RPSBLAST alignment for GI: 254780576 and conserved domain: cd03222

>gnl|CDD|72981 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 177
 Score = 54.6 bits (131), Expect = 8e-08
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 10/96 (10%)

Query: 480 PNGYDT-------VVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHI 532
           PNG +        V   + + LSGGE QRV+IA A+L+N    +FDE ++ LDI    + 
Sbjct: 51  PNGDNDEWDGITPVYKPQYIDLSGGELQRVAIAAALLRNATFYLFDEPSAYLDIEQRLNA 110

Query: 533 QTALATLSKN--RTTLVIAHRLSTITD-ADNIIVFD 565
             A+  LS+   +T LV+ H L+ +   +D I VF+
Sbjct: 111 ARAIRRLSEEGKKTALVVEHDLAVLDYLSDRIHVFE 146