BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780577|ref|YP_003064990.1| phosphatidylserine decarboxylase [Candidatus Liberibacter asiaticus str. psy62] (232 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780577|ref|YP_003064990.1| phosphatidylserine decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 232 Score = 476 bits (1224), Expect = e-136, Method: Compositional matrix adjust. Identities = 232/232 (100%), Positives = 232/232 (100%) Query: 1 MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERV 60 MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERV Sbjct: 1 MNLIQAIRKILVPIHFHGWPFIVSFAAFTIIIGMWSYGLLWFGAILTVWCAYFFRDPERV 60 Query: 61 TPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIK 120 TPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIK Sbjct: 61 TPIDPNLLISPADGLVSAICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIGGEVIK 120 Query: 121 SVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAG 180 SVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAG Sbjct: 121 SVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIGIVQIAGFVARRIVCWVKPTMKVEAG 180 Query: 181 MRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT 232 MRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT Sbjct: 181 MRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT 232 >gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter asiaticus str. psy62] Length = 1398 Score = 25.8 bits (55), Expect = 0.70, Method: Compositional matrix adjust. Identities = 40/184 (21%), Positives = 76/184 (41%), Gaps = 33/184 (17%) Query: 60 VTPIDPNLLISPADGLVS----AICEMSPPPELELENEVMLRLSIFMNIFDCHVNRMPIG 115 VT +D + + SP DG+V +C S + + L++ + M+ + + +R+ G Sbjct: 938 VTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQI-LDMSGQEQYSHRIMYG 996 Query: 116 GEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIG-------------IVQIAGF 162 ++ +G + + SE + ++ + G +G I + G Sbjct: 997 AKLFVD---DGGVIECG-QRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGI 1052 Query: 163 VARRIVCW--------VKPTMKV--EAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVA 212 R+++ W +KP + V E G+ R G+ FLP DA + V GQK Sbjct: 1053 AKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSAR-GTDARWFLPVDALLSVSPGQKVST 1111 Query: 213 GETV 216 G+ + Sbjct: 1112 GDVL 1115 >gi|254780606|ref|YP_003065019.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 744 Score = 23.5 bits (49), Expect = 3.3, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Query: 195 FLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLLVCRT 232 F AN+ + +G KT++GE+VIA+ + P +LV T Sbjct: 385 FSHSKANLALCLG-KTISGESVIADL-ANMPHILVAGT 420 >gi|254780873|ref|YP_003065286.1| aspartate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 411 Score = 23.5 bits (49), Expect = 3.6, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Query: 99 SIFMNIFDCHVNRMPIGGEVIKSVHRNGQFMNAALDKASEQNERQSLVLKTIHGNIG 155 SIF + + H+N I I++V +GQ+++ S E+ VL NIG Sbjct: 283 SIFSPLAEAHINIDMI----IQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIG 335 >gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 23.1 bits (48), Expect = 4.3, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 81 EMSPPPELELENEV 94 + SPPP L ++N+V Sbjct: 227 QQSPPPHLRMKNKV 240 >gi|254780600|ref|YP_003065013.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 22.7 bits (47), Expect = 5.4, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Query: 39 LLWFGAILTVWCAY-FFR 55 LLW A+LT++ Y +FR Sbjct: 170 LLWISALLTIYSGYDYFR 187 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.142 0.448 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 144,794 Number of Sequences: 1233 Number of extensions: 5761 Number of successful extensions: 14 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 6 length of query: 232 length of database: 328,796 effective HSP length: 71 effective length of query: 161 effective length of database: 241,253 effective search space: 38841733 effective search space used: 38841733 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 37 (18.9 bits)