RPSBLAST alignment for GI: 254780576 and conserved domain: cd03219

>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).. Length = 236
 Score = 87.4 bits (217), Expect = 9e-18
 Identities = 53/215 (24%), Positives = 94/215 (43%), Gaps = 19/215 (8%)

Query: 374 KGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTI 433
             +SF + P +   LIG +G GK+T+  L+        G +  DG+DI  +        +
Sbjct: 17  DDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFLRPTSGSVLFDGEDITGL-PPHEIARL 75

Query: 434 GIIP--QDTILFND-TLRYNILYGNPNASDQELCAAVEVAQLKSF---------IMKLPN 481
           GI    Q   LF + T+  N++      +   L  A    + +            + L +
Sbjct: 76  GIGRTFQIPRLFPELTVLENVMVAAQARTGSGLLLARARREEREARERAEELLERVGLAD 135

Query: 482 GYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLS- 540
             D   GE    LS G+++R+ IARA+  +P +++ DE  + L+      +   +  L  
Sbjct: 136 LADRPAGE----LSYGQQRRLEIARALATDPKLLLLDEPAAGLNPEETEELAELIRELRE 191

Query: 541 KNRTTLVIAHRLSTITD-ADNIIVFDQGTVVESGS 574
           +  T L++ H +  +   AD + V DQG V+  G+
Sbjct: 192 RGITVLLVEHDMDVVMSLADRVTVLDQGRVIAEGT 226