BLAST/BLAST alignment of GI: 254780576 and GI: 254780340
>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348
 Score = 50.8 bits (120), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 3/89 (3%)

Query: 494 LSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSK--NRTTLVIAHR 551
           LSGG KQRV  ARA     PI++ DE  SSLD +    +Q  L  L +   +T + ++H 
Sbjct: 170 LSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVSHD 229

Query: 552 LSTITDADN-IIVFDQGTVVESGSHENLI 579
           ++      N I + + G +++ G+ + +I
Sbjct: 230 INEAFRLGNRIAIMEGGRIIQCGTPQEII 258