RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780578|ref|YP_003064991.1| phosphatidylserine synthase [Candidatus Liberibacter asiaticus str. psy62] (298 letters) >d1s0pa_ a.192.1.1 (A:) N-terminal domain of adenylylcyclase associated protein, CAP {Dictyostelium discoideum [TaxId: 44689]} Length = 176 Score = 26.6 bits (59), Expect = 2.7 Identities = 6/33 (18%), Positives = 15/33 (45%) Query: 90 VAAFLDGIDGRIARFMEATSKFGAQLDSLADVI 122 V F + +D I F+ + K ++ + + + Sbjct: 2 VKEFQNLVDQHITPFVALSKKLAPEVGNQVEQL 34 >d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Length = 193 Score = 26.1 bits (57), Expect = 3.8 Identities = 7/84 (8%), Positives = 21/84 (25%), Gaps = 3/84 (3%) Query: 200 LGFKISVIYGYGSTIYAMIISFLLCSRLPVWSGKKIHRKFVLPIVLCSVAYIAFMIHFLW 259 G + + G ++ V S K + +V+ + + Sbjct: 29 AGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSR---EMVVKVKEPLPAEYDLMQ 85 Query: 260 EMIIFSTLCYIMLLPISFYCWKKR 283 + + T ++ + Sbjct: 86 KDQLLFTYLHLAAARELTEQLMRV 109 >d1f3ub_ b.65.1.1 (B:) TFIIF alpha subunit, Rap74 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Score = 25.6 bits (56), Expect = 5.1 Identities = 12/46 (26%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Query: 12 RGKKKYNVL---PDDFVVPSDQDEARYSFYKGKRWSLQEKEIPPFK 54 KKYN++ D V + ++AR + QE+E+P Sbjct: 17 NTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESG 62 >d1ohfa_ b.121.4.8 (A:) Tetraomegavirus capsid protein {Nudaurelia capensis omega virus [TaxId: 12541]} Length = 539 Score = 25.3 bits (55), Expect = 5.6 Identities = 11/35 (31%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Query: 52 PFKFLFPNLVTILAICAGFSGIGSAIEGNYETAVC 86 F P GF GI +++ N TAVC Sbjct: 414 AISFTNPG-FDRNLDLPGFGGIRDSLDVNMSTAVC 447 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.329 0.143 0.454 Gapped Lambda K H 0.267 0.0522 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,198,059 Number of extensions: 57035 Number of successful extensions: 136 Number of sequences better than 10.0: 1 Number of HSP's gapped: 135 Number of HSP's successfully gapped: 11 Length of query: 298 Length of database: 2,407,596 Length adjustment: 85 Effective length of query: 213 Effective length of database: 1,240,546 Effective search space: 264236298 Effective search space used: 264236298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 53 (24.7 bits)