIGLVSQEPVLFNGTIRENIAYGSEEVSEEEIIEAAKLANAHNFISSLPQ 1114

Query: 482  GYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSK 541
            GYDT VGERG++LSGG+KQR++IARAIL+NP I++ DEATS+LD  +ER +Q AL    +
Sbjct: 1115 GYDTRVGERGVQLSGGQKQRIAIARAILRNPKILLLDEATSALDSESERVVQEALDRAME 1174

Query: 542  NRTTLVIAHRLSTITDADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQ 592
             RTT+VIAHRLSTI +AD I V   G VVE G+H+ L+++ GIY  + + Q
Sbjct: 1175 GRTTIVIAHRLSTIQNADVIAVLKNGKVVEQGTHDELLAKRGIYFRLVQLQ 1225