RPSBLAST alignment for GI: 254780576 and conserved domain: KOG0057

>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 591
 Score =  478 bits (1231), Expect = e-135
 Identities = 227/581 (39%), Positives = 355/581 (61%), Gaps = 7/581 (1%)

Query: 12  LKKLWPYMWPANRWDLKVRIIGAMFSVIASKFVILGIPFLLKWVTESLIEQSTASKTTSY 71
           L+ L  Y WP +R  L+ R+  A+  ++ +K + + +PF+ K + + L      +     
Sbjct: 13  LRSLVSYKWPKSRPVLRFRVFPALGLLLGAKILNVQVPFIFKLIIDGL----NDADGNPA 68

Query: 72  LTIGIVILITSYGTMRVVNLISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFHINY 131
           +   I  L+  YG  R+ + + N +R+F++ ++ Q         V  H+  L   F ++ 
Sbjct: 69  VLSTITALLAGYGIARLGSSVFNELRNFVFAKVAQRVIRDSSSDVFRHLMSLDLSFFLSR 128

Query: 132 KVGKLSSAISNGIRSIEMIIRIIVVHLIPTILEFAISMAFLWYSYGDIYVSIMAVTVILY 191
             G L+  I  G R+I  ++  +V ++IPT+ E A+    L+Y +G  +  I   TV  Y
Sbjct: 129 GTGALNRIIDRGSRAISFVLSAMVFNIIPTLFEIALVSGILYYKFGAAFALITLGTVGAY 188

Query: 192 VWFTIITSNWRVGLSKKMNNLLHECHAKVFDTLINFETIQYFNSEKFEINRLEKYISKYK 251
             FTI+ + WR    K MNN  +    + +D+LIN+E ++ FN+E++E +R +  +  Y+
Sbjct: 189 AAFTIVVTRWRNRFRKAMNNADNSASRRAYDSLINYEIVKSFNNEEYEASRYDGSLKTYE 248

Query: 252 ESAISVATSLGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDFVFINTLLTQLAIPL 311
            + +  ++SL +LNFGQ  IFS+ +   M++ S+ +  G+ TVGD V +N+LL QL++PL
Sbjct: 249 RAGLKYSSSLAFLNFGQKAIFSVALTFIMVLGSNGIAAGKMTVGDLVMVNSLLFQLSLPL 308

Query: 312 NILGTIYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLKIKNGHIVFNNVSFSYNHHNC 371
           N LG++YR+ RQ+  ++  L  +L    +IQ A  +  +++  G I F++V FSY     
Sbjct: 309 NFLGSVYRELRQALTDMRTLFILLEVDEDIQEA--ALPIELFGGSIEFDDVHFSYGPKRK 366

Query: 372 IFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQ 431
           + KG+SF I   +K A++G +G GKST+ +LL R +D  G I+ IDGQDIK+++ ESLRQ
Sbjct: 367 VLKGVSFTIPKGEKVAIVGSNGSGKSTILRLLLRFFDYSGSIL-IDGQDIKEVSLESLRQ 425

Query: 432 TIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERG 491
           +IG++PQD++LFNDT+ YNI YGNP+ASD+E+  A + A L   I +LP+GY T+VGERG
Sbjct: 426 SIGVVPQDSVLFNDTILYNIKYGNPSASDEEVVEACKRAGLHDVISRLPDGYQTLVGERG 485

Query: 492 LKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAHR 551
           L LSGGEKQRVS+ARA LK+ PI++ DEATS+LD  TER I   +  +   RT ++I HR
Sbjct: 486 LMLSGGEKQRVSLARAFLKDAPILLLDEATSALDSETEREILDMIMDVMSGRTVIMIVHR 545

Query: 552 LSTITDADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQ 592
           L  + D D IIV D GTV E G+H  L++   +Y  +W  Q
Sbjct: 546 LDLLKDFDKIIVLDNGTVKEYGTHSELLAPSELYADLWTTQ 586