RPSBLAST alignment for GI: 254780576 and conserved domain: cd03369

>gnl|CDD|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.. Length = 207
 Score =  165 bits (419), Expect = 3e-41
 Identities = 83/223 (37%), Positives = 121/223 (54%), Gaps = 20/223 (8%)

Query: 353 KNGHIVFNNVSFSYNHH-NCIFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKG 411
           ++G I   N+S  Y      + K +SF++   +K  ++G +G GKST+   L+R  + + 
Sbjct: 3   EHGEIEVENLSVRYAPDLPPVLKNVSFKVKAGEKIGIVGRTGAGKSTLILALFRFLEAEE 62

Query: 412 GIITIDGQDIKKITKESLRQTIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQ 471
           G I IDG DI  I  E LR ++ IIPQD  LF+ T+R N+   +   SD+E+  A+ V+ 
Sbjct: 63  GKIEIDGIDISTIPLEDLRSSLTIIPQDPTLFSGTIRSNLDPFD-EYSDEEIYGALRVS- 120

Query: 472 LKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERH 531
                            E GL LS G++Q + +ARA+LK P +++ DEAT+S+D  T+  
Sbjct: 121 -----------------EGGLNLSQGQRQLLCLARALLKRPRVLVLDEATASIDYATDAL 163

Query: 532 IQTALATLSKNRTTLVIAHRLSTITDADNIIVFDQGTVVESGS 574
           IQ  +     N T L IAHRL TI D D I+V D G V E   
Sbjct: 164 IQKTIREEFTNSTILTIAHRLRTIIDYDKILVMDAGEVKEYDH 206