RPSBLAST alignment for GI: 254780576 and conserved domain: cd00267

>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157
 Score =  108 bits (270), Expect = 6e-24
 Identities = 58/212 (27%), Positives = 85/212 (40%), Gaps = 58/212 (27%)

Query: 359 FNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDG 418
             N+SF Y         +S  +   +  AL+G +G GKST+ + +  L     G I IDG
Sbjct: 2   IENLSFRYGGR-TALDNVSLTLKAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDG 60

Query: 419 QDIKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMK 478
           +DI K+  E                   LR  I Y               V QL      
Sbjct: 61  KDIAKLPLE------------------ELRRRIGY---------------VPQL------ 81

Query: 479 LPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALAT 538
                           SGG++QRV++ARA+L NP +++ DE TS LD  +   +   L  
Sbjct: 82  ----------------SGGQRQRVALARALLLNPDLLLLDEPTSGLDPASRERLLELLRE 125

Query: 539 LS-KNRTTLVIAHRLSTITDA-DNIIVFDQGT 568
           L+ + RT +++ H       A D +IV   G 
Sbjct: 126 LAEEGRTVIIVTHDPELAELAADRVIVLKDGK 157