RPSBLAST alignment for GI: 254780576 and conserved domain: cd03262

>gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQMP system of S. typhimurium, where HisJ is the extracellular solute binding proteins and HisP is the ABC protein.. Length = 213
 Score =  113 bits (284), Expect = 2e-25
 Identities = 66/225 (29%), Positives = 104/225 (46%), Gaps = 24/225 (10%)

Query: 357 IVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITI 416
           I   N+  S+   + + KGI   +   +   +IG SG GKST+ + +  L +   G I I
Sbjct: 1   IEIKNLHKSFGDFH-VLKGIDLTVKKGEVVVIIGPSGSGKSTLLRCINLLEEPDSGTIII 59

Query: 417 DGQDIKKITKE--SLRQTIGIIPQD-------TILFNDTLRYNILYGNPNASDQELC-AA 466
           DG  +    K    LRQ +G++ Q        T+L N TL    + G   A  +E     
Sbjct: 60  DGLKLTDDKKNINELRQKVGMVFQQFNLFPHLTVLENITLAPIKVKGMSKAEAEERALEL 119

Query: 467 VEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDI 526
           +E   L       P            +LSGG++QRV+IARA+  NP +++FDE TS+LD 
Sbjct: 120 LEKVGLADKADAYPA-----------QLSGGQQQRVAIARALAMNPKVMLFDEPTSALDP 168

Query: 527 ITERHIQTALATLSKNRTTLVIA-HRLSTITD-ADNIIVFDQGTV 569
                +   +  L++   T+V+  H +    + AD +I  D G +
Sbjct: 169 ELVGEVLDVMKDLAEEGMTMVVVTHEMGFAREVADRVIFMDDGRI 213