BLAST/PSIBLAST alignment of GI: 254780579 and GI: 315121772 at iteration 1
>gi|315121772|ref|YP_004062261.1| hypothetical protein CKC_00110 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 188
>gi|313495174|gb|ADR51773.1| hypothetical protein CKC_00110 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 188
 Score =  283 bits (725), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 160/186 (86%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRY WY L  CLIFFI GF+ FI+Y+ Q+ IP +PS++AIVVLTGEP RIE+AFELLEN+
Sbjct: 1   MRYLWYSLAACLIFFIGGFVLFIQYIVQIPIPANPSINAIVVLTGEPNRIEKAFELLENK 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IG+++FISGVHHSVSKDILLQKIPIR+DLAECC+DIGYKALNT GNA+EA  W  K+++H
Sbjct: 61  IGQRVFISGVHHSVSKDILLQKIPIRKDLAECCVDIGYKALNTAGNAKEALEWIRKHDYH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLI+THDYH+PR  LEL R NS  +F+PYPII+HDL++N+ I  +K+LR+  IEYLKIL
Sbjct: 121 HVLIITHDYHIPRILLELNRKNSMTKFVPYPIITHDLQKNTLILYMKMLRMTFIEYLKIL 180

Query: 181 LLSIQL 186
           LLS+Q+
Sbjct: 181 LLSLQI 186