BLAST/PSIBLAST alignment of GI: 254780579 and GI: 218462839 at iteration 1
>gi|218462839|ref|ZP_03502930.1| hypothetical protein RetlK5_26822 [Rhizobium etli Kim 5] Length = 236
 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 109/185 (58%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 32  LRWGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKG 91

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+E S W     + 
Sbjct: 92  AGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGHDAIDTIGNAEETSNWIHAKGYR 151

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT++YHMPRT  EL  ++  ++FIPYP+++ DL+  +       +RV+L EYLK+L
Sbjct: 152 SVLVVTNNYHMPRTLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYLKVL 211

Query: 181 LLSIQ 185
           L   +
Sbjct: 212 LAGAR 216