RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780578|ref|YP_003064991.1| phosphatidylserine synthase [Candidatus Liberibacter asiaticus str. psy62] (298 letters) >2ajt_A L-arabinose isomerase; arabinose catabolism, carbohydrate metabolism, structural genomics, PSI, protein structure initiative; 2.60A {Escherichia coli} SCOP: b.43.2.2 c.85.1.2 PDB: 2hxg_A Length = 500 Score = 31.0 bits (70), Expect = 0.37 Identities = 20/102 (19%), Positives = 37/102 (36%), Gaps = 11/102 (10%) Query: 14 KKKYNVLPDDFVVPSDQDEARYS--FYKGKRWSLQEKEIPPFKFLFPNL--VTILAICAG 69 + Y + P + + + G + L++ F F +L + L Sbjct: 234 ESCYTMTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHGLKQLP-GLA 292 Query: 70 FS-----GIGSAIEGNYETAVCMVLVAAFLDGIDGRIARFME 106 G G A EG+++TA + ++ G+ G FME Sbjct: 293 VQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGG-TSFME 333 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 29.6 bits (65), Expect = 0.79 Identities = 10/31 (32%), Positives = 13/31 (41%), Gaps = 8/31 (25%) Query: 106 EATSKFGAQLDSLADVINFGVAPSLVTYIAV 136 +A K A L AD AP+L A+ Sbjct: 20 QALKKLQASLKLYAD----DSAPAL----AI 42 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 29.5 bits (66), Expect = 1.0 Identities = 36/185 (19%), Positives = 53/185 (28%), Gaps = 82/185 (44%) Query: 8 KEIPRGKKKYNVL---PDDFVV-------------------PSDQDEARYSFYKGKRWSL 45 +P GK+ L + VV PS D++R F + K Sbjct: 358 SHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERK---- 413 Query: 46 QEKEIPPF--KFL-----F--PNL--VTILAICAGFSGIGSAIEGN------YETAVCMV 88 F +FL F L + L I + Y+T Sbjct: 414 -----LKFSNRFLPVASPFHSHLLVPASDL-INKDLVKNNVSFNAKDIQIPVYDTF---- 463 Query: 89 LVAAFLDGIDGR-------------IAR---FMEATSKFGAQLDSLADVINFGVAPSLVT 132 DG D R I R E T++F A +++FG P + Sbjct: 464 ------DGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKA-----THILDFG--PGGAS 510 Query: 133 YIAVL 137 + VL Sbjct: 511 GLGVL 515 >2j8s_A ACRB, acriflavine resistance protein B; membrane protein/complex, designed ankyrin repeat protein, multidrug resistance protein; HET: LMT LMU; 2.54A {Escherichia coli} PDB: 2dhh_A 1iwg_A 2dr6_A* 2drd_A* 2hqf_A 2hqg_A 2hqd_A 2hqc_A 2i6w_A 1oy6_A* 1oy9_A* 1oyd_A* 1oy8_A* 1oye_A 2rdd_A* 2w1b_A* 3d9b_A 1t9x_A* 1t9t_A* 1t9v_A* ... Length = 1055 Score = 27.8 bits (61), Expect = 3.0 Identities = 12/57 (21%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 240 VLPIVLCSVAYIAFMIHFLWEMI---IFSTLCYIMLLPISFYCWKKRYGIKPEQKKH 293 V+P+V+ + A ++ + +T+ I +P+ F ++R+ K E +H Sbjct: 986 VMPLVISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEH 1042 >3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Length = 444 Score = 27.7 bits (60), Expect = 3.6 Identities = 13/125 (10%), Positives = 36/125 (28%), Gaps = 4/125 (3%) Query: 160 ARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLMLPLYINFLGFKISVIYGYGSTIYAMII 219 A+ + + E+ W +L L + + + I + + + Sbjct: 303 AKDGELPEFFERKVWFKSTEGLYITSALGVLFALLFNMEGV----ASITSAVFMVIYLFV 358 Query: 220 SFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMIIFSTLCYIMLLPISFYC 279 + G+K F +VL + + + + + + + I Sbjct: 359 ILSHYILIDEVGGRKEIVIFSFIVVLGVFLLLLYYQWITNRFVFYGIIATFIGVLIFEII 418 Query: 280 WKKRY 284 ++K Sbjct: 419 YRKVT 423 >2e60_A SFRS8 protein, splicing factor, arginine/serine-rich 8; SURP domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Score = 26.8 bits (59), Expect = 5.8 Identities = 10/51 (19%), Positives = 19/51 (37%), Gaps = 11/51 (21%) Query: 20 LPDDFVVPSDQDE-------ARYSFYKGKRW--SLQEKEI--PPFKFLFPN 59 +P D +P A + +G ++ L+ K+ F FL + Sbjct: 15 VPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFD 65 >1w4s_A Polybromo, polybromo 1 protein; BAH, bromo-associated homology domain, chromatin remodelling, PBAF, SWI/SNF-B, RSC, nuclear protein; 1.55A {Gallus gallus} Length = 174 Score = 26.8 bits (59), Expect = 6.1 Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 5 LQCKEIPRGKKKYNVLPDDFVVPSDQDEARYSFYKGKRWSLQ--EKEIPPFKFLFP 58 + KE + + D +V S SF K K W++ P P Sbjct: 107 MFVKEYFKLCPENFRDEDVYVCESRYSAKTKSFKKIKLWTMPVSSVRFVPRDVPLP 162 >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Length = 434 Score = 26.5 bits (57), Expect = 6.9 Identities = 9/60 (15%), Positives = 15/60 (25%), Gaps = 5/60 (8%) Query: 65 AICAGFSGIGSAIEGNYETAVCMVLVAAFL-----DGIDGRIARFMEATSKFGAQLDSLA 119 + SGI + + E V + L + R M + L Sbjct: 51 LLLDRQSGIRTLDDPFVEEFDLPVRIGGHLLEEFDHQLTRIELRRMGYLQRMSTVLSRRL 110 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.329 0.143 0.454 Gapped Lambda K H 0.267 0.0496 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 2,735,414 Number of extensions: 126999 Number of successful extensions: 347 Number of sequences better than 10.0: 1 Number of HSP's gapped: 345 Number of HSP's successfully gapped: 17 Length of query: 298 Length of database: 5,693,230 Length adjustment: 92 Effective length of query: 206 Effective length of database: 3,462,782 Effective search space: 713333092 Effective search space used: 713333092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 56 (25.9 bits)