BLAST/PSIBLAST alignment of GI: 254780579 and GI: 241206553 at iteration 1
>gi|241206553|ref|YP_002977649.1| hypothetical protein Rleg_3867 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 238
>gi|240860443|gb|ACS58110.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 238
 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (58%), Gaps = 3/187 (1%)

Query: 2   RYFWYGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLE 58
           R   +G F CL+   +   GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+
Sbjct: 32  RLLRWGGFACLLAIALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQ 91

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G+++ ISGVH + +   + +      DL  CC+DIGY A++T GNA+EAS W     
Sbjct: 92  KGAGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGYDAIDTIGNAEEASNWIHTKG 151

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  VLIVT++YHMPR+  EL  ++  ++FI YP+++ DL+  +       +RV+L EY+K
Sbjct: 152 YRSVLIVTNNYHMPRSLAELSYVDPDIEFIAYPVVNSDLKSRNWFTDPNAMRVMLAEYVK 211

Query: 179 ILLLSIQ 185
           +LL   +
Sbjct: 212 VLLTGAR 218