RPSBLAST alignment for GI: 254780576 and conserved domain: cd03267

>gnl|CDD|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.. Length = 236
 Score = 69.9 bits (171), Expect = 2e-12
 Identities = 55/215 (25%), Positives = 95/215 (44%), Gaps = 31/215 (14%)

Query: 374 KGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTI 433
           KGISF I   +    IG +G GK+T  K+L  L     G + + G    K  K+ LR+ I
Sbjct: 38  KGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRVAGLVPWKRRKKFLRR-I 96

Query: 434 GII------------PQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPN 481
           G++              D+      + Y++          EL   +++ +    ++  P 
Sbjct: 97  GVVFGQKTQLWWDLPVIDSFYLLAAI-YDLPPARFKKRLDELSELLDLEE----LLDTPV 151

Query: 482 GYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSK 541
                      +LS G++ R  IA A+L  P I+  DE T  LD++ + +I+  L   ++
Sbjct: 152 ----------RQLSLGQRMRAEIAAALLHEPEILFLDEPTIGLDVVAQENIRNFLKEYNR 201

Query: 542 NRTTLVI--AHRLSTITD-ADNIIVFDQGTVVESG 573
            R T V+  +H +  I   A  ++V D+G ++  G
Sbjct: 202 ERGTTVLLTSHYMKDIEALARRVLVIDKGRLLYDG 236