RPSBLAST alignment for GI: 254780576 and conserved domain: cd03293

>gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220
 Score =  108 bits (271), Expect = 6e-24
 Identities = 56/230 (24%), Positives = 100/230 (43%), Gaps = 31/230 (13%)

Query: 357 IVFNNVSFSY---NHHNCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGI 413
           +   NVS +Y          + IS  +   +  AL+G SG GKST+ +++  L     G 
Sbjct: 1   LEVRNVSKTYGGGGGAVTALEDISLSVEEGEFVALVGPSGCGKSTLLRIIAGLERPTSGE 60

Query: 414 ITIDGQDIKKITKESLRQTIGIIPQDTILFN-DTLRYNILYG------NPNASDQELCAA 466
           + +DG+ +     +      G + Q   L    T+  N+  G          + +     
Sbjct: 61  VLVDGEPVTGPGPD-----RGYVFQQDALLPWLTVLDNVALGLELQGVPKAEARERAEEL 115

Query: 467 VEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDI 526
           +E+  L  F    P+           +LSGG +QRV++ARA+  +P +++ DE  S+LD 
Sbjct: 116 LELVGLSGFENAYPH-----------QLSGGMRQRVALARALAVDPDVLLLDEPFSALDA 164

Query: 527 ITERHIQTALATL--SKNRTTLVIAHRLS-TITDADNIIVFDQ--GTVVE 571
           +T   +Q  L  +     +T L++ H +   +  AD ++V     G +V 
Sbjct: 165 LTREQLQEELLDIWRETGKTVLLVTHDIDEAVFLADRVVVLSARPGRIVA 214