HHsearch alignment for GI: 254780579 and conserved domain: COG1434

>COG1434 Uncharacterized conserved protein [Function unknown].
Probab=99.91  E-value=1.2e-22  Score=158.47  Aligned_cols=142  Identities=26%  Similarity=0.218  Sum_probs=112.0

Q ss_pred             CCCCCCEEEEECCCH------HHHHHHHHHHHHCCCCCEECCCCCCCCCHHHHHHHHHHHCCCCHHHEECCCCCCCHHHH
Q ss_conf             545687899946985------79999999999689982451587654678999998765158861332204666660256
Q gi|254780579|r   33 DHPSVSAIVVLTGEP------IRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN  106 (207)
Q Consensus        33 ~~~~~DaIVVLgGg~------~Ri~~a~~L~~~g~~~~ii~SG~~~~~~~~~~~~~~~~~~~i~~~~I~~e~~s~~T~en  106 (207)
T Consensus        61 ~~~~~~~iv~~Gg~~~~~~~~~rl~~~~~~~~~~~~~~v~~s~~~~~---~~~~~~~~~~~gv~~~~i~~e~~s~~T~eN  137 (223)
T COG1434          61 LPGLADAIVVLGGGSRLTDHLIRLLEAARLAKILPISGVLESGGVIE---IQATRRYLENLGVPAERIILEDRSRNTVEN  137 (223)
T ss_pred             CCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCH---HHHHHHHHHHCCCCHHHEEEECCCCCHHHH
T ss_conf             54568889984887543589999999999999724367066765214---778889999859987782420777768999


Q ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9999999986499818985114421999999998629987999641676667542116989999999999999999
Q gi|254780579|r  107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL  182 (207)
Q Consensus       107 a~~~~~~l~~~~~~~iiLVTs~yHm~RA~~~f~~~~p~i~i~~~pv~~~~~~~~~Ww~~~~~~~~~~~Ey~K~l~~  182 (207)
T Consensus       138 a~~s~~~l~~~~~~~~ilVTs~~Hm~Ra~~~~~~~g~~~--~p~p~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  208 (223)
T COG1434         138 ARFSRRLLRTQGPESVILVTSPYHMPRALLLFRKLGISV--IPYPVGFLDRN---ILRLPLSLLALAEALLKSLRA  208 (223)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCC--CCCCCCCCCCC---CHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999739837999889862899999999828988--54542345532---102055551567999999999