RPSBLAST alignment for GI: 254780576 and conserved domain: cd03247

>gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.. Length = 178
 Score =  148 bits (374), Expect = 6e-36
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 41/218 (18%)

Query: 357 IVFNNVSFSYNHHNC-IFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIIT 415
           +  NNVSFSY      + K +S E+   +K AL+G SG GKST+ +LL      + G IT
Sbjct: 1   LSINNVSFSYPEQEQQVLKNLSLELKQGEKIALLGRSGSGKSTLLQLLTGDLKPQQGEIT 60

Query: 416 IDGQDIKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSF 475
           +DG  +  + +++L   I ++ Q   LF+ TLR N+                        
Sbjct: 61  LDGVPVSDL-EKALSSLISVLNQRPYLFDTTLRNNL------------------------ 95

Query: 476 IMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTA 535
                          G + SGGE+QR+++AR +L++ PI++ DE T  LD ITER + + 
Sbjct: 96  ---------------GRRFSGGERQRLALARILLQDAPIVLLDEPTVGLDPITERQLLSL 140

Query: 536 LATLSKNRTTLVIAHRLSTITDADNIIVFDQGTVVESG 573
           +  + K++T + I H L+ I   D I+  + G ++  G
Sbjct: 141 IFEVLKDKTLIWITHHLTGIEHMDKILFLENGKIIMQG 178