BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780579|ref|YP_003064992.1| hypothetical protein
CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040256|gb|ACT57052.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ
Sbjct: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH
Sbjct: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL
Sbjct: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180

Query: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207
           LLSIQLSLSTQTASQFFITLIEEITVK
Sbjct: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207


>gi|315121772|ref|YP_004062261.1| hypothetical protein CKC_00110 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495174|gb|ADR51773.1| hypothetical protein CKC_00110 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 188

 Score =  283 bits (725), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 160/186 (86%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRY WY L  CLIFFI GF+ FI+Y+ Q+ IP +PS++AIVVLTGEP RIE+AFELLEN+
Sbjct: 1   MRYLWYSLAACLIFFIGGFVLFIQYIVQIPIPANPSINAIVVLTGEPNRIEKAFELLENK 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IG+++FISGVHHSVSKDILLQKIPIR+DLAECC+DIGYKALNT GNA+EA  W  K+++H
Sbjct: 61  IGQRVFISGVHHSVSKDILLQKIPIRKDLAECCVDIGYKALNTAGNAKEALEWIRKHDYH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLI+THDYH+PR  LEL R NS  +F+PYPII+HDL++N+ I  +K+LR+  IEYLKIL
Sbjct: 121 HVLIITHDYHIPRILLELNRKNSMTKFVPYPIITHDLQKNTLILYMKMLRMTFIEYLKIL 180

Query: 181 LLSIQL 186
           LLS+Q+
Sbjct: 181 LLSLQI 186


>gi|218680941|ref|ZP_03528838.1| hypothetical protein RetlC8_19678 [Rhizobium etli CIAT 894]
          Length = 216

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 111/183 (60%), Gaps = 3/183 (1%)

Query: 6   YGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +G F C++   +   GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 14  WGGFACVLTMALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKGAG 73

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+EAS W   N +  V
Sbjct: 74  KRLLISGVHPTTTPRQIRRMTQGSADLFSCCVDIGHDAIDTIGNAEEASNWIHANGYRSV 133

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY+K+LL 
Sbjct: 134 IVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYVKVLLA 193

Query: 183 SIQ 185
             +
Sbjct: 194 GAR 196


>gi|241206553|ref|YP_002977649.1| hypothetical protein Rleg_3867 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860443|gb|ACS58110.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 238

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (58%), Gaps = 3/187 (1%)

Query: 2   RYFWYGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLE 58
           R   +G F CL+   +   GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+
Sbjct: 32  RLLRWGGFACLLAIALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQ 91

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G+++ ISGVH + +   + +      DL  CC+DIGY A++T GNA+EAS W     
Sbjct: 92  KGAGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGYDAIDTIGNAEEASNWIHTKG 151

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  VLIVT++YHMPR+  EL  ++  ++FI YP+++ DL+  +       +RV+L EY+K
Sbjct: 152 YRSVLIVTNNYHMPRSLAELSYVDPDIEFIAYPVVNSDLKSRNWFTDPNAMRVMLAEYVK 211

Query: 179 ILLLSIQ 185
           +LL   +
Sbjct: 212 VLLTGAR 218


>gi|218462839|ref|ZP_03502930.1| hypothetical protein RetlK5_26822 [Rhizobium etli Kim 5]
          Length = 236

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 109/185 (58%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 32  LRWGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKG 91

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+E S W     + 
Sbjct: 92  AGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGHDAIDTIGNAEETSNWIHAKGYR 151

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT++YHMPRT  EL  ++  ++FIPYP+++ DL+  +       +RV+L EYLK+L
Sbjct: 152 SVLVVTNNYHMPRTLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYLKVL 211

Query: 181 LLSIQ 185
           L   +
Sbjct: 212 LAGAR 216


>gi|239833000|ref|ZP_04681329.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239825267|gb|EEQ96835.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 302

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 118/184 (64%), Gaps = 3/184 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LFV L+ F++GF++F   V  M  P  D P+  AI+VLTG   RI+ A  LL+++ G+++
Sbjct: 105 LFVILLAFLVGFVAFGEKVTSMQPPAIDEPA-DAIIVLTGGQSRIQAAVNLLKDKRGKRL 163

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S ++ +L +     Q L +CC+D+   ALNT GNA E+  W   NN+  V++V
Sbjct: 164 LISGVHPSTNEKVLQRATHADQSLFDCCVDLDRSALNTIGNAAESERWIRTNNYRRVILV 223

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+  +   V+F+PYP+++ +  E+S + +   LRVL IEY+K L   ++
Sbjct: 224 TNNYHIPRSTLEMSYLMKDVEFVPYPVVNGERREHSWVAEGDTLRVLFIEYVKYLGAVVR 283

Query: 186 LSLS 189
           +  S
Sbjct: 284 VGAS 287


>gi|222149964|ref|YP_002550921.1| hypothetical protein Avi_4029 [Agrobacterium vitis S4]
 gi|221736946|gb|ACM37909.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 246

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 103/181 (56%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +RY  Y + + +   + GF+ F   V  M  P  P   AIVVLTG   RI++A +LL   
Sbjct: 38  LRYGGYAILLLMACLVAGFLHFADDVTAMMPPAEPKADAIVVLTGGYQRIDQAVDLLRKG 97

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGVH S S   + +      DL  CC+D+GY+A++T GNA E + W     F 
Sbjct: 98  SGRRLLISGVHPSTSPATIRKMTQASPDLFACCVDMGYRAIDTIGNANETAQWIHDKGFS 157

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT +YHM R+ +EL+R +   QFIPYP+++ DL   +       LR L+ EY KIL
Sbjct: 158 SVLVVTSNYHMRRSLMELRRTDHETQFIPYPVVTADLRTRAWYADPNALRTLMSEYAKIL 217

Query: 181 L 181
           +
Sbjct: 218 I 218


>gi|153008321|ref|YP_001369536.1| hypothetical protein Oant_0986 [Ochrobactrum anthropi ATCC 49188]
 gi|151560209|gb|ABS13707.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 302

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 120/191 (62%), Gaps = 7/191 (3%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LFV L+ F++GF++F   V  M  P  D P+  AI+VLTG   RI+ A +LL+++ G+++
Sbjct: 105 LFVILLAFLVGFVAFGEKVTSMQPPAIDEPA-DAIIVLTGGQSRIQAAVDLLKDKRGKRL 163

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH + ++  L +     Q L +CC+D+   ALNT GNA E+  W   NN+  V++V
Sbjct: 164 LISGVHPATNEKALQRATHADQSLFDCCVDLDRSALNTIGNATESERWIRTNNYRRVILV 223

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ D  E+S + +   LRVL IEY+K L  +++
Sbjct: 224 TNNYHIPRSTLEMSYRMKDVEFIPYPVVNGDRREHSWVSEGDTLRVLFIEYVKYLGAAVR 283

Query: 186 LS----LSTQT 192
           +       TQT
Sbjct: 284 VGTTELFGTQT 294


>gi|209551150|ref|YP_002283067.1| hypothetical protein Rleg2_3574 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536906|gb|ACI56841.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 238

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 110/183 (60%), Gaps = 3/183 (1%)

Query: 6   YGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +G F C++   +   GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 36  WGGFACVLAIALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKGAG 95

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+EAS W   N +  V
Sbjct: 96  KRLLISGVHPTTTPRQIRRMTQGSADLFSCCVDIGHDAIDTIGNAEEASNWIHANGYRSV 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 156 IVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 215

Query: 183 SIQ 185
             +
Sbjct: 216 GAR 218


>gi|116254067|ref|YP_769905.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258715|emb|CAK09820.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 236

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 109/187 (58%), Gaps = 3/187 (1%)

Query: 2   RYFWYGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLE 58
           R   +G F CL+   +   GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+
Sbjct: 30  RLLRWGGFACLLAIALVFGGFLRFADSVTTLKPPTEPKADAIVVLTGGYQRIDQAVELLQ 89

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G+++ ISG H + +   + +      DL  CC+DIGY A++T GNA+EAS W     
Sbjct: 90  KGAGKRLLISGAHPTTTPAQIRKMTQGSADLFSCCVDIGYDAIDTIGNAEEASNWIHAKG 149

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  VLIVT++YHMPR+  EL  ++  ++FI YP+++ DL+  +       +RV+L EY+K
Sbjct: 150 YRSVLIVTNNYHMPRSLAELSYVDPDIEFIAYPVVNSDLKSRNWFTDPNAMRVMLAEYVK 209

Query: 179 ILLLSIQ 185
           +LL   +
Sbjct: 210 VLLTGAR 216


>gi|190893641|ref|YP_001980183.1| hypothetical protein RHECIAT_CH0004075 [Rhizobium etli CIAT 652]
 gi|190698920|gb|ACE93005.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 236

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 109/183 (59%), Gaps = 3/183 (1%)

Query: 6   YGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +G F C++   +   GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  +G
Sbjct: 34  WGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGVG 93

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      +L  CC+DIG+ AL+T GNA+E S W     +  V
Sbjct: 94  KRLLISGVHPTTTPAQIRKMTQGSANLFSCCVDIGHDALDTIGNAEETSNWIHAKGYRSV 153

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 154 LVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 213

Query: 183 SIQ 185
             +
Sbjct: 214 GAR 216


>gi|227823233|ref|YP_002827205.1| hypothetical protein NGR_c27030 [Sinorhizobium fredii NGR234]
 gi|227342234|gb|ACP26452.1| hypothetical protein NGR_c27030 [Sinorhizobium fredii NGR234]
          Length = 242

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 109/175 (62%), Gaps = 3/175 (1%)

Query: 7   GLFVCLIF---FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
           G FV L F   F+ GF+ F   V  +  P  P   AIVVLTG   RIE+A ELL++  G 
Sbjct: 38  GFFVLLAFLAVFVAGFLYFADTVASLQPPAAPKADAIVVLTGGFQRIEQAVELLKSGAGN 97

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ISGV+ + +   + +      DL +CC+DIG++A++T GNA EA  W   + +  VL
Sbjct: 98  RLLISGVNPATTGSQIRRNTQSSADLFKCCVDIGHEAVDTIGNATEAGQWIHDHGYRSVL 157

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +VT++YHMPR+ LEL+R+    +FI YP+++ DL+ ++ +   + ++ +L+EY K
Sbjct: 158 VVTNNYHMPRSLLELRRVRPDTEFIAYPVVNSDLKTSNWLRNPRFIKAILLEYAK 212


>gi|327193562|gb|EGE60452.1| hypothetical protein RHECNPAF_150012 [Rhizobium etli CNPAF512]
          Length = 238

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 108/183 (59%), Gaps = 3/183 (1%)

Query: 6   YGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +G F C++   +   GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 36  WGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGAG 95

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      +L  CC+DIG+ AL+T GNA+E S W     +  V
Sbjct: 96  KRLLISGVHPTTTPAQIRKMTQGSANLFSCCVDIGHDALDTIGNAEETSNWIHAKGYRSV 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 156 LVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 215

Query: 183 SIQ 185
             +
Sbjct: 216 GAR 218


>gi|15966410|ref|NP_386763.1| hypothetical protein SMc00715 [Sinorhizobium meliloti 1021]
 gi|307300553|ref|ZP_07580333.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
 gi|307318418|ref|ZP_07597853.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|15075681|emb|CAC47236.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896100|gb|EFN26851.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|306904719|gb|EFN35303.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
          Length = 232

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 106/175 (60%), Gaps = 3/175 (1%)

Query: 7   GLFVCLIF---FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
           G FV L F   FI GF+ F   V  +  P  P   AIVVLTG   RI++A +LL+   G+
Sbjct: 28  GFFVLLAFLTVFIAGFLQFADTVASLQPPATPKADAIVVLTGGFQRIDQAVDLLKLGAGK 87

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ISGVH S ++  + +      DL +CC+DIG+ A++T GNA E S W     +  +L
Sbjct: 88  RLLISGVHPSTTRSQIRRNTQSSADLFKCCVDIGHAAIDTIGNATETSLWIRNRGYRTIL 147

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +VT++YHMPR+ LEL+R     +FI YP+++ DL+  + +    +L+ +L+EY K
Sbjct: 148 VVTNNYHMPRSLLELRRARPETEFIAYPVVNSDLKTTNWLRNPLVLKAILLEYGK 202


>gi|163759927|ref|ZP_02167011.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
 gi|162282885|gb|EDQ33172.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
          Length = 220

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 111/195 (56%), Gaps = 1/195 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R    G  + + F ++GF  F   + ++  P     V AIVVLTG   RIE+A  LLE+
Sbjct: 9   LRILTIGAILGVTFVVIGFFRFTDEIAELKAPGTSVDVDAIVVLTGGYQRIEQALALLED 68

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
            IG+++ ISGV+ S S   L +    +    +CC+DIGY+AL+T GNA E + W  +NN+
Sbjct: 69  GIGDRLLISGVNPSTSSAALRRATGTQSATFDCCVDIGYQALDTIGNANETADWIRQNNY 128

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             VL+VT++YHMPR+ +EL + +  V F+ YP+   DL+  + +     LR L  EY K 
Sbjct: 129 VRVLVVTNNYHMPRSLMELSQASPDVSFVAYPVTHADLKTEAWLTDPVALRTLFTEYAKY 188

Query: 180 LLLSIQLSLSTQTAS 194
            L  ++      TA+
Sbjct: 189 SLARLRNWSGATTAT 203


>gi|150397743|ref|YP_001328210.1| hypothetical protein Smed_2545 [Sinorhizobium medicae WSM419]
 gi|150029258|gb|ABR61375.1| protein of unknown function DUF218 [Sinorhizobium medicae WSM419]
          Length = 232

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 112/185 (60%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  ++ L   L  FI GF+ F   V  +  P  P   AIVVLTG   RI++A +LL+  
Sbjct: 25  LRRSFFVLLAFLAVFIAGFLQFADTVASLQPPPTPKADAIVVLTGGFQRIDQAVDLLKLG 84

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH S ++  + +      DL +CC+DIG +A++T GNA E S W     + 
Sbjct: 85  AGKRLLISGVHPSTTRSQIRRNTQSSADLFKCCVDIGREAVDTIGNATETSHWIRSRGYR 144

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +L+VT++YHMPR+ LEL+R     +F+ YP+++ DL+  + +    +L+ +L+EY+K  
Sbjct: 145 TILVVTNNYHMPRSLLELRRARPETEFVAYPVVNSDLKTTNWLRNPLVLKAILLEYVKYS 204

Query: 181 LLSIQ 185
           + S++
Sbjct: 205 VSSLR 209


>gi|86359387|ref|YP_471279.1| hypothetical protein RHE_CH03804 [Rhizobium etli CFN 42]
 gi|86283489|gb|ABC92552.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 191

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G+++ ISGVH + +  
Sbjct: 4   GFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGAGKRLLISGVHPTTTPA 63

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            + +      DL  CC+DIG+ A++T GNA+E S W     +  VL+VT++YHMPR+  E
Sbjct: 64  QIRKMTQGSADLFSCCVDIGHDAIDTIGNAEETSNWIHAKGYRSVLVVTNNYHMPRSLAE 123

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           L  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL   +
Sbjct: 124 LSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLTGAR 171


>gi|148559698|ref|YP_001259812.1| hypothetical protein BOV_1921 [Brucella ovis ATCC 25840]
 gi|189025061|ref|YP_001935829.1| hypothetical protein BAbS19_I18730 [Brucella abortus S19]
 gi|237816354|ref|ZP_04595347.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260546109|ref|ZP_05821849.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260562906|ref|ZP_05833392.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567524|ref|ZP_05837994.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|265999274|ref|ZP_06111628.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|297247229|ref|ZP_06930947.1| hypothetical protein BAYG_00126 [Brucella abortus bv. 5 str. B3196]
 gi|148370955|gb|ABQ60934.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|189020633|gb|ACD73355.1| hypothetical protein BAbS19_I18730 [Brucella abortus S19]
 gi|237788421|gb|EEP62636.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260096216|gb|EEW80092.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260152922|gb|EEW88014.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260157042|gb|EEW92122.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|263092990|gb|EEZ17140.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|297174398|gb|EFH33745.1| hypothetical protein BAYG_00126 [Brucella abortus bv. 5 str. B3196]
          Length = 300

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 103 LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 161

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 162 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 221

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 222 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 281

Query: 186 LSLST 190
           L  ++
Sbjct: 282 LGSAS 286


>gi|261221047|ref|ZP_05935328.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265997008|ref|ZP_06109565.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260919631|gb|EEX86284.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262551476|gb|EEZ07466.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 254

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 57  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 115

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 116 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 175

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 176 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 235

Query: 186 LSLST 190
           L  ++
Sbjct: 236 LGSAS 240


>gi|17986358|ref|NP_538992.1| hypothetical protein BMEI0074 [Brucella melitensis bv. 1 str. 16M]
 gi|260755671|ref|ZP_05868019.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758896|ref|ZP_05871244.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760620|ref|ZP_05872963.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884697|ref|ZP_05896311.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214946|ref|ZP_05929227.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261217820|ref|ZP_05932101.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261314966|ref|ZP_05954163.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316476|ref|ZP_05955673.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321332|ref|ZP_05960529.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751141|ref|ZP_05994850.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755703|ref|ZP_05999412.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265987548|ref|ZP_06100105.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265992020|ref|ZP_06104577.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993756|ref|ZP_06106313.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17981947|gb|AAL51256.1| hypothetical protein BMEI0074 [Brucella melitensis bv. 1 str. 16M]
 gi|260669214|gb|EEX56154.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671052|gb|EEX57873.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675779|gb|EEX62600.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874225|gb|EEX81294.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916553|gb|EEX83414.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260922909|gb|EEX89477.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294022|gb|EEX97518.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295699|gb|EEX99195.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303992|gb|EEY07489.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740894|gb|EEY28820.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745456|gb|EEY33382.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262764737|gb|EEZ10658.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003086|gb|EEZ15379.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659745|gb|EEZ30006.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 250

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 53  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 111

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 112 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 171

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 172 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 231

Query: 186 LSLST 190
           L  ++
Sbjct: 232 LGSAS 236


>gi|261323939|ref|ZP_05963136.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261299919|gb|EEY03416.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 250

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+  I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 53  LFLAFIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 111

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 112 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 171

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 172 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 231

Query: 186 LSLST 190
           L  ++
Sbjct: 232 LGSAS 236


>gi|256112323|ref|ZP_05453244.1| hypothetical protein Bmelb3E_06514 [Brucella melitensis bv. 3 str.
           Ether]
          Length = 208

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 11  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 69

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 70  LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 129

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 130 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 189

Query: 186 LSLST 190
           L  ++
Sbjct: 190 LGSAS 194


>gi|23502843|ref|NP_698970.1| hypothetical protein BR1995 [Brucella suis 1330]
 gi|62290842|ref|YP_222635.1| hypothetical protein BruAb1_1970 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700754|ref|YP_415328.1| hypothetical protein BAB1_1995 [Brucella melitensis biovar Abortus
           2308]
 gi|254705003|ref|ZP_05166831.1| hypothetical protein Bsuib36_14000 [Brucella suis bv. 3 str. 686]
 gi|256370397|ref|YP_003107908.1| hypothetical protein BMI_I2019 [Brucella microti CCM 4915]
 gi|294851231|ref|ZP_06791904.1| hypothetical protein BAZG_00130 [Brucella sp. NVSL 07-0026]
 gi|23348869|gb|AAN30885.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196974|gb|AAX75274.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616855|emb|CAJ11951.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|256000560|gb|ACU48959.1| hypothetical protein BMI_I2019 [Brucella microti CCM 4915]
 gi|294819820|gb|EFG36819.1| hypothetical protein BAZG_00130 [Brucella sp. NVSL 07-0026]
 gi|326539710|gb|ADZ87925.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 212

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 15  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 73

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 74  LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 133

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 134 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 193

Query: 186 LSLST 190
           L  ++
Sbjct: 194 LGSAS 198


>gi|256059967|ref|ZP_05450151.1| hypothetical protein Bneo5_06389 [Brucella neotomae 5K33]
          Length = 212

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+  I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 15  LFLAFIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 73

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 74  LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 133

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 134 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 193

Query: 186 LSLST 190
           L  ++
Sbjct: 194 LGSAS 198


>gi|306843432|ref|ZP_07476033.1| Hypothetical protein BIBO1_0084 [Brucella sp. BO1]
 gi|306276123|gb|EFM57823.1| Hypothetical protein BIBO1_0084 [Brucella sp. BO1]
          Length = 250

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF  F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 53  LFLAVIAFLGGFFVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKERRGKRL 111

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 112 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 171

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 172 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 231

Query: 186 LSLST 190
           L  ++
Sbjct: 232 LGSAS 236


>gi|222087356|ref|YP_002545893.1| hypothetical protein Arad_4209 [Agrobacterium radiobacter K84]
 gi|221724804|gb|ACM27960.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 240

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 104/183 (56%), Gaps = 2/183 (1%)

Query: 5   WYGL-FVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           W G  FV L+  + G F+ F   +  +  P  P   AI+VLTG   RI++A ELL    G
Sbjct: 37  WGGFAFVFLVAIVFGGFLHFADSITTLKPPLEPKADAIIVLTGGYQRIDQAVELLRTGAG 96

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++ ISG H + +   + +      +L  CC+DIGY A++T GNA+EA+ W     +  +
Sbjct: 97  NRLLISGAHPTTTPSQIRKLTQSPANLFNCCVDIGYDAIDTIGNAREAAKWIHARGYKSI 156

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL+ ++    FIPYP+++ DL+  +       LR ++ EY K+LL 
Sbjct: 157 LVVTNNYHMPRSLAELKYVDPATDFIPYPVVNSDLKTKNWFTDPNALRTMIYEYAKVLLA 216

Query: 183 SIQ 185
             +
Sbjct: 217 GAR 219


>gi|265982992|ref|ZP_06095727.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264661584|gb|EEZ31845.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 250

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF  F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 53  LFLAVIAFLGGFFVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 111

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 112 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 171

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 172 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 231

Query: 186 LSLST 190
           +  ++
Sbjct: 232 VGSAS 236


>gi|13473042|ref|NP_104609.1| hypothetical protein mlr3524 [Mesorhizobium loti MAFF303099]
 gi|14023790|dbj|BAB50395.1| mlr3524 [Mesorhizobium loti MAFF303099]
          Length = 241

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 103/175 (58%), Gaps = 1/175 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L +  + F  GF  F   V  +  P +P    AI+VLTG   R++ A +LL +  GE++ 
Sbjct: 42  LLILAVLFAGGFGWFANKVAHLTTPANPEKADAIIVLTGGQSRLDAAMDLLASGKGERLL 101

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S S+  L       ++L  CC+DI   AL+T GNA+E++ W E + +  V++VT
Sbjct: 102 ISGVHPSASRRQLQAATGGDKNLFSCCVDIDRAALDTIGNAEESAKWVESHAYGTVILVT 161

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           ++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K LL
Sbjct: 162 NNYHMPRSLLEMGRLLHGAKLEPYPVVNSNLDNGGWLTKPRALRVLFTEYTKYLL 216


>gi|225628192|ref|ZP_03786227.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617017|gb|EEH14064.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 254

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 57  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 115

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GN  E+  W   N++H V++V
Sbjct: 116 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNVAESERWIRANDYHRVIVV 175

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 176 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 235

Query: 186 LSLST 190
           L  ++
Sbjct: 236 LGSAS 240


>gi|261758934|ref|ZP_06002643.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp.
           F5/99]
 gi|261738918|gb|EEY26914.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp.
           F5/99]
          Length = 269

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF+ F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 72  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 130

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GN  E+  W   N++H V++V
Sbjct: 131 LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNVAESERWIRANDYHRVIVV 190

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 191 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 250

Query: 186 LSLST 190
           L  ++
Sbjct: 251 LGSAS 255


>gi|254718046|ref|ZP_05179857.1| hypothetical protein Bru83_00605 [Brucella sp. 83/13]
          Length = 212

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           LF+ +I F+ GF  F   V  M  P    P+  AIVVLTG   R++    LL+ + G+++
Sbjct: 15  LFLAVIAFLGGFFVFSEKVTGMQPPVLSEPA-EAIVVLTGGQSRVKAGINLLKEKRGKRL 73

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++V
Sbjct: 74  LISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVV 133

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++
Sbjct: 134 TNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVR 193

Query: 186 LSLST 190
           +  ++
Sbjct: 194 VGSAS 198


>gi|319781280|ref|YP_004140756.1| hypothetical protein Mesci_1548 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167168|gb|ADV10706.1| protein of unknown function DUF218 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 241

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 105/182 (57%), Gaps = 1/182 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGEPIRIERAFELLEN 59
           +R     + +    F  GF  F   V  +  P +P+   AI+VLTG   R++ A +LL +
Sbjct: 35  LRLSALSVLILATLFAGGFGWFANKVSHLTTPANPARADAIIVLTGGQSRLDAAMDLLAS 94

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GE++ ISGVH S S+  L       ++L  CC+DI   AL+T GNA+E++ W E + +
Sbjct: 95  GKGERLLISGVHPSASRRQLQAATGGDKNLFSCCVDIDRAALDTIGNAEESAKWVESHAY 154

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             V++VT++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K 
Sbjct: 155 GTVILVTNNYHMPRSLLEMGRLLHGAKLEPYPVVNSNLDNGGWLTKPRALRVLFTEYNKY 214

Query: 180 LL 181
           LL
Sbjct: 215 LL 216


>gi|15891332|ref|NP_357004.1| hypothetical protein Atu3608 [Agrobacterium tumefaciens str. C58]
 gi|15159715|gb|AAK89789.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 243

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 107/176 (60%), Gaps = 3/176 (1%)

Query: 8   LFVCLIF---FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
           + VC+I    F  GF+ F   V  M  P+     AI+VLTG   RIE+A  LL + +G++
Sbjct: 35  ILVCVIALGAFSGGFLWFADSVASMRPPEGARGDAIIVLTGGYQRIEQAVGLLRDGVGKR 94

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ + ++  + +      D+  CC+D+GYKA++T GNA EA++W   +N+  +++
Sbjct: 95  LLISGVNPATTRSQIRKMTQGSSDMFTCCVDMGYKAIDTIGNANEAASWIRDHNYSSIVV 154

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           VT++YHM R+  EL+  +   +FI YP+IS DL   +   +  ++R LL EYLK +
Sbjct: 155 VTNNYHMHRSLHELRNASPQTEFIAYPVISADLVRTNWFVEPDVVRTLLYEYLKFV 210


>gi|260466676|ref|ZP_05812863.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029539|gb|EEW30828.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
          Length = 241

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 101/175 (57%), Gaps = 1/175 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L V    F  GF  F   V  +  P +P+   AI+VLTG   R++ A ELL +  GE++ 
Sbjct: 42  LLVLATLFAGGFGWFANKVSHLTTPANPTKADAIIVLTGGQSRLDAAMELLASGKGERLL 101

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S S+  L       + L  CC+DI   AL+T GNA++++ W   + +  V++VT
Sbjct: 102 ISGVHPSASRRQLQAATGGDKKLFSCCVDIDRAALDTIGNAEQSAKWVTNHAYGTVILVT 161

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           ++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K LL
Sbjct: 162 NNYHMPRSLLEMGRLLHGARLEPYPVVNSNLDNGGWLTKPRALRVLFTEYTKYLL 216


>gi|332716396|ref|YP_004443862.1| hypothetical protein AGROH133_11928 [Agrobacterium sp. H13-3]
 gi|325063081|gb|ADY66771.1| hypothetical protein AGROH133_11928 [Agrobacterium sp. H13-3]
          Length = 243

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 104/174 (59%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           + L  F  GF+ F   V  M  P+     AI+VLTG   RIE+A  LL + +G+++ ISG
Sbjct: 40  ITLGAFSGGFLWFADSVASMRPPEGAKGDAIIVLTGGYQRIEQAVGLLRDGVGKRLLISG 99

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           V+ + ++  + +      D+  CC+D+GYKA++T GNA EA++W   + +  +++VT++Y
Sbjct: 100 VNPATTRTQIRKMTQGSSDMFSCCVDMGYKAIDTIGNANEAASWIRDHGYSSIVVVTNNY 159

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           HM R+  EL   +   QFI YP+IS DL   +   +  ++R +L EY+K ++ +
Sbjct: 160 HMHRSLHELHNASPQTQFIAYPVISADLARTNWFAEPDVVRTMLYEYMKFVIAA 213


>gi|49474722|ref|YP_032764.1| hypothetical protein BQ12360 [Bartonella quintana str. Toulouse]
 gi|49240226|emb|CAF26695.1| hypothetical protein BQ12360 [Bartonella quintana str. Toulouse]
          Length = 230

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 112/182 (61%), Gaps = 3/182 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L + + FF  GF+ F    +Q+  P+  P   AI+VLTG   RIE    LL+ ++G ++ 
Sbjct: 51  LLMIVFFFCAGFVIFSEKTEQLKPPNPLPKADAIIVLTGGEKRIETGLNLLQQELGSRLL 110

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV+ + +    +    I   L  CC+DIG+KA+NT+GNA+E++ W +K+++  V IVT
Sbjct: 111 ISGVNTTTNLKRFMYSTHITPQLFTCCVDIGHKAINTKGNAEESADWIKKHHYQTVYIVT 170

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           HDYHM R+  EL+ +   + FI YP+   ++E  S+I +I  +R+L+ +Y+K L + I+ 
Sbjct: 171 HDYHMWRSLRELKYLMPDINFIAYPVKKSEIE--STIQQINQIRILVFQYIKTLEVYIRT 228

Query: 187 SL 188
           + 
Sbjct: 229 AF 230


>gi|114705471|ref|ZP_01438379.1| hypothetical protein FP2506_11041 [Fulvimarina pelagi HTCC2506]
 gi|114540256|gb|EAU43376.1| hypothetical protein FP2506_11041 [Fulvimarina pelagi HTCC2506]
          Length = 234

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 68/186 (36%), Positives = 107/186 (57%), Gaps = 7/186 (3%)

Query: 10  VCLIFFIMG-FI--SFIRYVKQM----HIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +CL+  + G FI  SF+RY +       + + P   AIVVLTG   RIERA  LL+N  G
Sbjct: 33  LCLVVLVAGGFIVGSFLRYAETTAAVSRLENVPPADAIVVLTGGANRIERAISLLKNGYG 92

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGV+ + S   + +      DL ECC+DI   AL+T GNA EA  WA +N F  +
Sbjct: 93  KRLLISGVNENTSARAIARATNTDLDLFECCVDIDVAALDTVGNAMEAVRWAAENGFDEL 152

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT DYHM R+ +E  R+    +  P  +   +L ++ +I   + L VL++EY K++  
Sbjct: 153 ILVTSDYHMQRSLIEFDRVGDLDRITPVAVRLDELWQDDTIPTRRGLEVLVMEYAKLMAA 212

Query: 183 SIQLSL 188
            ++ ++
Sbjct: 213 RVRAAI 218


>gi|319899424|ref|YP_004159521.1| hypothetical protein BARCL_1288 [Bartonella clarridgeiae 73]
 gi|319403392|emb|CBI76960.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 225

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 104/161 (64%), Gaps = 4/161 (2%)

Query: 32  PDHP--SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDL 89
           P HP   V AI+VLTG   RIE   +LLE   G ++ ISGV  +   + L++ + I   L
Sbjct: 66  PPHPLQKVDAIIVLTGGKNRIETGLKLLEKGFGSRLLISGVSTTTHPNKLIRMMNINPQL 125

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             CCIDIGY+A+NT+GNA+E++ W +K+ +  + IVTHDYHM R+ LE Q +   + FI 
Sbjct: 126 FSCCIDIGYQAINTQGNAKESADWIKKHRYKTLYIVTHDYHMMRSLLEFQYLMPNINFIA 185

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           YP I  D+ + S I +   +R+L++EY+K + + I+++LS+
Sbjct: 186 YP-IKQDVAD-SWIKEANQIRLLVLEYIKNICVKIRMTLSS 224


>gi|110635418|ref|YP_675626.1| hypothetical protein Meso_3089 [Mesorhizobium sp. BNC1]
 gi|110286402|gb|ABG64461.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 218

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 103/186 (55%), Gaps = 10/186 (5%)

Query: 2   RYFWYG-------LFVCLIFFIMGFISFIRYVKQMHIPD--HPSVSAIVVLTGEPIRIER 52
           R  W G       +F+  + ++ GF  F  +V ++  P   +P+   IVVLTG   RI+ 
Sbjct: 5   RRMWVGVRSAAATIFLFFVLYVAGFGIFADHVVRLRAPAELNPA-DGIVVLTGGQSRIDT 63

Query: 53  AFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
             +LL+    +++ ISGV+     D L       + L  CC+DI   ALNT GNAQE++ 
Sbjct: 64  GMDLLKAGKAKRLLISGVNPVARVDDLRLATGGDRALFNCCVDIDRAALNTVGNAQESAK 123

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
           W   N +  +++VT++YHMPR+ LE++RI       PYP+++  L++ + I     LRVL
Sbjct: 124 WVSANTYGSIIVVTNNYHMPRSLLEMRRILPNADLQPYPVVNTPLDDGAWISNPDALRVL 183

Query: 173 LIEYLK 178
           LIEY K
Sbjct: 184 LIEYTK 189


>gi|163844017|ref|YP_001628421.1| hypothetical protein BSUIS_A1836 [Brucella suis ATCC 23445]
 gi|163674740|gb|ABY38851.1| protein of unknown function DUF218 [Brucella suis ATCC 23445]
          Length = 177

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 95/152 (62%)

Query: 39  AIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGY 98
           AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L  CCID+  
Sbjct: 12  AIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDR 71

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            ALNT GNA E+  W   NN+H V++VT++YH+PR+ LE+      V+FIPYP+++ +  
Sbjct: 72  TALNTVGNAAESERWIRANNYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKR 131

Query: 159 ENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 132 EQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|163869202|ref|YP_001610454.1| hypothetical protein Btr_2487 [Bartonella tribocorum CIP 105476]
 gi|161018901|emb|CAK02459.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 221

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 108/182 (59%), Gaps = 3/182 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L V +  F  GFI F    +++  P   P   AI+VLTG   RIE    LL+  +G ++ 
Sbjct: 42  LVVIVFIFWGGFIIFSEKTERLVPPTPLPKADAIIVLTGGEHRIETGLHLLQKGLGSRLL 101

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV+ S +    +  + I   L  CCIDIG++A+NT GNAQE++AW +K+++  + IVT
Sbjct: 102 ISGVNTSTNLKSFMHNMHISPQLISCCIDIGHQAINTRGNAQESAAWIKKHHYKTLYIVT 161

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           HDYH+ R+  EL+ +   + FI YP+     E  S+I +IK  R+L+ +Y+K L + I+ 
Sbjct: 162 HDYHIWRSMRELKYLMPDIHFIAYPVKKSKAE--STIQQIKQARILIFQYIKTLQVYIRT 219

Query: 187 SL 188
           + 
Sbjct: 220 AF 221


>gi|90420238|ref|ZP_01228146.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335572|gb|EAS49322.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 244

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 100/188 (53%), Gaps = 11/188 (5%)

Query: 10  VCLIFFIMGFI-------SFIRYVKQMHIPDHPS----VSAIVVLTGEPIRIERAFELLE 58
           +CL   ++G +        F+R+ +++ +   P+       IVVLTG  +RI++A +LL+
Sbjct: 38  LCLAAVLVGVLLGGYLAGGFVRFAEEVSLLAKPAPIGAADGIVVLTGGALRIDQAIDLLK 97

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G ++ ISGV+   S   L +     +DL  CC+D+ Y ALNT GNA+ A  WA +  
Sbjct: 98  EGRGRRLLISGVNPGTSAATLARMTDTDRDLFACCVDLDYAALNTVGNAEIARNWAREQG 157

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           F  +++VT DYHMPR+  E  RI       PY +   DL     +     LRVLL EY K
Sbjct: 158 FRDLILVTSDYHMPRSLREFDRIGELRSVTPYAVRRDDLWSAELMPNTAGLRVLLTEYAK 217

Query: 179 ILLLSIQL 186
           ++   ++L
Sbjct: 218 LIAARVRL 225


>gi|254472459|ref|ZP_05085859.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211958742|gb|EEA93942.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 239

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 111/198 (56%), Gaps = 15/198 (7%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVK---QMHIPDHPSVSAIVVLTGEPIRIERAFELL 57
           +R+F+    +C + F  GF+ F+  ++   Q  +P H     IVVLTG   RI ++ +LL
Sbjct: 41  VRFFFLLFLICSVAFAAGFLWFVEVLQPAVQAVVPKH--ADGIVVLTGGRDRISQSLDLL 98

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           E    +++ ISGVH S S   + +    R  L +CC+D+  KALNT GNA+E ++W  KN
Sbjct: 99  ETGSAKRLLISGVHPSTSAKQIARLNSKRMWLFDCCVDLDRKALNTIGNAEETASWVRKN 158

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE-----ENSSIFKIKILRVL 172
            F+ +L+VT  YHMPR   ELQ         P P+   +L+     E+SSI K+     L
Sbjct: 159 QFNSLLVVTSAYHMPRALAELQVRLPEADLYPSPVYHKELDLEHWYESSSITKL-----L 213

Query: 173 LIEYLKILLLSIQLSLST 190
           L EY+K +L+ +++ L T
Sbjct: 214 LREYVKYILVRLRVELDT 231


>gi|161619913|ref|YP_001593800.1| hypothetical protein BCAN_A2041 [Brucella canis ATCC 23365]
 gi|225853431|ref|YP_002733664.1| hypothetical protein BMEA_A2054 [Brucella melitensis ATCC 23457]
 gi|254690133|ref|ZP_05153387.1| hypothetical protein Babob68_08186 [Brucella abortus bv. 6 str.
           870]
 gi|254694623|ref|ZP_05156451.1| hypothetical protein Babob3T_08184 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696248|ref|ZP_05158076.1| hypothetical protein Babob28_00674 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700633|ref|ZP_05162461.1| hypothetical protein Bsuib55_07228 [Brucella suis bv. 5 str. 513]
 gi|254707480|ref|ZP_05169308.1| hypothetical protein BpinM_11037 [Brucella pinnipedialis
           M163/99/10]
 gi|254708978|ref|ZP_05170789.1| hypothetical protein BpinB_01690 [Brucella pinnipedialis B2/94]
 gi|254713593|ref|ZP_05175404.1| hypothetical protein BcetM6_09616 [Brucella ceti M644/93/1]
 gi|254716053|ref|ZP_05177864.1| hypothetical protein BcetM_06394 [Brucella ceti M13/05/1]
 gi|254731166|ref|ZP_05189744.1| hypothetical protein Babob42_08216 [Brucella abortus bv. 4 str.
           292]
 gi|256030505|ref|ZP_05444119.1| hypothetical protein BpinM2_07627 [Brucella pinnipedialis
           M292/94/1]
 gi|256045596|ref|ZP_05448476.1| hypothetical protein Bmelb1R_13928 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256158491|ref|ZP_05456389.1| hypothetical protein BcetM4_06532 [Brucella ceti M490/95/1]
 gi|256253910|ref|ZP_05459446.1| hypothetical protein BcetB_06374 [Brucella ceti B1/94]
 gi|256258387|ref|ZP_05463923.1| hypothetical protein Babob9C_13798 [Brucella abortus bv. 9 str.
           C68]
 gi|161336724|gb|ABX63029.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|225641796|gb|ACO01710.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|326409995|gb|ADZ67060.1| conserved hypothetical protein [Brucella melitensis M28]
          Length = 177

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 95/152 (62%)

Query: 39  AIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGY 98
           AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L  CCID+  
Sbjct: 12  AIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDR 71

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            ALNT GNA E+  W   N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  
Sbjct: 72  TALNTVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKR 131

Query: 159 ENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 132 EQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|49476199|ref|YP_034240.1| hypothetical protein BH15440 [Bartonella henselae str. Houston-1]
 gi|49239007|emb|CAF28307.1| hypothetical protein BH15440 [Bartonella henselae str. Houston-1]
          Length = 230

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 112/191 (58%), Gaps = 6/191 (3%)

Query: 2   RYF---WYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELL 57
           RYF    + L + ++FF  GF+ F    +Q+  P   P   AI+VLTG   RIE   +LL
Sbjct: 42  RYFPPTAFFLLMIVLFFCAGFVVFSEKTEQLTPPSPLPKADAIIVLTGGENRIETGLDLL 101

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +  +G ++ ISGV+ + +    +    I   L  CC+DIG+KA+NT+GNA+E++ W +K+
Sbjct: 102 QQGLGSRLLISGVNTTTTLKRFMHSTHITPQLFACCVDIGHKAINTKGNAEESAVWIKKH 161

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
           ++  V IVTHDYHM R+  EL+ +   + FI YP+     E  S + ++  +R+L  +Y+
Sbjct: 162 HYKTVYIVTHDYHMWRSMRELKYLMPDINFIAYPVKKSGDE--SIVQQLNQIRILAFQYI 219

Query: 178 KILLLSIQLSL 188
           K + + I+ + 
Sbjct: 220 KTIDVYIRTAF 230


>gi|154243978|ref|YP_001414936.1| hypothetical protein Xaut_0020 [Xanthobacter autotrophicus Py2]
 gi|154158063|gb|ABS65279.1| protein of unknown function DUF218 [Xanthobacter autotrophicus Py2]
          Length = 300

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 97/168 (57%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F++F   +            AIVVLTG P RI  A  LL +  G ++ I+GV+ + S D 
Sbjct: 84  FLAFTAQIAAREPAAVKPADAIVVLTGGPSRIVDAVGLLADGRGRRLLITGVNPTTSMDE 143

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + + +P  + L  CCID+G+KALNT GNA EA+ WA +  F  +++VT  +HMPR  +EL
Sbjct: 144 MRRALPDGEHLLGCCIDLGHKALNTRGNALEAAEWAREKRFRSLVVVTSSWHMPRAMMEL 203

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            R    V+ + YP+++   +  S       L++L+ EYLK ++ ++++
Sbjct: 204 GRALPDVELVSYPVVTTRTQPESWWSDPGTLKLLVKEYLKFIMATVKI 251


>gi|319406304|emb|CBI79941.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 226

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 111/176 (63%), Gaps = 5/176 (2%)

Query: 17  MGFISFIRYVKQMHIPDHP--SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           + F++F   V+Q+  P HP   V AI+VLTG   RIE   ELL+ ++G ++ ISGV+ ++
Sbjct: 53  LTFVAFTEKVEQL-TPPHPLPKVDAIIVLTGGKNRIETGLELLQKKLGSRLLISGVNTTI 111

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
             + L++++ I   L  CC+DI + A NT+GNA+E++ W  K+ +  + IVTHDYHM R+
Sbjct: 112 HPNKLIRRMNINPRLFACCVDIDHHATNTQGNAKESAHWINKHRYKTLYIVTHDYHMIRS 171

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            LE + +   + FI YPI  +  +  S I +   +R+L +EY+K + + I++ LS+
Sbjct: 172 LLEFKYLMPNINFIAYPIKQNVTD--SWIKQANQIRLLALEYVKNISVKIRIILSS 225


>gi|240851278|ref|YP_002972681.1| hypothetical membrane protein [Bartonella grahamii as4aup]
 gi|240268401|gb|ACS51989.1| hypothetical membrane protein [Bartonella grahamii as4aup]
          Length = 229

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 103/174 (59%), Gaps = 3/174 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L + +  F  GFI F    +++  P   P   AI+VLTG   RIE    LL+  +G ++ 
Sbjct: 50  LAIIVFIFWGGFIVFSEKTERLSPPKPLPKADAIIVLTGGENRIETGLHLLQKGLGSRLL 109

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV+ + +    +    I   L  CCIDIG++A+NT GNA+E++ W +K++F  + IVT
Sbjct: 110 ISGVNTTTNLKGFMHNRHITPRLVSCCIDIGHQAINTRGNAKESATWIKKHHFKTLYIVT 169

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HDYHM R+  EL+ +   + FI YP+   + E  S+I +I  +R+LL +Y+K L
Sbjct: 170 HDYHMWRSMRELKYLMPDIHFIAYPVKKSNAE--SAIQQINQIRILLFQYIKTL 221


>gi|306837606|ref|ZP_07470477.1| Hypothetical protein BROD_0407 [Brucella sp. NF 2653]
 gi|306407313|gb|EFM63521.1| Hypothetical protein BROD_0407 [Brucella sp. NF 2653]
          Length = 177

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 95/152 (62%)

Query: 39  AIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGY 98
           AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L  CCID+  
Sbjct: 12  AIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDR 71

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            ALNT GNA E+  W   N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  
Sbjct: 72  TALNTVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKR 131

Query: 159 ENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           E S + +   LRVL  EY+K L   +++  ++
Sbjct: 132 EQSWVAEGDTLRVLFTEYVKYLGAVVRVGSAS 163


>gi|328541756|ref|YP_004301865.1| hypothetical protein SL003B_0132 [polymorphum gilvum SL003B-26A1]
 gi|326411508|gb|ADZ68571.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 196

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 100/169 (59%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F+ F + V  +  P+  S   IVVLTG   RIERA  LL+ +   ++ ISGV+ + +   
Sbjct: 20  FLLFAQSVVSIRAPEEASADGIVVLTGGQDRIERAVGLLQEERARRLLISGVYPATTDRQ 79

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           ++++      L  CC+D+  KALNT GNA E +AWA  + F  +L+VT  YH+PR  LEL
Sbjct: 80  IVERTSGDLPLFRCCVDLDRKALNTVGNAVETAAWARTHGFSSLLLVTSAYHLPRAALEL 139

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           + +   ++ +PYP+ + DL  +S   + + +R+LL E++K  L  +++ 
Sbjct: 140 KAVMPELELVPYPVFAEDLMLSSWYRRPQTIRLLLREFVKYTLARLRIG 188


>gi|158426237|ref|YP_001527529.1| hypothetical protein AZC_4613 [Azorhizobium caulinodans ORS 571]
 gi|158333126|dbj|BAF90611.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS
           571]
          Length = 256

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 103/187 (55%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHH 72
           + F+ GF+ F   +             IVVLTG   RI    +LL +  G+++ ISGV+ 
Sbjct: 45  LLFVGGFVVFTTAIAPREPAGLKPADGIVVLTGGASRIADGVQLLASGHGQRLLISGVNR 104

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
           + S+D + + +P  + L +CC+D+G++ALNT GNA EA+ W     F  +++VT  +HMP
Sbjct: 105 ATSQDEIRRTLPDNEHLLDCCVDLGHRALNTFGNAIEAAEWTRAQGFRSLVVVTSAWHMP 164

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQT 192
           R  +EL R    V+ + YP+++  ++        + +++LL EYLK ++   ++  +   
Sbjct: 165 RALVELGRALPEVELVAYPVVTDRMQSGGWWTDPQTVKLLLKEYLKYMMAMAKIRPAQAV 224

Query: 193 ASQFFIT 199
           A +  ++
Sbjct: 225 APKATVS 231


>gi|260169411|ref|ZP_05756222.1| hypothetical protein BruF5_13857 [Brucella sp. F5/99]
          Length = 177

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 94/152 (61%)

Query: 39  AIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGY 98
           AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L  CCID+  
Sbjct: 12  AIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDR 71

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            ALNT GN  E+  W   N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  
Sbjct: 72  TALNTVGNVAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKR 131

Query: 159 ENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 132 EQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|218531041|ref|YP_002421857.1| hypothetical protein Mchl_3091 [Methylobacterium chloromethanicum
           CM4]
 gi|218523344|gb|ACK83929.1| protein of unknown function DUF218 [Methylobacterium
           chloromethanicum CM4]
          Length = 234

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 103/194 (53%), Gaps = 1/194 (0%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
            V L+    GF++F+  V++   P    V  IV +TG   R+  A +LL    G ++ IS
Sbjct: 23  LVGLLALAGGFLAFVAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLIS 82

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           GV+   ++D +++  P ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +
Sbjct: 83  GVNERTTRDEIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSN 142

Query: 129 YHMPRTFLELQR-INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           YHMPRT +EL+  +      IPYP++S  L+ +       + R+L  EYLK L+   +  
Sbjct: 143 YHMPRTLVELRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTR 202

Query: 188 LSTQTASQFFITLI 201
             +      F  LI
Sbjct: 203 FESDPEQSRFAVLI 216


>gi|91975425|ref|YP_568084.1| hypothetical protein RPD_0945 [Rhodopseudomonas palustris BisB5]
 gi|91681881|gb|ABE38183.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB5]
          Length = 241

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 97/182 (53%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF++F+  ++   +  + +   IVVLTG   R+  A ELL +  G+++ I
Sbjct: 32  LALGFVATAAGFVAFLAQLRGAELKPNRTADGIVVLTGGSSRVSDAVELLASGYGKRLLI 91

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P  +D  +CC+D+   A+NT  NA E   WA +  FH +++VT 
Sbjct: 92  SGVHRTNGASDISRSVPDSKDWLDCCVDLDRSAVNTRSNAAETRRWAHERGFHSLIVVTS 151

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +E+      V+ IP+ +I     +         LR+LL EY K + +  ++ 
Sbjct: 152 NYHMPRAIVEMSHAMPDVELIPFAVIGDKWRDEPWWTSGATLRLLLSEYAKYVAVEARVR 211

Query: 188 LS 189
           L+
Sbjct: 212 LA 213


>gi|121602686|ref|YP_988436.1| hypothetical protein BARBAKC583_0098 [Bartonella bacilliformis
           KC583]
 gi|120614863|gb|ABM45464.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 202

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 108/176 (61%), Gaps = 13/176 (7%)

Query: 11  CLI--FFIMG--FISFIRYVKQMHIPDHPS-VSAIVVLTGEPIRIERAFELLENQIGEKI 65
           CL+  F IMG  F+ F   V+Q++ P   S   AI+VLTG   RIE    LL+  +G ++
Sbjct: 17  CLLSLFLIMGTHFVIFSEKVEQLYPPVSLSKADAIIVLTGGERRIETGLRLLKQGLGSRL 76

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV+ +     LL+ + I   L ECC+D+GY+A NT+ NA+E++ W +K+++  + IV
Sbjct: 77  LISGVNATFHPKRLLRNMHIDPQLFECCVDLGYQATNTKSNAEESAVWIKKHHYKTLYIV 136

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL---RVLLIEYLK 178
           THDYH+ R+ LEL+ +   + FI YPI     +EN +  K+K L   R+L  EY+K
Sbjct: 137 THDYHIARSLLELRYLMPDINFIAYPI-----KENVTQNKVKQLNKIRMLASEYIK 187


>gi|319409380|emb|CBI83024.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 225

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 108/176 (61%), Gaps = 9/176 (5%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
            LF+ ++     F++F   ++ +  P+  P   AI+VLTG   RI+  F+LL+  +G ++
Sbjct: 45  ALFITILLIGATFVTFSEKIEHLTPPNPLPQADAIIVLTGGENRIKTGFDLLQKGLGSRL 104

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV+ ++  + L+    I   L    +D GY+A NT+GNA+E++AW +++N+  V IV
Sbjct: 105 LISGVNSTIDLNKLIDATYINPHLLVSRVDFGYEATNTKGNAEESAAWIKQHNYKTVYIV 164

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS---IFKIKILRVLLIEYLK 178
           THDYHM R+ LEL+ +   + FI YPI     +EN++   I +I  +R+L+ EY+K
Sbjct: 165 THDYHMVRSLLELKYLMPHIDFIAYPI-----KENTTGSWIKQINQMRILVSEYIK 215


>gi|307943505|ref|ZP_07658849.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773135|gb|EFO32352.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 245

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 96/180 (53%), Gaps = 1/180 (0%)

Query: 9   FVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           F+ ++  ++G F SF   V  +  P  P   AIVVLTG   RI +A  LLE    E++ I
Sbjct: 60  FIVVVGLVVGSFASFAERVATIETPRDPRADAIVVLTGGKERISKAMRLLEEGRAERLLI 119

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH   S   + Q       L  CC+D+   ALNT GNA E ++W  ++ F  +L+VT 
Sbjct: 120 SGVHPGSSARQIAQATSSDLPLFTCCVDLDRAALNTLGNATETASWVAEHEFETLLVVTS 179

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            YH+PR  LEL  +      +PYP+ S + +  +       L++L+ EY+K  L  ++++
Sbjct: 180 AYHLPRAELELAEVLPNAGLLPYPVFSSERDLTAWYSSFDTLKLLMREYVKYTLARLRIT 239


>gi|302384409|ref|YP_003820232.1| hypothetical protein Bresu_3303 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302195037|gb|ADL02609.1| protein of unknown function DUF218 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 208

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 98/171 (57%), Gaps = 4/171 (2%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGEPI-RIERAFELLENQIGEKIFISGV 70
           + +++G  +F   V+ +   D P+    IV LTG    R+  A  LLE   GE++ ISGV
Sbjct: 12  LIWLVGLFAFADRVRNLTPADEPARADGIVALTGPSAERVNAAVRLLEQDKGERVLISGV 71

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           +  V +  L +  P    L  CC+D+G++A +T GNAQE +AWA   N+  +++VT DYH
Sbjct: 72  NREVRRQELRELTPGSNRLFNCCVDLGFEAEDTGGNAQEIAAWAGSKNYTSLIVVTSDYH 131

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI-LRVLLIEYLKIL 180
           MPR+ LE++     ++  PY + +  L +NS  ++  +  R + +EY+K L
Sbjct: 132 MPRSLLEIRSAAPGLELTPYAVSTPSL-DNSRWWRAAVTARRMTLEYMKYL 181


>gi|319404819|emb|CBI78420.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 231

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 19  FISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           F++F   V Q+  P   P   AI+VLTG   RIE   +LL+ ++G ++ ISGV+ +   +
Sbjct: 60  FVAFTEKVGQLTPPQPLPKADAIIVLTGGKNRIETGLKLLQKKLGSRLLISGVNTTTHPN 119

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            L++ + I   L  CC+DI ++A+NT+GNA+E++ W +K+ +  + IVTHDYHM R+ LE
Sbjct: 120 RLIRIMNINPRLFSCCVDIDHQAVNTQGNAKESAHWIKKHRYKTLYIVTHDYHMIRSLLE 179

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            + +   V FI YP I  ++ +N  I +   +R+L +EY+K + + I++ LS+
Sbjct: 180 FKYLMPDVNFIAYP-IKQNVADN-WIKQANQIRLLALEYIKSISVKIRIILSS 230


>gi|114570926|ref|YP_757606.1| hypothetical protein Mmar10_2376 [Maricaulis maris MCS10]
 gi|114341388|gb|ABI66668.1| protein of unknown function DUF218 [Maricaulis maris MCS10]
          Length = 195

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 108/197 (54%), Gaps = 10/197 (5%)

Query: 1   MRYFWYGL-FVCLIFFIMGFISFIRYVKQMHIPDHPS----VSAIVVLTGEPIRIERAFE 55
           M+  W  L  +C +  +   I F  Y  ++   D P+    V AI+VLTG+  R+    E
Sbjct: 1   MKQSWLWLRGLCFVVVLASMIGFAAYAGKVTGYDLPATDNTVDAIIVLTGDAGRLSAGGE 60

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           LL++     + ISGVH SV+   + ++  +  D   CC+ +G +A +T GNA+EA+A+ +
Sbjct: 61  LLQDGRASHLMISGVHPSVTTADIRRQTGLGDDAFSCCVTLGREATDTVGNAREAAAYVQ 120

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            N +  ++IVT DYH+PR+ LE +     V  IPYP+ +    ++     +  LR+ L E
Sbjct: 121 ANGYDRLIIVTSDYHLPRSLLEFRSHMPGVDLIPYPVRTQAPWQD-----VGALRLWLQE 175

Query: 176 YLKILLLSIQLSLSTQT 192
           Y K   + ++ SL++QT
Sbjct: 176 YAKYTTVQLRHSLTSQT 192


>gi|240139618|ref|YP_002964094.1| hypothetical protein MexAM1_META1p3069 [Methylobacterium extorquens
           AM1]
 gi|240009591|gb|ACS40817.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 234

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 100/185 (54%), Gaps = 1/185 (0%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           GF++F+  V++   P    V  IV +TG   R+  A +LL    G ++ ISGV+   ++D
Sbjct: 32  GFLAFVAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLISGVNERTTRD 91

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            +++  P ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +YHMPRT +E
Sbjct: 92  EIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSNYHMPRTLVE 151

Query: 138 LQR-INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQF 196
           L+  +      IPYP++S  L+ +       + R+L  EYLK L+   +    +      
Sbjct: 152 LRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTRFESDPEQSR 211

Query: 197 FITLI 201
           F  LI
Sbjct: 212 FAVLI 216


>gi|329847903|ref|ZP_08262931.1| hypothetical protein ABI_09720 [Asticcacaulis biprosthecum C19]
 gi|328842966|gb|EGF92535.1| hypothetical protein ABI_09720 [Asticcacaulis biprosthecum C19]
          Length = 220

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 100/176 (56%), Gaps = 5/176 (2%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHI---PDHPSVSAIVVLTG-EPIRIERAFELLENQIGEK 64
            V ++ +  G + F   V +      P+ P+  AIVVLTG   +R++    LLE + GE+
Sbjct: 8   LVVVLLWAAGLLVFADRVIESTPAIEPEEPA-DAIVVLTGASDMRLKEGMRLLERRKGER 66

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           +FISGV+  V +  L+      + L ECC+D+GY+A NT  NA+E + WA  ++F  +++
Sbjct: 67  LFISGVNRDVKRPELMDVTEGSKRLYECCVDLGYQAENTVQNAREIAEWARGHDFDTLIV 126

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           VT DYHMPR+ LEL+       FI YP+ + DL         K  R++++EY K L
Sbjct: 127 VTSDYHMPRSLLELKADMPDAHFISYPVPTADLSARDWWKSGKGARLIVLEYCKYL 182


>gi|146343248|ref|YP_001208296.1| hypothetical protein BRADO6468 [Bradyrhizobium sp. ORS278]
 gi|146196054|emb|CAL80081.1| conserved hypothetical protein; putative exported protein
           [Bradyrhizobium sp. ORS278]
          Length = 221

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 91/180 (50%), Gaps = 2/180 (1%)

Query: 12  LIFFI--MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           L FFI  +GF+ F+  ++   I        IVVLTG   R+  A ELL    G ++ ISG
Sbjct: 15  LGFFIAAVGFVGFLSQLRGAEIKPERKADGIVVLTGGSSRVSDAVELLAGGYGRRLLISG 74

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +   + + + +P  +    CC+D+ Y A+NT  NA +   WA +  F  +++VT +Y
Sbjct: 75  VHPTNDANDITRSLPEARSFINCCVDLDYSAINTRSNAAQTRRWAAERGFKSLVVVTSNY 134

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR   EL     ++  IPY ++     +         LR+LL EY K +    +L L+
Sbjct: 135 HMPRAIAELSHAMPSMDLIPYAVVGEKWRDEPWWTSGPTLRLLLSEYAKYVAAEARLRLA 194


>gi|163852283|ref|YP_001640326.1| hypothetical protein Mext_2865 [Methylobacterium extorquens PA1]
 gi|163663888|gb|ABY31255.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 283

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 100/185 (54%), Gaps = 1/185 (0%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           GF++F+  V++   P    V  IV +TG   R+  A +LL    G ++ ISGV+   ++D
Sbjct: 81  GFLAFVAVVERTDRPSLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLISGVNERTTRD 140

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            +++  P ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +YHMPRT +E
Sbjct: 141 EIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSNYHMPRTLVE 200

Query: 138 LQR-INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQF 196
           L+  +      IPYP++S  L+ +       + R+L  EYLK L+   +    +      
Sbjct: 201 LRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTRFESDPEQSR 260

Query: 197 FITLI 201
           F  LI
Sbjct: 261 FAVLI 265


>gi|319407779|emb|CBI81430.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 233

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 105/172 (61%), Gaps = 5/172 (2%)

Query: 19  FISFIRYVKQMHIPDHP--SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSK 76
           F++F   V Q   P HP     AI+VLTG   RIE   +LL+ ++G ++ ISGV+     
Sbjct: 62  FVAFTEKVGQF-TPPHPLPKADAIIVLTGGKNRIETGLKLLQKKLGSRLLISGVNTRTHP 120

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
           + L++ + I   L  CC+DI ++A+NT GNA+E++ W +KN +  + IVT DYHM R+ L
Sbjct: 121 NKLIRIMNINPRLFSCCVDIDHQAINTRGNAEESAHWIKKNRYKTLYIVTDDYHMTRSLL 180

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
           E + +   + FI YP I  D+ + S I ++  +R+L +EY+K + + I++ L
Sbjct: 181 EFKYLMPDINFIAYP-IKQDVAD-SWIKQVNQIRLLALEYIKNISVKIRIIL 230


>gi|148252746|ref|YP_001237331.1| hypothetical protein BBta_1178 [Bradyrhizobium sp. BTAi1]
 gi|146404919|gb|ABQ33425.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 221

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 90/183 (49%), Gaps = 4/183 (2%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           G FV  +    GFI F+  ++   I        IVVLTG   R+  A ELL    G ++ 
Sbjct: 16  GFFVAAV----GFIGFLSQLRGAEIKPERKADGIVVLTGGSSRVSDAVELLAGGYGRRLL 71

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH +     + + +P  +    CC+D+ Y A+NT  NA +   WA +  F  +++VT
Sbjct: 72  ISGVHPTNEASDITRSLPEARSFINCCVDLDYSAINTRSNAAQTRRWAAERGFKSLIVVT 131

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            +YHMPR  +EL     ++  IPY ++     +         LR+LL EY K +    +L
Sbjct: 132 SNYHMPRAIVELSHAMPSLDLIPYAVVGEKWRDEPWWTSGPTLRLLLSEYAKYVAAEARL 191

Query: 187 SLS 189
            L+
Sbjct: 192 RLA 194


>gi|167647181|ref|YP_001684844.1| hypothetical protein Caul_3219 [Caulobacter sp. K31]
 gi|167349611|gb|ABZ72346.1| protein of unknown function DUF218 [Caulobacter sp. K31]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 99/177 (55%), Gaps = 3/177 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVS-AIVVLTGEP-IRIERAFELLENQIGEKI 65
           L V +++F+ G ++F   V Q      P VS  +VVLTG   +R+E A +LLE   G+++
Sbjct: 8   LIVVMVWFV-GLLAFTSRVDQSTPALEPPVSDGVVVLTGASNVRLEVATKLLEAGKGKRL 66

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV+   S++ +L      + + ECC+D+GY A +T GNA E + WA   ++  +++V
Sbjct: 67  LISGVNREASREDVLGVTKAVRPIYECCVDLGYAAADTIGNASETAEWARAKDYRSLIVV 126

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           T DYHMPR+ LEL      V   PYP+++  L  +         R + +EY K L +
Sbjct: 127 TADYHMPRSMLELHASMPGVTLHPYPVVTESLNAHRWWQGGTSARRMTVEYCKYLAI 183


>gi|90426336|ref|YP_534706.1| hypothetical protein RPC_4865 [Rhodopseudomonas palustris BisB18]
 gi|90108350|gb|ABD90387.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB18]
          Length = 240

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 93/182 (51%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF+ F+  ++   I    +   IVVLTG   R+  A ELL    G ++ I
Sbjct: 31  LAIGFVGMASGFVVFLSQLRGAEIQPGRNADGIVVLTGGSSRVSDAIELLAAGYGRRLLI 90

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +   + + + +P  Q L  CC+D+   A+NT  NA EA  WA +  FH +++VT 
Sbjct: 91  SGVHPTNGANDISRSLPDSQQLLSCCVDLDRSAINTRSNAAEARRWAHERGFHSLIVVTS 150

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +E+      ++ IP+ ++     ++         R+LL EY K +    ++ 
Sbjct: 151 NYHMPRAIVEMSHAMPDIELIPFAVVGDKWRDDPWWTSGATFRLLLSEYAKYIAAEARVR 210

Query: 188 LS 189
           L+
Sbjct: 211 LA 212


>gi|306842871|ref|ZP_07475508.1| Hypothetical protein BIBO2_2646 [Brucella sp. BO2]
 gi|306286958|gb|EFM58475.1| Hypothetical protein BIBO2_2646 [Brucella sp. BO2]
          Length = 162

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 86/138 (62%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           +TG   R++    LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALN
Sbjct: 1   MTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALN 60

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           T GNA E+  W   N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S 
Sbjct: 61  TVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSW 120

Query: 163 IFKIKILRVLLIEYLKIL 180
           + +   LRVL  EY+K L
Sbjct: 121 VAEGDTLRVLFTEYVKYL 138


>gi|329890874|ref|ZP_08269217.1| hypothetical protein BDIM_25830 [Brevundimonas diminuta ATCC 11568]
 gi|328846175|gb|EGF95739.1| hypothetical protein BDIM_25830 [Brevundimonas diminuta ATCC 11568]
          Length = 218

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 90/173 (52%), Gaps = 2/173 (1%)

Query: 10  VCLIFFIMGFISFIRYVKQ-MHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFI 67
           V  + ++ G   F   V+     PD     AIV LTG    R+  A  LLE   G+++ I
Sbjct: 9   VVALMWLTGLFVFAERVRGFTPAPDPARADAIVSLTGPSAERVNAAIRLLEQGKGDRLLI 68

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGV+  V +  L    P    L  CC+D+G++A NT GNAQE +AWA    +  +++VT 
Sbjct: 69  SGVNREVRRQELRALTPGSSKLFNCCVDLGFEAENTVGNAQEIAAWARSKGYDDLIVVTS 128

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           DYHMPR+ LE++     V+  PY + +  L+        +  R + +EY+K L
Sbjct: 129 DYHMPRSLLEIRGAAPGVRLTPYAVSTPSLDNAGWWRATETARRMTLEYMKYL 181


>gi|300024263|ref|YP_003756874.1| hypothetical protein Hden_2757 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526084|gb|ADJ24553.1| protein of unknown function DUF218 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 214

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 87/165 (52%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
           + GF+ F   V +  +        IVVLTG  +R+E   +L+     +++ ISGV+  V 
Sbjct: 20  VFGFVLFSVTVTRDDVGGWDKADGIVVLTGGDLRVEAGAKLMNEGRAKRLLISGVNRKVR 79

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           ++ + + + +      CC+D+GY+AL+T GNA E   WA  N +  ++IVT  YHMPR+ 
Sbjct: 80  REEMQRLLGLDAKTFNCCVDLGYEALDTVGNADETRTWARNNGYTKLIIVTSRYHMPRSL 139

Query: 136 LELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            EL  +   V  IPYP+      E +        RVL+ EYLK L
Sbjct: 140 AELALVMPKVTLIPYPVTPRHFPETAWWLHSSTTRVLVSEYLKFL 184


>gi|92116288|ref|YP_576017.1| hypothetical protein Nham_0669 [Nitrobacter hamburgensis X14]
 gi|91799182|gb|ABE61557.1| protein of unknown function DUF218 [Nitrobacter hamburgensis X14]
          Length = 238

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 91/180 (50%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A ELL    G+++ ISG
Sbjct: 34  IGFVGAAVGFVGFLSQLRGVETKPASNADGIVVLTGGSSRISDAVELLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W ++  F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDNQRLLTCCVDLDRSAVNTRSNASETRRWVDEQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      +  IP+ +I     E         LR+LL EY K L   +++ L+
Sbjct: 154 HMPRAIVELSYAMPDITLIPFAVIGDKWREEPWWTSGATLRLLLSEYAKYLAAEVRVRLA 213


>gi|85713578|ref|ZP_01044568.1| hypothetical protein NB311A_03539 [Nitrobacter sp. Nb-311A]
 gi|85699482|gb|EAQ37349.1| hypothetical protein NB311A_03539 [Nitrobacter sp. Nb-311A]
          Length = 239

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 91/180 (50%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A ELL    G+++ ISG
Sbjct: 34  IAFVGAGVGFVGFLSQLRGVETKPVNNADGIVVLTGGSSRISDAVELLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W ++  F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDSQQLLTCCVDLDRSAVNTRSNASETRRWVDEQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      V  IP+ +I     E         LR+LL EY+K L    ++ L+
Sbjct: 154 HMPRAIVELSHAMPNVTLIPFAVIGDKWREEPWWTSGTTLRLLLSEYVKYLAAEARVRLA 213


>gi|75674776|ref|YP_317197.1| hypothetical protein Nwi_0578 [Nitrobacter winogradskyi Nb-255]
 gi|74419646|gb|ABA03845.1| Protein of unknown function DUF218 [Nitrobacter winogradskyi
           Nb-255]
          Length = 241

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 90/180 (50%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A +LL    G+++ ISG
Sbjct: 34  IAFVGAAVGFVGFLSQLRGVETKPAANADGIVVLTGGSSRISDAVDLLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W +   F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDSQRLLTCCVDLDRSAVNTRSNASETRRWVDGQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      V  IP+ +I     E         LR+LL EY+K L    ++ L+
Sbjct: 154 HMPRAIVELSHAMPDVTLIPFAVIGEKWREEPWWTSGATLRLLLSEYVKYLAAEARVRLA 213


>gi|220921160|ref|YP_002496461.1| hypothetical protein Mnod_1152 [Methylobacterium nodulans ORS 2060]
 gi|219945766|gb|ACL56158.1| protein of unknown function DUF218 [Methylobacterium nodulans ORS
           2060]
          Length = 245

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 96/180 (53%), Gaps = 1/180 (0%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHH 72
           + F +GF++F+  + +     H     IV LTG   RI  A +LL    G ++ I+GV+ 
Sbjct: 41  LAFGVGFLAFVGCLARTERQPHAPADGIVALTGGAQRIGDAIDLLAAGYGRRLLITGVNE 100

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
             S++ + +  P +Q L  CC+D+ Y+A NT GNA E   W  +N F  V +VT +YHMP
Sbjct: 101 RTSREEIARLNPGQQHLIACCVDLDYRARNTIGNAIETRRWMRENGFRTVAVVTSNYHMP 160

Query: 133 RTFLEL-QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQ 191
           RT LEL   +    + +P+P++    + ++        R+L+ EY+K L+  I+    T 
Sbjct: 161 RTLLELGHALADGNRVVPHPVVHDGFDPDAWWHHPASARLLVSEYVKFLVAWIRTRFETD 220


>gi|299132206|ref|ZP_07025401.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
 gi|298592343|gb|EFI52543.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
          Length = 236

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 93/183 (50%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           LF   + F+ GF  F   ++            IVVLTG   R+  A +LL    G+++ I
Sbjct: 28  LFSFFVIFLAGFAWFASQLRSEESKPDRHADGIVVLTGGASRVADALDLLSKGYGKRLLI 87

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     +L+  P  Q L +CC+D+   A+NT  NA E   W ++  FH +++VT 
Sbjct: 88  SGVHPANGAADILRAQPESQALLKCCVDLDRSAVNTRSNATETRRWVKERGFHSLIVVTS 147

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +EL      +  I YP++S              +R++ +EY+K L+  +++ 
Sbjct: 148 NYHMPRATVELTHAMPDIDLIFYPVVSEAWRGEPWWNSPAGVRLVALEYVKYLVAQVRVR 207

Query: 188 LST 190
           L+ 
Sbjct: 208 LAA 210


>gi|323136484|ref|ZP_08071566.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
 gi|322398558|gb|EFY01078.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
          Length = 225

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 98/177 (55%), Gaps = 3/177 (1%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           F+ G+++F   + +          A+V LTG   R+  A + L     +++ I+GV+ + 
Sbjct: 32  FVAGYVAFALSLARQEPILKVEAEAVVALTGGSDRVLDAADFLARGQAKRMLITGVNRAT 91

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI-VTHDYHMPR 133
              +L + +P+ +DL  CC+D+GY+A++T GNA+E   WA+  N    LI VT +YHMPR
Sbjct: 92  RSSVLARILPVSRDLFNCCVDLGYQAMDTAGNARETREWAQSRNITRSLIVVTSNYHMPR 151

Query: 134 TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL--LLSIQLSL 188
             +EL      ++  P+P++S  ++       + + R++  EY+K L  LL  +LSL
Sbjct: 152 ALVELSAALPDIKLYPFPVVSEHVDVADWATDLGVARLVGSEYVKFLGALLRTRLSL 208


>gi|39937792|ref|NP_950068.1| hypothetical protein RPA4734 [Rhodopseudomonas palustris CGA009]
 gi|39651652|emb|CAE30174.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 255

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 95/184 (51%), Gaps = 5/184 (2%)

Query: 10  VCLIFFIMGFISFIRYVKQM----HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           V  + F++G   F+ ++ Q+      P H +   IVVLTG   R+  A ELL    G+++
Sbjct: 45  VLALGFLVGAGGFVVFLSQLRGAEQKPRH-NADGIVVLTGGSSRVSDAVELLAAGYGKRL 103

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH +     + + +P  +D   CC+D+   A++T  NA E   W ++  F  +++V
Sbjct: 104 LISGVHRTNGARDISRSVPESRDWFSCCVDLDRSAVDTRSNASETRRWVQERGFRSLIVV 163

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + ++
Sbjct: 164 TSNYHMPRAIAEMSHAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELR 223

Query: 186 LSLS 189
           + LS
Sbjct: 224 VRLS 227


>gi|27376503|ref|NP_768032.1| hypothetical protein blr1392 [Bradyrhizobium japonicum USDA 110]
 gi|27349644|dbj|BAC46657.1| blr1392 [Bradyrhizobium japonicum USDA 110]
          Length = 234

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 91/186 (48%), Gaps = 5/186 (2%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDIL 79
           I+F+  ++   I        IVVLTG   R+  A ELL    G ++ ISGVH + +   +
Sbjct: 37  IAFLSQLRGAEIAPDRKADGIVVLTGGSSRVSDAMELLAAGYGRRLLISGVHPTSTASDI 96

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
            + +P  Q    CC+D+   AL+T GNA EA  WA+   F  +++VT +YHMPR  +E  
Sbjct: 97  SRTLPENQSFMTCCVDLDRTALSTRGNAAEARRWAQARRFKSLIVVTSNYHMPRALVEFS 156

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFIT 199
                   IP+ ++     E         LR+LL EY+K +   +++ L       F I 
Sbjct: 157 HAMPETILIPFAVVGDKWREEPWWASASTLRLLLSEYVKYIAAEVRVRL-----EDFGID 211

Query: 200 LIEEIT 205
           L  E++
Sbjct: 212 LSPEVS 217


>gi|192293574|ref|YP_001994179.1| hypothetical protein Rpal_5216 [Rhodopseudomonas palustris TIE-1]
 gi|192287323|gb|ACF03704.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           TIE-1]
          Length = 241

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 95/184 (51%), Gaps = 5/184 (2%)

Query: 10  VCLIFFIMGFISFIRYVKQM----HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           V  + F++G   F+ ++ Q+      P H +   IVVLTG   R+  A ELL    G+++
Sbjct: 31  VLALGFLVGAGGFVVFLSQLRGAEQKPRH-NADGIVVLTGGSSRVSDAVELLAAGYGKRL 89

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH +     + + +P  +D   CC+D+   A++T  NA E   W ++  F  +++V
Sbjct: 90  LISGVHRTNGARDISRSVPESRDWFSCCVDLDRSAVDTRSNASETRRWVQERGFRSLIVV 149

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + ++
Sbjct: 150 TSNYHMPRAIAEMSHAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELR 209

Query: 186 LSLS 189
           + LS
Sbjct: 210 VRLS 213


>gi|298293358|ref|YP_003695297.1| hypothetical protein Snov_3404 [Starkeya novella DSM 506]
 gi|296929869|gb|ADH90678.1| protein of unknown function DUF218 [Starkeya novella DSM 506]
          Length = 228

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 88/161 (54%), Gaps = 1/161 (0%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           GF  F+  +K            IVVLTG   RI  A  LL    G ++ I+GVH   +  
Sbjct: 42  GFGLFVAGIKGREAQTARRADGIVVLTGGAERITDATNLLVEGRGTRLLITGVHPDTTLA 101

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            + + +P  ++  ECC+++G  ALNT GNA E + WA ++ F  +L+VT  +HMPR  +E
Sbjct: 102 EIGRTVPATRESLECCVELGRAALNTRGNAIETAQWAREHRFRSLLVVTSAWHMPRALVE 161

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           L+R    V+ +PYP++     EN     +  +R+L +EY+K
Sbjct: 162 LRRALPDVELVPYPVVPKRGPENWEA-SLANVRLLFVEYVK 201


>gi|295690243|ref|YP_003593936.1| hypothetical protein Cseg_2870 [Caulobacter segnis ATCC 21756]
 gi|295432146|gb|ADG11318.1| protein of unknown function DUF218 [Caulobacter segnis ATCC 21756]
          Length = 205

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 96/176 (54%), Gaps = 5/176 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVK-QMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKI 65
           L + L+ + +G ++F   V      P+ P    +V LTG   +R+E A  LLE   G+++
Sbjct: 7   LLIALMIWGLGLVAFTGRVDLSTPAPEPPEADGVVALTGASSLRLEAATRLLEEGKGKRL 66

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV+   ++  +       + + +CC+D+G+ A NT GNA E + WA    +  +++V
Sbjct: 67  LISGVNRETTRADVQSVTKAVKPIYDCCVDLGFTAANTVGNALETAEWARSKGYKSLIVV 126

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI-LRVLLIEYLKIL 180
           T DYHMPR+ LEL      V+  PYP+ + DL  +   +K  I  R +++EY K L
Sbjct: 127 TADYHMPRSMLELSAAMPGVKLFPYPVKT-DLNAH-RWWKTSISARRMIVEYCKYL 180


>gi|16126457|ref|NP_421021.1| hypothetical protein CC_2218 [Caulobacter crescentus CB15]
 gi|221235238|ref|YP_002517674.1| hypothetical protein CCNA_02301 [Caulobacter crescentus NA1000]
 gi|13423723|gb|AAK24189.1| hypothetical protein CC_2218 [Caulobacter crescentus CB15]
 gi|220964410|gb|ACL95766.1| hypothetical protein CCNA_02301 [Caulobacter crescentus NA1000]
          Length = 205

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 95/175 (54%), Gaps = 3/175 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQ-MHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKI 65
           L + L+ + +G ++F   V Q    P+ P    +V LTG   +R+E A  LLE+  G+++
Sbjct: 7   LLIALMIWGLGLLAFTGRVDQSTPAPEPPISDGVVALTGASTLRLEAATRLLEDGKGQRL 66

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV+   ++  +       + + +CC+D+G+ A NT GNA+E + WA    +  +++V
Sbjct: 67  LISGVNREATRAEIQAVTKAVKPIYDCCVDLGFAAANTVGNARETAEWARSKGYKSLIVV 126

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           T DYHMPR+ LEL+     V   PYP+ + DL            R +++EY K L
Sbjct: 127 TADYHMPRSMLELRAAMPNVVLHPYPVKT-DLNARRWWKTGVSARRMIVEYCKYL 180


>gi|316936202|ref|YP_004111184.1| hypothetical protein Rpdx1_4910 [Rhodopseudomonas palustris DX-1]
 gi|315603916|gb|ADU46451.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           DX-1]
          Length = 241

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 89/182 (48%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF++F+  +    +    +   IVVLTG   R+  A ELL    G ++ I
Sbjct: 32  LALGFVAVAGGFVAFLAQLHSAELQPRRNAEGIVVLTGGSSRVSDAVELLAAGYGRRLLI 91

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P   D   CC+D+   A++T  NA E   W  +  F  +++VT 
Sbjct: 92  SGVHRTNGARDISRSVPESSDWFSCCVDLDRSAVDTRSNAAETRRWVRERGFRSLIVVTS 151

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + +++ 
Sbjct: 152 NYHMPRAIAEMSDAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELRVR 211

Query: 188 LS 189
           LS
Sbjct: 212 LS 213


>gi|209883916|ref|YP_002287773.1| hypothetical protein OCAR_4768 [Oligotropha carboxidovorans OM5]
 gi|209872112|gb|ACI91908.1| protein of unknown function [Oligotropha carboxidovorans OM5]
          Length = 234

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 90/179 (50%)

Query: 12  LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVH 71
           +I F+ GF  F   +    I        IVVLTG   R+  A +LL    G+++ ISGVH
Sbjct: 32  VIIFLAGFAWFAGQLHSEEIKPERHADGIVVLTGGASRVADALDLLSRGYGKRLLISGVH 91

Query: 72  HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHM 131
            +     +L+  P R+ L  CC+D+   A+NT  NA E   W ++  F  +++VT +YHM
Sbjct: 92  PANGTADILRAQPERETLLSCCVDLDRSAVNTRSNATETRRWVKERGFRSLIVVTSNYHM 151

Query: 132 PRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           PR  +EL      +  I YP++S              +R++ +EY+K L   +++ L+ 
Sbjct: 152 PRASVELSHAMPDIDLIFYPVVSEAWRGEPWWHSAAGIRLVALEYVKYLAAQVRVRLAA 210


>gi|254562029|ref|YP_003069124.1| hypothetical protein METDI3633 [Methylobacterium extorquens DM4]
 gi|254269307|emb|CAX25273.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 234

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 94/177 (53%), Gaps = 1/177 (0%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPI 85
           V++   P    V  IV +TG   R+  A +LL    G ++ ISGV+   ++D +++  P 
Sbjct: 40  VERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLISGVNERTTRDEIVRLNPS 99

Query: 86  RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR-INST 144
           ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +YHMPRT +EL+  +   
Sbjct: 100 QEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSNYHMPRTLVELRHALKDG 159

Query: 145 VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
              IPYP++S  L+ +       + R+L  EYLK L+   +    +      F  LI
Sbjct: 160 ETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTRFESDPEQSRFAVLI 216


>gi|188582230|ref|YP_001925675.1| hypothetical protein Mpop_2985 [Methylobacterium populi BJ001]
 gi|179345728|gb|ACB81140.1| protein of unknown function DUF218 [Methylobacterium populi BJ001]
          Length = 234

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 91/177 (51%), Gaps = 1/177 (0%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPI 85
           V+Q   P    +  IV +TG   R+  A +LL    G+++ ISGV+   ++D +++  P 
Sbjct: 40  VEQAERPSLDGIDGIVAMTGGSQRVGDAIDLLAEGHGKRLLISGVNERTTRDEIVRLNPS 99

Query: 86  RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR-INST 144
           ++    CC+D+ Y+A NT GNA E   W  ++ F  + +VT  YHMPRT +EL+  +   
Sbjct: 100 QEHWITCCVDLDYRARNTIGNAIETRRWMRRHGFTAIAVVTSSYHMPRTLVELRHALRDG 159

Query: 145 VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
              IPYP++S  L+         ++R+L  EYLK L+   +           F  LI
Sbjct: 160 ETLIPYPVVSDGLDLGRWWADPAVMRLLGAEYLKFLVAWGRTRFEADPEQSRFAVLI 216


>gi|154252045|ref|YP_001412869.1| hypothetical protein Plav_1593 [Parvibaculum lavamentivorans DS-1]
 gi|154155995|gb|ABS63212.1| protein of unknown function DUF218 [Parvibaculum lavamentivorans
           DS-1]
          Length = 208

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 88/167 (52%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           ++ GF  F   ++++     P    IV LTG P RI  A++LL+   G ++ I+GVH  V
Sbjct: 30  YVAGFFLFTAELERIPPVRVPVADGIVALTGGPDRITAAYKLLQEGKGNRLLITGVHPDV 89

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           S   L + +P      +CC+D+G+ A NT GNA E + W  + N+  +++VT  YH+PR 
Sbjct: 90  SVASLKEMVPGGSAKFDCCVDLGHMAENTIGNATETAEWVRERNYRSIILVTSTYHLPRA 149

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            LEL R    V+   +P+    L  +         R+L+ EY K LL
Sbjct: 150 RLELARAMPDVEISAFPVFQDTLHLDGWWAYPGTTRLLISEYTKYLL 196


>gi|296447118|ref|ZP_06889050.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
 gi|296255387|gb|EFH02482.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
          Length = 232

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 93/179 (51%), Gaps = 6/179 (3%)

Query: 8   LFVCLIFF-----IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           L +CL  F     + GFI F   +++           +VVLTG   RI  A ELL     
Sbjct: 22  LLLCLAGFLASGFVAGFIGFALSLERAEPILTVQADGVVVLTGGSDRIHEAAELLARGQA 81

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++ I+GV+ S     + + +P+ + L +CCID+GY+AL+T GNA E   WA+       
Sbjct: 82  RRLLITGVNKSTRGPEIAKLLPVSRQLFDCCIDLGYEALDTAGNAAETREWAKARGIGGS 141

Query: 123 LI-VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           LI VT +YHMPR  +EL      V+  P+P++S  ++    +    + R++  EY+K L
Sbjct: 142 LIVVTSNYHMPRALVELSAALPGVELYPFPVVSEHMQVADWLDDASVARLIGGEYVKYL 200


>gi|170740433|ref|YP_001769088.1| hypothetical protein M446_2193 [Methylobacterium sp. 4-46]
 gi|168194707|gb|ACA16654.1| protein of unknown function DUF218 [Methylobacterium sp. 4-46]
          Length = 245

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 1/164 (0%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F+ F+  + +     +     IVVLTG   RI  A +LL    G ++ I+GV+   S+D 
Sbjct: 47  FLVFVGGLARTEQQPYARADGIVVLTGGAQRIGDAIDLLAAGFGRRLLITGVNERTSRDE 106

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + +  P +Q L  CC+D+ Y+A NT GNA E   W  +N F  + +VT +YHMPRT LEL
Sbjct: 107 IARLNPGQQHLISCCVDLDYRARNTIGNAIETRRWMRENGFRTIAVVTSNYHMPRTLLEL 166

Query: 139 QR-INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
              + S  + +P+P++    + ++        R+L  EY+K L+
Sbjct: 167 DHALTSGDRVVPHPVVHEGFDADAWWHHPASARLLASEYVKFLV 210


>gi|118591370|ref|ZP_01548768.1| hypothetical protein SIAM614_27023 [Stappia aggregata IAM 12614]
 gi|118436042|gb|EAV42685.1| hypothetical protein SIAM614_27023 [Stappia aggregata IAM 12614]
          Length = 241

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 95/189 (50%), Gaps = 1/189 (0%)

Query: 1   MRYFWYGLFVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           +R  +  +   L+    G F  F + V    +P   +  AIVVLTG   R+  A  LLE 
Sbjct: 49  LRVLFVAVVTALLAGTAGQFAMFAQKVANARVPATANADAIVVLTGGHARVNEAVRLLEE 108

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
               ++ ISGVH   +++ L         L    +D+   ALNT GNA E + W  KN F
Sbjct: 109 GRANRLLISGVHPGTTREQLAAVTASNMPLETNSVDLDRVALNTAGNAVETANWVRKNGF 168

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             +L+VT  YH+PR  +EL      V  I YP+ S DL+ +    +   +R+L+ EY+K 
Sbjct: 169 SSLLVVTSAYHLPRAKVELAGALPDVSLIAYPVFSKDLKLDHWYREPATMRLLMREYVKY 228

Query: 180 LLLSIQLSL 188
           +L  +++++
Sbjct: 229 ILARLRITV 237


>gi|83859181|ref|ZP_00952702.1| hypothetical protein OA2633_12290 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852628|gb|EAP90481.1| hypothetical protein OA2633_12290 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 191

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 87/170 (51%), Gaps = 5/170 (2%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
           F+ L  F++GF  F+R  +           AIVVLTG P R+  A  LL++  G ++ IS
Sbjct: 14  FILLTAFVVGFALFVRQARTFTPDASVRGQAIVVLTGGPNRVSTAAALLQDGSGRRLLIS 73

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           GV+       +       Q L ECC+D G +A +T GNA E +AWA ++ +  +++VT D
Sbjct: 74  GVNPDSPPADIAAAAGASQALFECCVDFGLQAADTIGNAAETAAWARQHGYDRIIVVTSD 133

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           YHMPR  LELQ     V+ + Y + +               R  L+EY+K
Sbjct: 134 YHMPRALLELQAAMPDVRLVAYGVPAPAPWSGG-----HEARRWLVEYVK 178


>gi|315500246|ref|YP_004089049.1| hypothetical protein Astex_3264 [Asticcacaulis excentricus CB 48]
 gi|315418258|gb|ADU14898.1| protein of unknown function DUF218 [Asticcacaulis excentricus CB
           48]
          Length = 214

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 90/156 (57%), Gaps = 1/156 (0%)

Query: 40  IVVLTG-EPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGY 98
           IVVLTG   +RI+    LLE + G ++ ISGV+  V ++ LL      + L ECC+D+GY
Sbjct: 41  IVVLTGASDMRIKEGMRLLERRKGARMLISGVNREVKREELLPVTEGSKKLYECCVDLGY 100

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
           +A  T GNA E + WA+   F  +++VT DYH+PR+ LE++     V+   YP+ +  L+
Sbjct: 101 EAQTTLGNAYEVAEWAKAKGFDDLIVVTSDYHVPRSLLEIKAALPGVKLHAYPVATPTLD 160

Query: 159 ENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTAS 194
                   +  RVL++EY K L +  +   S+ T+S
Sbjct: 161 AREWWKSWRSSRVLIVEYSKYLAILARDIFSSLTSS 196


>gi|304394191|ref|ZP_07376114.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303293631|gb|EFL88008.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 241

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 101/203 (49%), Gaps = 3/203 (1%)

Query: 2   RYFWYGLFVCLIFFIMGFISF---IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLE 58
           R F   LF+ +   + GF+ F   +   +Q+     P+  A+VVLTG   RI    +L+ 
Sbjct: 37  RLFLVLLFIGVGLLVGGFLKFSDGVTSTEQLEAARVPAADAVVVLTGGSARIAEGLDLIA 96

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G+++ ISGV+   S   L         L +CC+D+   AL+T GNA+E + W     
Sbjct: 97  AGKGKRLLISGVNEDTSVAALKAINTNHAPLFDCCVDVERAALDTIGNARETAKWVADKG 156

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  +++VT  YHMPR+ LE +R    +   P+ +I   L         + LR L++EY+K
Sbjct: 157 YSSLIVVTSSYHMPRSLLEFRRTMPKLNIKPHAVILEPLAREGWWKNPETLRFLVVEYVK 216

Query: 179 ILLLSIQLSLSTQTASQFFITLI 201
            +  +++  L  QT S    +++
Sbjct: 217 YVGAAMREYLKPQTISALRGSML 239


>gi|86747962|ref|YP_484458.1| hypothetical protein RPB_0836 [Rhodopseudomonas palustris HaA2]
 gi|86570990|gb|ABD05547.1| Protein of unknown function DUF218 [Rhodopseudomonas palustris
           HaA2]
          Length = 240

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 3/171 (1%)

Query: 22  FIRYVKQMHIPD-HPSVSA--IVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F  ++ Q+ + +  PS +A  IVVLTG   R+  A +LL +  G+++ ISGVH +     
Sbjct: 42  FAAFLLQLRVEESRPSRAADGIVVLTGGSSRVSDAVDLLASGYGKRLLISGVHRTSGASE 101

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + + +P  +D   CC+D+   A NT  NA E   WA +  F  +++VT +YHMPR   E+
Sbjct: 102 ISRSVPDSKDWLGCCVDLDRSAFNTRSNAAETRRWAHERGFRSLIVVTSNYHMPRAIAEM 161

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
                 ++ IP+ +I     + +       LR+LL EY K + +  ++ L+
Sbjct: 162 SHAMPDIELIPFSVIGEKWRDEAWWSSGATLRLLLSEYAKYVAVEARVRLA 212


>gi|170749389|ref|YP_001755649.1| hypothetical protein Mrad2831_2982 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655911|gb|ACB24966.1| protein of unknown function DUF218 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 258

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 91/176 (51%), Gaps = 1/176 (0%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           G  + ++    GF+ F+  + +           IV LTG   RI  A +LL    G ++ 
Sbjct: 44  GAGLGMLALFAGFLVFVSALARHERTPTDRADGIVALTGGAQRIGDAIDLLAGGYGRRLL 103

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           I+GV+   S+D + +  P ++ L  CC+D+ Y+A NT GNA E   W   + F  V +VT
Sbjct: 104 ITGVNERTSRDEIARLNPTQRALIACCVDLDYRARNTIGNAIETRRWMRAHRFSTVAVVT 163

Query: 127 HDYHMPRTFLELQR-INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +YHMPRT +EL   +  + + +P+P+++   + +         R+L  EY+K L+
Sbjct: 164 SNYHMPRTLVELDHALQDSDRVLPHPVVTEAFDADRWWQNPPAARLLASEYMKFLV 219


>gi|254500805|ref|ZP_05112956.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436876|gb|EEE43555.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 243

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 93/185 (50%), Gaps = 4/185 (2%)

Query: 8   LFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
           L  C+  F++G    F +F   V    +P      AIVVLTG   R+  A  LLE     
Sbjct: 55  LVACVTVFVVGTTIQFANFANRVSTATVPVSTQADAIVVLTGGQERVSEAVRLLEEGHAG 114

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ISGVH   ++  +       + L E  +++   ALNT GNA E + W  KN F  +L
Sbjct: 115 RLLISGVHPGTTRKQIAVVTASAKPLEEGSVELDRVALNTAGNATETANWVRKNGFDSLL 174

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT  YH+PR   EL      V  I YP+ + DL+  +   K   +R+L+ EY+K  +  
Sbjct: 175 VVTSAYHLPRATAELSGALPDVTLIGYPVFAKDLQLEAWHTKPATIRLLIREYVKYTVAR 234

Query: 184 IQLSL 188
           +++++
Sbjct: 235 LRIAV 239


>gi|46206241|ref|ZP_00047534.2| COG1434: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 178

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 86/160 (53%), Gaps = 1/160 (0%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           +TG   RI  A +LL    G+++ ISGV+   +++ +++  P ++    CC+D+ Y+A N
Sbjct: 1   MTGGAQRIGDAIDLLAGGRGKRLLISGVNERTTREEIIRLNPAQEQWISCCVDLDYRARN 60

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR-INSTVQFIPYPIISHDLEENS 161
           T GNA E   W  ++ F  V +VT  YHMPRT +EL+  +N+    IPYP+++  LE   
Sbjct: 61  TIGNAIETRRWMRRHRFGTVAVVTSSYHMPRTLVELRHALNAGETVIPYPVVTEGLEIER 120

Query: 162 SIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                   R+L  EYLK L+  ++    T      F  LI
Sbjct: 121 WWADPAATRLLGAEYLKFLVAWLRTRFETDPEQSRFAVLI 160


>gi|115526818|ref|YP_783729.1| hypothetical protein RPE_4830 [Rhodopseudomonas palustris BisA53]
 gi|115520765|gb|ABJ08749.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisA53]
          Length = 233

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 81/155 (52%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID 95
           +   IVVLTG   R+  A ELL +  G+++ ISGVH +     + + +P      +CCID
Sbjct: 52  NADGIVVLTGGSSRVSDAIELLSSGYGKRLLISGVHRTNGVHDISRTVPDSHRWLDCCID 111

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +   A+NT  NA EA  WA +  F  +++VT +YHMPR  +E+      V+ IP+ ++  
Sbjct: 112 LDRSAINTRSNAAEARRWAHERGFRSLIVVTSNYHMPRAIVEMSHAMPDVELIPFAVVGD 171

Query: 156 DLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
              +          R+LL EY K L    ++ L++
Sbjct: 172 KWRDEPWWSSGTTFRLLLSEYAKYLAAETRVRLAS 206


>gi|197104094|ref|YP_002129471.1| hypothetical protein PHZ_c0628 [Phenylobacterium zucineum HLK1]
 gi|196477514|gb|ACG77042.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 211

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 97/182 (53%), Gaps = 10/182 (5%)

Query: 8   LFVCLIFFIMGFISFIRYVKQ---MHIPDHPSVSAIVVLTGEPI--RIERAFELLENQIG 62
           L + LI+F  G  ++   V+Q     +P  P    IV LTG     RI  A  LLE+  G
Sbjct: 8   LVLALIWF-AGLFAYAHRVQQSTPARLP--PPADGIVALTGAGSKERIAAAIGLLEDGYG 64

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++ +SGV+   S++ +       + L +CC+D+G+ A +T GNA+E + W E   +  +
Sbjct: 65  RRVLVSGVNPEASREDIRNLSRAVRRLYDCCVDLGFTAADTVGNARETAEWTEAMRYRSL 124

Query: 123 LIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            IVT DYHMPR  LEL+ +   + V+   Y + +  L+ +    + +  R++++EY K L
Sbjct: 125 TIVTADYHMPRAMLELRAVFHGTGVRLSTYAVPTPALKSSHWWRQPRAARLMVVEYCKYL 184

Query: 181 LL 182
            +
Sbjct: 185 AI 186


>gi|163793809|ref|ZP_02187783.1| hypothetical protein BAL199_12291 [alpha proteobacterium BAL199]
 gi|159180920|gb|EDP65437.1| hypothetical protein BAL199_12291 [alpha proteobacterium BAL199]
          Length = 231

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 97/195 (49%), Gaps = 14/195 (7%)

Query: 7   GLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSV----SAIVVLTGEPIRIERAFELLEN 59
           GL + ++   +     I  +RY  +  IP  P++    +A+VVLTG   R++    LL  
Sbjct: 20  GLLITVVVLSLATAWTIGLVRYASR--IPTQPTLVEPAAAVVVLTGGSKRMDAGVALLAK 77

Query: 60  QIGEKIFISGVHHSVSKDILLQKIP-----IRQDLAECCIDIGYKALNTEGNAQEASAWA 114
                +F+SGV H V    +   IP     + Q   +CC+ +GY A +T GNA+E + WA
Sbjct: 78  GTAPVLFVSGVDHRVDPARIRDLIPDAGDSLDQATIDCCVVLGYGASDTLGNARETALWA 137

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
                  +++VT +YHMPR  LE       V+ +PYP+I  D+  ++       L ++  
Sbjct: 138 RATERTSLILVTSNYHMPRARLEFTHALPEVRLVPYPVIPPDVRMDAWWRWPGTLGLVAG 197

Query: 175 EYLKILLLSIQLSLS 189
           E+ K +   +++ L+
Sbjct: 198 EWTKYVFARVRIGLA 212


>gi|209967333|ref|YP_002300248.1| hypothetical protein RC1_4097 [Rhodospirillum centenum SW]
 gi|209960799|gb|ACJ01436.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 244

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 90/191 (47%), Gaps = 6/191 (3%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           G     + +  G   F   + +    D     AIVVLTG   R+   FELL      K+F
Sbjct: 39  GALTLAVAWFAGLFLFAAGLPRTPPEDDRQTDAIVVLTGGSERLAAGFELLRAHRARKLF 98

Query: 67  ISGVHHSVSKDILLQ---KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ISGV+  V    LL+   + P   DL ECCI +GY A +TEGNA E + W  +  F  + 
Sbjct: 99  ISGVYRGVDVQELLRLSRQAP--GDL-ECCIVLGYAADDTEGNAAETALWVRQEGFRSLR 155

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT +YHMPR+ +E +R    V  I +P+   ++             +++ EY K LL  
Sbjct: 156 VVTANYHMPRSLVEFRRALPEVDLIAHPVAPPNVRLEHWWRWPGTASLIVGEYNKFLLAW 215

Query: 184 IQLSLSTQTAS 194
            +  L    A+
Sbjct: 216 TRALLPVPAAT 226


>gi|83313543|ref|YP_423807.1| hypothetical protein amb4444 [Magnetospirillum magneticum AMB-1]
 gi|82948384|dbj|BAE53248.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 206

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 80/153 (52%), Gaps = 1/153 (0%)

Query: 29  MHIPDHPSVS-AIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ 87
           + + D  +V+ A+VVLTG   R+     LLE   G K+F+SGVH  V    LL++  +  
Sbjct: 37  IRVEDQSTVTDAVVVLTGGAERLNSGIALLEAGRGRKLFVSGVHRGVDLPDLLRQAHVSP 96

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
           + A CCI +G+ A +T GNA E +AW  +  F  + +VT  YHM R+ LEL+R       
Sbjct: 97  ERARCCIVLGHAADDTVGNATETAAWMGREGFSSLRLVTAAYHMRRSLLELRRALPDATI 156

Query: 148 IPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           I +P+     + +          +L +EY K L
Sbjct: 157 IAHPVFPDAFKRDQWWRWPGTAHLLAVEYTKYL 189


>gi|56551314|ref|YP_162153.1| hypothetical protein ZMO0418 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241760967|ref|ZP_04759056.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753066|ref|YP_003225959.1| hypothetical protein Za10_0828 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542888|gb|AAV89042.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374586|gb|EER64047.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552429|gb|ACV75375.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 203

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 86/174 (49%), Gaps = 15/174 (8%)

Query: 9   FVCL-IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
            +CL + ++ GF  F  Y    H  +      IVVLTG   RI+R   +LE    +K+ +
Sbjct: 14  LICLFMLWLGGFWLF--YSFHAHPTNKQVTDGIVVLTGGAGRIDRGLMMLERHQAKKMLV 71

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGV+  V  + L     I   L ECC+D+G +A++T  NAQE + W   N++H V ++T 
Sbjct: 72  SGVNRQVKAEELAALYDIPSHLIECCVDLGTQAVDTSSNAQETAEWITLNHYHSVRLITT 131

Query: 128 DYHMPRTFLELQ-RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           D+HM R   EL   I   ++ +   I SH              RV +IEY K L
Sbjct: 132 DWHMARARFELSLMIGKDIKVVEDAIPSH-----------AGWRVWIIEYCKYL 174


>gi|288962085|ref|YP_003452380.1| hypothetical protein AZL_d00100 [Azospirillum sp. B510]
 gi|288914351|dbj|BAI75836.1| hypothetical protein AZL_d00100 [Azospirillum sp. B510]
          Length = 213

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%)

Query: 37  VSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDI 96
             AIVVLTG   R+    ELL     +K+F+SGV+  V    LL+         ECCI +
Sbjct: 56  TDAIVVLTGGRNRLSTGLELLAAGRAKKLFVSGVYDGVEVQELLKLSRHSPTEMECCITL 115

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           GY A +T GNA E + W     FH + +VT +YHM R+ LEL      V  +P+P+++  
Sbjct: 116 GYSADSTIGNAYETADWMHDQGFHSLRLVTANYHMRRSLLELSMAMPDVDLLPHPVVAPT 175

Query: 157 LEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           +  +          +L+ EY K+L++ ++
Sbjct: 176 VHLDDWWMWPGTANLLVTEYNKLLVVGLR 204


>gi|258542112|ref|YP_003187545.1| hypothetical protein APA01_10160 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633190|dbj|BAH99165.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636247|dbj|BAI02216.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639302|dbj|BAI05264.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642356|dbj|BAI08311.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645411|dbj|BAI11359.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648466|dbj|BAI14407.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651519|dbj|BAI17453.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654510|dbj|BAI20437.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 194

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 84/174 (48%), Gaps = 9/174 (5%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L  C  F   GF  F+     +  P + P    IV LTG   RI+ +  LL    GEK+ 
Sbjct: 12  LLACFAF-AGGFGWFVN--DALRPPGYLPHADGIVALTGGAGRIDTSLNLLARNQGEKLL 68

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV    +   LL        LAE  I +GY+A +T GNA E + W   N+   +++VT
Sbjct: 69  ISGVDTQTTLGELLPPT-APPALAER-ITLGYQARSTIGNATETAVWVADNHITSLIVVT 126

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
             YHM R  LEL R    V   PYP++   +E      +   LR+L +EYLK L
Sbjct: 127 ASYHMRRALLELSRTLPDVTLYPYPVLPPAMEHP---LRRSSLRLLALEYLKWL 177


>gi|329114135|ref|ZP_08242897.1| Hypothetical protein APO_0915 [Acetobacter pomorum DM001]
 gi|326696211|gb|EGE47890.1| Hypothetical protein APO_0915 [Acetobacter pomorum DM001]
          Length = 216

 Score = 92.4 bits (228), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/167 (35%), Positives = 82/167 (49%), Gaps = 8/167 (4%)

Query: 15  FIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHS 73
           F  GF  F+     +  P + P    IV LTG   RI+ +  LL    GE++ ISGV   
Sbjct: 40  FAGGFGWFVN--DALRPPGYLPHADGIVALTGGAGRIDTSLNLLARNQGERLLISGVDTQ 97

Query: 74  VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR 133
            +   LL        LAE  I +GY+A +T GNA E + W   N+   +++VT  YHM R
Sbjct: 98  TTLAALLPST-APPALAER-ITLGYQARSTIGNATETAVWVADNHITSLIVVTASYHMRR 155

Query: 134 TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
             LEL R    V   PYP++   +E      +   LR+L +EYLK L
Sbjct: 156 ALLELSRTLPDVTLYPYPVLPPAMEHP---LRRSSLRLLALEYLKWL 199


>gi|294010104|ref|YP_003543564.1| hypothetical protein SJA_C1-01180 [Sphingobium japonicum UT26S]
 gi|292673434|dbj|BAI94952.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 176

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 76/131 (58%), Gaps = 4/131 (3%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
           V L+ +++GF  F  ++ Q   P D     AIVVLTG   RI+R   LL++   +++ IS
Sbjct: 8   VTLLGWMLGFAWFAIFLPQ---PLDGRQTDAIVVLTGGAGRIDRGLALLQDGAAKRMLIS 64

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           GV  SV    L  +  + + L  CCI +G +A++T  NA E + W E+ +F  V ++T D
Sbjct: 65  GVDRSVRPVELAAQYKVPERLFSCCITLGREAIDTRSNAIETAHWLERRDFKTVRLITTD 124

Query: 129 YHMPRTFLELQ 139
           +HM R+ LEL+
Sbjct: 125 WHMRRSALELR 135


>gi|296283193|ref|ZP_06861191.1| hypothetical protein CbatJ_06211 [Citromicrobium bathyomarinum
           JL354]
          Length = 176

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 89/176 (50%), Gaps = 15/176 (8%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           GL + L++ ++GFI F  ++      +     A++V TG   RIER  E+++    + + 
Sbjct: 6   GLAIVLVW-VLGFIWFAGWLPGPAPMER--TDAVIVPTGYAGRIERGLEVVQTDSADTLL 62

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ++GV   V       +  + +D+ ECC+ +G+ A +T GNAQE   WAE +    + +VT
Sbjct: 63  VTGVDPEVKPGEFAAQFKVPEDVMECCVTLGFAATDTRGNAQETREWAEAHGIKSLRLVT 122

Query: 127 HDYHMPRTFLELQR-INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            D+HM R   EL+R +   V+ I             ++     L +LLIEY K L+
Sbjct: 123 SDWHMRRAATELRRQLPGDVKLI-----------KDAVRSEPSLWLLLIEYHKWLV 167


>gi|148555918|ref|YP_001263500.1| hypothetical protein Swit_3011 [Sphingomonas wittichii RW1]
 gi|148501108|gb|ABQ69362.1| protein of unknown function DUF218 [Sphingomonas wittichii RW1]
          Length = 177

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 73/130 (56%), Gaps = 3/130 (2%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           +I GF++F  ++ Q   PD  +   IVV+TG   R+ER   LLE +  +++ ISG    V
Sbjct: 13  WIAGFMAFALFLPQ-PAPDGIATDGIVVMTGGRGRVERGLRLLEAKRAKRLLISGADRRV 71

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
               L  +      L ECC+D+G+++++T  NA EA+ W  +  +  + +VT D+HM R 
Sbjct: 72  RPHELAAQFKAPMALVECCVDLGHESVDTRSNAAEAADWIARRRYRSIRLVTSDWHMVRA 131

Query: 135 FLELQRINST 144
             +L+  N+T
Sbjct: 132 RFDLR--NAT 139


>gi|326405574|ref|YP_004285656.1| hypothetical protein ACMV_34270 [Acidiphilium multivorum AIU301]
 gi|325052436|dbj|BAJ82774.1| hypothetical protein ACMV_34270 [Acidiphilium multivorum AIU301]
          Length = 218

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 87/173 (50%), Gaps = 8/173 (4%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           + +G I+  R +  M     P    IVVLTG   R++   ELL      ++ ISG  +  
Sbjct: 43  WFLGDIAEERPINPM-----PHAGGIVVLTGGADRVKAGLELLMAGAAPRLLISGAGNGT 97

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
                  +  I  +     I +G+ A  T GNA+E +AWA +++   +++VT DYHMPR 
Sbjct: 98  YLGDFTARDGIDANAKATDITVGHAAATTRGNARETAAWASRHHIGSLVVVTADYHMPRA 157

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            LEL R    V  IP P+    +   ++  +  +L++L+ E+ K +++ ++L 
Sbjct: 158 LLELHRALPGVTLIPEPVRPPAM---TNPGQPHMLKILVTEFCKYIVVRLRLG 207


>gi|312116073|ref|YP_004013669.1| hypothetical protein Rvan_3387 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221202|gb|ADP72570.1| protein of unknown function DUF218 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 197

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 78/167 (46%), Gaps = 6/167 (3%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
           + GF  F   V  M         AIV LTG+  RI  A  LL      ++ ISGVH +  
Sbjct: 1   MCGFFIFAYSVSIMPSTRLKDADAIVALTGDEERIAAAVRLLSEGKARRLLISGVHKTTR 60

Query: 76  KDILLQKIPIRQD----LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHM 131
              ++     R      L  CC+D+   A NTE NA E + W  K  +  +++VT  YHM
Sbjct: 61  APQIMSLTTSRGSRSWSLFSCCVDLD-NAHNTEANAAETTNWVRKRGYRSIIVVTSTYHM 119

Query: 132 PRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           PR  +EL +    V+ +PYP+ +  L+E       +   VL  EY+K
Sbjct: 120 PRALIELHQAMRDVELVPYPVRAPRLDER-WWRDSRTAWVLWKEYMK 165


>gi|148262062|ref|YP_001236189.1| hypothetical protein Acry_3082 [Acidiphilium cryptum JF-5]
 gi|146403743|gb|ABQ32270.1| protein of unknown function DUF218 [Acidiphilium cryptum JF-5]
          Length = 218

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 87/173 (50%), Gaps = 8/173 (4%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           + +G I+  R +  M     P    IVVLTG   R++   ELL      ++ ISG  +  
Sbjct: 43  WFLGDIAEERPINPM-----PHAGGIVVLTGGADRVKAGLELLMAGAAPRLLISGAGNGT 97

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
                  +  I  +     I +G+ A  T GNA+E +AWA +++   +++VT DYHMPR 
Sbjct: 98  YLGDFTARDGIDANAKATDITVGHAAATTRGNARETAAWASRHHIGSLVVVTADYHMPRA 157

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            LEL R    V  IP P+    +   ++  +  +L++L+ E+ K +++ ++L 
Sbjct: 158 LLELHRALPGVTLIPEPVRPPAM---TNPGQPHMLKILVTEFCKYIVVRLRLG 207


>gi|304320133|ref|YP_003853776.1| hypothetical protein PB2503_02792 [Parvularcula bermudensis
           HTCC2503]
 gi|303299036|gb|ADM08635.1| hypothetical protein PB2503_02792 [Parvularcula bermudensis
           HTCC2503]
          Length = 194

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 78/145 (53%), Gaps = 3/145 (2%)

Query: 38  SAIVVLTGEPIR-IERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDI 96
           + +V+LTG   R I+   +L     G+++ ISG H  V K+ L + + +R  L  CC+D+
Sbjct: 45  TGMVILTGGAGRRIQHGLDLFAQGYGDRVLISGTHPLVDKEDL-EGLGVRDSL-HCCVDL 102

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           G +A  T GNA EA  WA +  +  +L+VT D+H+PR  LEL+ +   +  I   + +  
Sbjct: 103 GPRARTTIGNALEARDWARRRGYDTILLVTSDFHLPRALLELEAVAPELTVIGIAVDTRS 162

Query: 157 LEENSSIFKIKILRVLLIEYLKILL 181
               + +      RVL  EY+K +L
Sbjct: 163 APSANWMRSPSAWRVLAEEYIKYIL 187


>gi|254292607|ref|YP_003058630.1| hypothetical protein Hbal_0231 [Hirschia baltica ATCC 49814]
 gi|254041138|gb|ACT57933.1| protein of unknown function DUF218 [Hirschia baltica ATCC 49814]
          Length = 197

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 84/173 (48%), Gaps = 3/173 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           L  CL      F+SF     Q+  P  D  +  A++ LTG   RI  A E+ ++Q    +
Sbjct: 13  LVFCLFLIGYDFVSFSYRAAQLATPQFDTSNPHAVIALTGGSNRIAFAAEIAKDQ-NLPL 71

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           FISGV+     D +     +     ECC  +GYKA  T  N  E + W+ K+ +  ++IV
Sbjct: 72  FISGVNREAKPDEVAIAAGVDTAFFECCTTLGYKARTTYENGLEVAQWSTKSGYTRLIIV 131

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           T +YHM R  LEL+R    V      + S  ++ ++    ++  + + IE++K
Sbjct: 132 TSNYHMERALLELERAMPNVTLTGLAVASPAIKADAWWTDMRSAKRMGIEWVK 184


>gi|94497844|ref|ZP_01304410.1| hypothetical protein SKA58_17288 [Sphingomonas sp. SKA58]
 gi|94422733|gb|EAT07768.1| hypothetical protein SKA58_17288 [Sphingomonas sp. SKA58]
          Length = 176

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 89/177 (50%), Gaps = 16/177 (9%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
           + L+ +++GF  F  ++ +   P D     AIVVLTG P RI+R   L++     ++ IS
Sbjct: 8   LALLGWVLGFAWFAIFLPE---PLDGRRTDAIVVLTGGPGRIDRGIALMQQGAARRMLIS 64

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           GV  SV    L  +    + L +CCI +G +A++T  N  E + W  + ++  V +VT D
Sbjct: 65  GVDRSVRPGELAAQYDAPEALFDCCITLGREAIDTRSNGLETARWLARRDYQTVRLVTTD 124

Query: 129 YHMPRTFLEL-QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +HM R+ LEL Q +   +  +   + SH             L VL+ EY K LL  I
Sbjct: 125 WHMRRSALELTQALPPRIHIVYDAVPSH-----------PSLSVLMREYNKYLLRRI 170


>gi|307293520|ref|ZP_07573364.1| protein of unknown function DUF218 [Sphingobium chlorophenolicum
           L-1]
 gi|306879671|gb|EFN10888.1| protein of unknown function DUF218 [Sphingobium chlorophenolicum
           L-1]
          Length = 176

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 74/131 (56%), Gaps = 4/131 (3%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
           + L+ +++GF  F   + Q   P D     AIVVLTG   RI+R   LL++   +++ IS
Sbjct: 8   LTLLAWMLGFAWFAILLPQ---PLDGRQTDAIVVLTGGAGRIDRGLSLLQDGAAKRMLIS 64

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           GV  SV    L  +    + L  CCI +G +A++T  NA E + W E+ +F  V ++T D
Sbjct: 65  GVDRSVRPAELAAQYDAPERLFACCITLGREAIDTRSNAIETAHWLERRDFKTVRLITTD 124

Query: 129 YHMPRTFLELQ 139
           +HM R+ LEL+
Sbjct: 125 WHMRRSALELR 135


>gi|149185075|ref|ZP_01863392.1| hypothetical protein ED21_18517 [Erythrobacter sp. SD-21]
 gi|148831186|gb|EDL49620.1| hypothetical protein ED21_18517 [Erythrobacter sp. SD-21]
          Length = 201

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 89/182 (48%), Gaps = 14/182 (7%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
            +  IF +  F  F+ +   +  P   +   A++VLTG P RI R  E++E  + +++F+
Sbjct: 5   LLAAIFLVYAF-GFLGFAMTLPAPAAKTETDAVIVLTGGPGRIARGLEVVEQNMAKEMFV 63

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGV   V  +   ++  +   L +CC+ +GY A++T  NA E + W ++  F    +VT 
Sbjct: 64  SGVDPEVKPNEFAEQFEVSSRLMDCCVTLGYLAVDTRSNAGEVAQWMKEKEFTSARLVTT 123

Query: 128 DYHMPRTFLELQ-RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++HM R + E+   + + +  +   ++SH             L  L +EY K+L   +  
Sbjct: 124 NWHMARAYSEVAGTLPAGISIVKDAVVSH-----------PDLATLFLEYNKLLASEVSQ 172

Query: 187 SL 188
            L
Sbjct: 173 GL 174


>gi|114326797|ref|YP_743954.1| hypothetical protein GbCGDNIH1_0133 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314971|gb|ABI61031.1| hypothetical protein GbCGDNIH1_0133 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 216

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 86/178 (48%), Gaps = 8/178 (4%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
            L+    GF+ F    +  H+   PS    IVVLTG   R+    +LL    G  + ISG
Sbjct: 38  ALLVLSGGFLWFA--WQSQHVLRAPSHADGIVVLTGGAERVATGLKLLAAGRGSVLLISG 95

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           V    S   L +   I     E  + +GY+A  T GNA E + WA + +   V++VT  Y
Sbjct: 96  VAKGASLGTLARVAGIDPTPLEGRVMLGYEAATTRGNALETADWAHERHLRSVIVVTAGY 155

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           HMPR   EL+R    V  I YP   H  ++  S+  + IL++L  EYLK L   + LS
Sbjct: 156 HMPRALAELRRAMPDV--ILYPETVHP-DQGGSL--LNILKLLSSEYLKWLGAELHLS 208


>gi|58038750|ref|YP_190714.1| hypothetical protein GOX0275 [Gluconobacter oxydans 621H]
 gi|58001164|gb|AAW60058.1| Hypothetical protein GOX0275 [Gluconobacter oxydans 621H]
          Length = 239

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 89/178 (50%), Gaps = 10/178 (5%)

Query: 8   LFVCLIF---FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
           L  CL     ++ GF  FI+   +  +   P    IV LTG   R++    LL    G  
Sbjct: 47  LLTCLALGGLWLAGFAWFIQDASKASV-TAPVCDGIVALTGGEQRVDTGITLLRGGYGHL 105

Query: 65  IFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           + ISGV  H ++   + LQ+  +   LAE  I +G +A +T GNA E + WA  N+ H +
Sbjct: 106 LLISGVGPHVTLQHILHLQQESLSSPLAER-ITLGRRATSTIGNAHETAQWARDNHLHRL 164

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           L+VT  YH+ R  LE+ R+   +  +PYP++   L+   +    + L ++  EY K L
Sbjct: 165 LVVTAGYHIRRAVLEIHRVAPDLALVPYPVVPLALQ---APLSRRTLFLMFREYNKFL 219


>gi|83594586|ref|YP_428338.1| hypothetical protein Rru_A3256 [Rhodospirillum rubrum ATCC 11170]
 gi|83577500|gb|ABC24051.1| Protein of unknown function DUF218 [Rhodospirillum rubrum ATCC
           11170]
          Length = 226

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (51%)

Query: 33  DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
           D  +  AIVVLTG   R+    +LL   +G K+F+SGV   V+ D L   I    +    
Sbjct: 38  DQTTTDAIVVLTGGSERLPVGLDLLARGLGRKLFLSGVGVEVTLDDLRAAIVDVPENLRS 97

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            + +G+ AL+T GNA+E + W    +F  + +VT  YHMPR+ +E +     V+ I +P+
Sbjct: 98  RVVLGHAALDTVGNAEETAHWLATEHFTSLRLVTAAYHMPRSLVEFRAAMPDVRIIAHPV 157

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
               +++          R++  EY K L+  ++ +LS
Sbjct: 158 FPGSVKQQEWWMWKGTARLMAEEYSKFLVAWLRRTLS 194


>gi|85710207|ref|ZP_01041272.1| hypothetical protein NAP1_15018 [Erythrobacter sp. NAP1]
 gi|85688917|gb|EAQ28921.1| hypothetical protein NAP1_15018 [Erythrobacter sp. NAP1]
          Length = 178

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 71/135 (52%), Gaps = 2/135 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           Y L   ++ + +GF  F   + Q    +  S  A++V TG P RI +  ++LE    +++
Sbjct: 6   YLLAASVLVWALGFFWFAAALPQPA--EELSTDAVIVPTGGPGRIAQGLQVLEQGQAQRM 63

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ++GV   V++D    +  + +   +CCI +G +A++T  NA E + W   N+   + +V
Sbjct: 64  LVTGVDPEVTRDEFAAEFEVDEARMDCCITLGSEAVDTRSNATETAEWVAANDITSLRLV 123

Query: 126 THDYHMPRTFLELQR 140
           T D+HM R   EL R
Sbjct: 124 TTDWHMRRAAGELDR 138


>gi|103488367|ref|YP_617928.1| hypothetical protein Sala_2890 [Sphingopyxis alaskensis RB2256]
 gi|98978444|gb|ABF54595.1| protein of unknown function DUF218 [Sphingopyxis alaskensis RB2256]
          Length = 176

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 9   FVCLIF--FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            + L+F  +++GF  F   +            AIVV+TG P RI+RA E LE    +++ 
Sbjct: 5   LISLLFLVWVLGFAWFALLLPLPAP--PQKTDAIVVVTGGPGRIDRALERLEAGDAKRLL 62

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV   V    L  +      L +CCI +G+ A +T  NA E +AWA++  +  + +VT
Sbjct: 63  ISGVAREVKPRELAAEYGRPVALFDCCIALGFDAEDTRSNATEVAAWAKRRKYKSIRLVT 122

Query: 127 HDYHMPRTFLELQR 140
            D+HM R   E+ R
Sbjct: 123 TDWHMRRAEYEIGR 136


>gi|87198723|ref|YP_495980.1| hypothetical protein Saro_0699 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134404|gb|ABD25146.1| protein of unknown function DUF218 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 182

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 85/173 (49%), Gaps = 11/173 (6%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L + +I + +GFI F  ++ +    +      IVVLTG   RI  A  LL+   G K+ +
Sbjct: 11  LSLLMIAWALGFIWFAVFLPR-PAAEPARTDGIVVLTGGSGRIPHALRLLQTGAGRKLLV 69

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGV   V       +  +   L  CCI +GY A++T  NA E++ W + N    V +VT 
Sbjct: 70  SGVDREVRPREFAVEYDVPSRLMTCCIVLGYDAVDTRSNAVESARWMQTNRIRSVRLVTT 129

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           D+HM R   +L       Q  P  ++   + E++ + +    R+L IEY K++
Sbjct: 130 DWHMRRAAFDL------AQEAPKDLV---IVEDAVVSRPS-FRILFIEYNKLV 172


>gi|332188414|ref|ZP_08390138.1| hypothetical protein SUS17_3520 [Sphingomonas sp. S17]
 gi|332011560|gb|EGI53641.1| hypothetical protein SUS17_3520 [Sphingomonas sp. S17]
          Length = 177

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 2/126 (1%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHH 72
           + + +GF +F+  +   H  ++ +  AIVV TG   RI+R   LL+    +++ ++GV  
Sbjct: 10  LGWCLGFAAFM--LSLPHPLENNTTDAIVVPTGGAGRIDRGIALLQAHQAKRMLVTGVAP 67

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
            V    L +       L  CCID+G +A++T  NA+E + W  ++ +  V +VT D+H+P
Sbjct: 68  GVRPIDLARTYRTAPSLFSCCIDLGLEAVDTRSNAEETARWVREHGYRTVRLVTSDWHLP 127

Query: 133 RTFLEL 138
           R  +EL
Sbjct: 128 RARMEL 133


>gi|144898927|emb|CAM75791.1| Protein of unknown function DUF218 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 202

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 82/174 (47%), Gaps = 3/174 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L      +  GF+ F+  V +  + D  S   AIVVLTG   R+    +LLE  + +++F
Sbjct: 16  LVALAALWSGGFLWFVDEVPRA-VDDQTSHTDAIVVLTGGRERLTTGLDLLEAGLSQRLF 74

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV+  V    ++Q       L E  + +GY A +T GNA E + WA ++N   + IVT
Sbjct: 75  ISGVYKGVDLAEIIQLGRGHAGLKEAVV-LGYAADDTVGNAIETALWATEHNLRSLRIVT 133

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
             YHMPR   E +     +  I +P+    ++            +L  EY K L
Sbjct: 134 GAYHMPRALAEFRHALPEITLIAHPVFPDQVKSREWWRWPGTAALLATEYSKYL 187


>gi|85375113|ref|YP_459175.1| hypothetical protein ELI_11430 [Erythrobacter litoralis HTCC2594]
 gi|84788196|gb|ABC64378.1| hypothetical protein ELI_11430 [Erythrobacter litoralis HTCC2594]
          Length = 176

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 82/177 (46%), Gaps = 14/177 (7%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
           W    + ++ + +GF+ F   + Q          A++V TG   RI+R  E+L+      
Sbjct: 3   WRLFLLVVVAYALGFMWFAAALPQPRF--EGETDAVIVPTGAAGRIDRGLEVLDGGKARM 60

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ++GV   V       +  +  +   CC+ +G+ A++T GNA E + W  +N    + +
Sbjct: 61  MLVTGVDPEVRPAEFAAEFEVSMERMRCCVSLGFDAVDTRGNAAETADWVAENRIRSLRL 120

Query: 125 VTHDYHMPRTFLEL-QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           VT D+HM R   EL Q++ + ++ +   + S              L +L +EY K+L
Sbjct: 121 VTTDWHMRRASGELRQKLPTNIRIVEDAVASE-----------PSLGILFLEYNKLL 166


>gi|296536740|ref|ZP_06898797.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296262933|gb|EFH09501.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 200

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 69/154 (44%), Gaps = 7/154 (4%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP--SVSAIVVLTGEPIRIERAFELLENQI 61
            W    +  I  + GF  F    +    P+ P      I VLTG P R++    LL    
Sbjct: 15  LWLLPALLAILVVAGFALFTGQSRAR--PELPLRQTDGIAVLTGGPQRVDAGLRLLAEGH 72

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAE---CCIDIGYKALNTEGNAQEASAWAEKNN 118
              + ISG     + + L ++  +   L E     + +G +A +T GN QE + WAE   
Sbjct: 73  ARALIISGTGRDATLEELARRAGLPDPLPEGFAARVTLGREATSTRGNGQEVAEWAEARQ 132

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
              + +VT  +HMPR  LEL+R    V  +P+P+
Sbjct: 133 IGSLRVVTAAFHMPRALLELRRTLPGVALVPHPV 166


>gi|162149067|ref|YP_001603528.1| hypothetical protein GDI_3297 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161787644|emb|CAP57240.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 197

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 87/179 (48%), Gaps = 16/179 (8%)

Query: 18  GFISFIRYVKQMHIPDHPSVS-AIVVLTGEPIRIERAFELLENQIGEKIFISGVH-HSVS 75
           GF  F R    +  P  P ++  IV LTG   RIE +  LL    G ++ ISGV  H+ +
Sbjct: 18  GFAWFFR--DALRPPAMPPIADGIVALTGGQGRIEASLRLLAQGRGRQLLISGVAPHATT 75

Query: 76  KDILLQKIPIRQDLAECC-------IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
             +  +  P  Q   +         + +G  A +T GNA E + WA  N  H +++VT  
Sbjct: 76  GSVASRLQP--QGGGDGIPAALWRHVTLGRHATSTIGNADETAEWAHANAIHSLIVVTAG 133

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           YH+ R  +E++R    +   PYPI    L+   +  ++  +R++  EY K ++ S+ L+
Sbjct: 134 YHIRRATMEIRRTVPGIVLYPYPIQPPALQ---APLRVASVRLMATEYDKWIMASLGLT 189


>gi|294085432|ref|YP_003552192.1| hypothetical protein SAR116_1865 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665007|gb|ADE40108.1| protein of unknown function DUF218 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 207

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 73/149 (48%), Gaps = 5/149 (3%)

Query: 33  DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAE- 91
           DH     IVV TG   R+     LL +   +K+ ISGV   V+K +L+Q++ +       
Sbjct: 53  DH--TDGIVVTTGGQQRLVEGLNLLVSGTTDKVLISGVGKGVNKAVLVQELNLDDQQVSA 110

Query: 92  --CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             CC+++ Y AL+T GNA  A AW + N    + +VT +YHMPR  +   R    V    
Sbjct: 111 LFCCVELEYGALDTRGNALAARAWIDLNGLKSIRLVTANYHMPRAEIVFSRAIPNVDIHQ 170

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLK 178
           + +  + L+         I+R+L  EY K
Sbjct: 171 WAVSPNALDVERWWQDPMIIRLLTREYAK 199


>gi|209545186|ref|YP_002277415.1| hypothetical protein Gdia_3070 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532863|gb|ACI52800.1| protein of unknown function DUF218 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 213

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 87/179 (48%), Gaps = 16/179 (8%)

Query: 18  GFISFIRYVKQMHIPDHPSVS-AIVVLTGEPIRIERAFELLENQIGEKIFISGVH-HSVS 75
           GF  F R    +  P  P ++  IV LTG   RIE +  LL    G ++ ISGV  H+ +
Sbjct: 34  GFAWFFR--DALRPPAMPPIADGIVALTGGQGRIEASLRLLAQGRGRQLLISGVAPHATT 91

Query: 76  KDILLQKIPIRQDLAECC-------IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
             +  +  P  Q   +         + +G  A +T GNA E + WA  N  H +++VT  
Sbjct: 92  GSVASRLQP--QGGGDGIPAALWRHVTLGRHATSTIGNADETAEWAHANAIHSLIVVTAG 149

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           YH+ R  +E++R    +   PYPI    L+   +  ++  +R++  EY K ++ S+ L+
Sbjct: 150 YHIRRATMEIRRTVPGIVLYPYPIQPPALQ---APLRVASVRLMATEYDKWIMASLGLT 205


>gi|330993951|ref|ZP_08317881.1| hypothetical protein SXCC_03846 [Gluconacetobacter sp. SXCC-1]
 gi|329758897|gb|EGG75411.1| hypothetical protein SXCC_03846 [Gluconacetobacter sp. SXCC-1]
          Length = 201

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 74/153 (48%), Gaps = 4/153 (2%)

Query: 35  PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECC- 93
           P    IV LTG   RIE +  LL      ++ ISGV    ++   L+ +P    LA    
Sbjct: 27  PRADGIVALTGGQGRIEESVRLLVQGRAGRLLISGVDPHATRGDFLRHLPPPVPLAAWTH 86

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             +G +A +T GNA E +AW  +   H +++VT  YH+ R  LE+ R    V+    PI 
Sbjct: 87  TTLGSRATSTLGNADETAAWVREYGLHSLIVVTAGYHIRRAMLEISRTVPGVRLYGDPIR 146

Query: 154 SHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           S  L      F    +R++++EY K LL  + +
Sbjct: 147 SPALAHP---FHPATMRLMVVEYDKWLLACLDV 176


>gi|326386450|ref|ZP_08208073.1| hypothetical protein Y88_2345 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209111|gb|EGD59905.1| hypothetical protein Y88_2345 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 194

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 86/173 (49%), Gaps = 12/173 (6%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L + ++ +++GF+ F  ++ +    DH    A++ LTG   RI+R  E+L     +++ +
Sbjct: 14  LSLMVLAWLLGFLWFALFLPRPA--DHTRTDAVIALTGGSGRIQRGIEVLRADEAKRMLV 71

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGV   V       +  +   L  CC+ +GY++ +T  NA EA+ W  + +   V +VT 
Sbjct: 72  SGVDSEVKPAEFEAEYGVPASLFACCMTLGYESFDTRSNALEAARWIARYDLRSVRLVTT 131

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           D+HM R   +L  + +    +   I+   +  + S      +R+L +EY K L
Sbjct: 132 DWHMRRAAFDLA-VAAPKGLV---IVEDAVPSHPS------MRILFVEYNKFL 174


>gi|296116632|ref|ZP_06835242.1| hypothetical protein GXY_12533 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976844|gb|EFG83612.1| hypothetical protein GXY_12533 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 227

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 74/155 (47%), Gaps = 10/155 (6%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISGVH-HSVSKDILLQK---IPIRQDLAECCIDI 96
           V LTG   RIE + +L+      ++ ISGV  H+   D L +    +P+   L      +
Sbjct: 58  VALTGGQGRIEASLQLMAQHRARRLLISGVDPHATLGDFLTRAPRVLPLEVWLRTT---L 114

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           G +A +T GNA E + W    + H +++VT  YH+ R  +E+ R    V   P+ +    
Sbjct: 115 GRQATSTLGNADETAQWVRAQDIHSLIVVTAGYHIRRAMMEIARAAPGVTLYPFAVQPPA 174

Query: 157 LEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQ 191
           L       ++   R+L++EY K LL  I  +  T+
Sbjct: 175 LLHPR---RLATWRLLVVEYDKWLLACIDTARWTR 206


>gi|42523257|ref|NP_968637.1| hypothetical protein Bd1767 [Bdellovibrio bacteriovorus HD100]
 gi|39575462|emb|CAE79630.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 184

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 53/101 (52%)

Query: 35  PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCI 94
           PS    VVLTG   R+   F+LL NQ  +K+ ISGV+ +     ++   P   +L+E  +
Sbjct: 39  PSADCAVVLTGGAGRVREGFDLLVNQNVKKLVISGVYSNARLREIMPVWPFYGNLSENDV 98

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
            +  ++  T GNAQ++    E      +L+VT   HM R++
Sbjct: 99  VLDRRSETTYGNAQQSLPIVEALKCRDILLVTSRLHMYRSY 139


>gi|322420740|ref|YP_004199963.1| hypothetical protein GM18_3250 [Geobacter sp. M18]
 gi|320127127|gb|ADW14687.1| protein of unknown function DUF218 [Geobacter sp. M18]
          Length = 195

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 62/140 (44%), Gaps = 11/140 (7%)

Query: 32  PDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAE 91
           P      AIVVLTG   R+E    L     G+K+F+ GV  SV K  L       Q   E
Sbjct: 34  PRDTQADAIVVLTGGRGRVEEGVRLYRAGQGKKLFLIGVDPSVKKRELF------QGDGE 87

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR-TFLELQRINSTVQFIPY 150
             + +   + NT  NA  A     K+    + ++T  YHM R T L    +   V   P+
Sbjct: 88  GGVYLEQNSRNTLENAIYARDLIMKHKVRSIKLITSRYHMKRSTILFRNALPRYVAIYPH 147

Query: 151 PIISHDLEE----NSSIFKI 166
           P+ S +L+E    +S  FK+
Sbjct: 148 PVDSSNLKEQWWRHSGSFKL 167


>gi|301165835|emb|CBW25408.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 212

 Score = 51.2 bits (121), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 34  HPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECC 93
           + S   IVV TG+  RI  A +L +      IFI+GV+   S D LL+ + I +++    
Sbjct: 57  NRSPDLIVVFTGDSGRIPLAVQLAKKYKQSNIFITGVYSKNSVDSLLRPLKIDEEIDTNL 116

Query: 94  IDIGYKALNTEGNA-QEASAWAEKNNFHHVLIVTHDYHMPR 133
           + I Y A NT  N         E+     +++++HDYH+ R
Sbjct: 117 LTIDYLARNTVENVISTLRHLRERKGNKKIIVISHDYHVMR 157


>gi|332968000|gb|EGK07087.1| protein of hypothetical function DUF218 [Desmospora sp. 8437]
          Length = 190

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 88/192 (45%), Gaps = 28/192 (14%)

Query: 2   RYFWYGLFVCLIFFIM---GFISFIRYVKQMHIPDHPSVSAIVV----LTGEPI-----R 49
           R+ W G+ +CLIF ++    ++   RY   + + DHP  +A+V+       +P      R
Sbjct: 4   RWLWSGVILCLIFALLIIPFWVQASRY-DDVRVADHPRDAALVLGAALWDSQPSPALRER 62

Query: 50  IERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++ A  L      + I  SG      +S+   +++  + Q +    + +  ++ NT+ N 
Sbjct: 63  LQMALSLYHKGQVQWIICSGGVGDDGISEAEGMKRYLMEQGVPPKDLLLEEESTNTKENL 122

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF---------LELQRINSTVQFIPYPIISHDLE 158
           Q +    + N+  ++ +VTHDYHM R+           E   ++S+V F PY    +   
Sbjct: 123 QYSKKLLKPNDIQNIYLVTHDYHMYRSLALARQAGIRAEPAPVHSSVLFTPY----YKAR 178

Query: 159 ENSSIFKIKILR 170
           E  SI K ++ +
Sbjct: 179 ECLSIIKYRLTK 190


>gi|331004989|ref|ZP_08328398.1| hypothetical protein IMCC1989_103 [gamma proteobacterium IMCC1989]
 gi|330421202|gb|EGG95459.1| hypothetical protein IMCC1989_103 [gamma proteobacterium IMCC1989]
          Length = 144

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 91  ECCIDIGY---KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
           E  +DI +   ++ NT  NA       +K + HHV +VTH YHMPR+    Q+   TV  
Sbjct: 41  ELNVDIAWPEGESRNTWENAHFTKKMLDKQSIHHVALVTHAYHMPRSVYAFQQAGLTVSP 100

Query: 148 IPYPIISHD------LEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           +P   +S        L    S   + I R+ L EYL +L  S++
Sbjct: 101 MPTGQLSQQSSTSYWLNWLPSAGALHISRLALHEYLGLLFYSLK 144


>gi|78223525|ref|YP_385272.1| hypothetical protein Gmet_2322 [Geobacter metallireducens GS-15]
 gi|78194780|gb|ABB32547.1| protein of unknown function DUF218 [Geobacter metallireducens
           GS-15]
          Length = 200

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 78/167 (46%), Gaps = 14/167 (8%)

Query: 1   MRYFWYGLFVCL-IFFIMGFISFIRY------VKQMHIPDHPSVSAIVVLTGEPIRIERA 53
           M  F+ GLF  L IF ++  + F+ +      V+Q  I    +  AIVVL G   R+E  
Sbjct: 1   MALFFRGLFSLLVIFLVVATVLFVDFAYKTFSVRQRDI----ATDAIVVLAGGRGRVEEG 56

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             L   + G+ +F+ GV   V K  L Q+    + LA+  + +   + NT  NA      
Sbjct: 57  IRLFRAKKGKYLFLIGVDPMVRKQELFQERK-GESLADRVV-LENASRNTLENALYGREI 114

Query: 114 AEKNNFHHVLIVTHDYHMPR-TFLELQRINSTVQFIPYPIISHDLEE 159
            ++ +   + ++T  YHM R T +    +   +   P+P+ + +L+E
Sbjct: 115 IDRKDIRSISLITSRYHMKRATLIFRSTLPRDIAIYPHPVDTINLKE 161


>gi|189425340|ref|YP_001952517.1| hypothetical protein Glov_2281 [Geobacter lovleyi SZ]
 gi|189421599|gb|ACD95997.1| protein of unknown function DUF218 [Geobacter lovleyi SZ]
          Length = 198

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 3/129 (2%)

Query: 32  PDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAE 91
           P      AIVVL G   R+E    L   + G  +F+ GV  +V K  L +  P   D   
Sbjct: 34  PRQVQADAIVVLAGGKGRVEEGVRLFRERRGTWLFLVGVDPTVRKSDLYRPKP--GDPPA 91

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR-INSTVQFIPY 150
             + +   + NT  NA        ++    VL++T  YH+ R+ +  +  +   V   PY
Sbjct: 92  DNVVLEKLSRNTLENAIYGRDILAEHKVRSVLLITSRYHLKRSAILFRNALAPDVALYPY 151

Query: 151 PIISHDLEE 159
           P+ S +++E
Sbjct: 152 PVDSSNVKE 160


>gi|157965010|ref|YP_001499834.1| hypothetical protein RMA_1350 [Rickettsia massiliae MTU5]
 gi|157844786|gb|ABV85287.1| hypothetical protein RMA_1350 [Rickettsia massiliae MTU5]
          Length = 171

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 73/150 (48%), Gaps = 7/150 (4%)

Query: 9   FVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           F+  IF + +G   +  Y+   +  +  + +AI+V  G   +IE    LL+      +FI
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGSALLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +     LL++   R  + +  I    K ++ E N ++A  +    N   +++V H
Sbjct: 65  TGIESTEQLKNLLKE---RNVIEQQVILAPSKIMSEEDNIKKAVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRI---NSTVQFIPYPIIS 154
           +Y+MP    +L+++   +  +  +PYP+ S
Sbjct: 122 NYNMPFMLNKLEKVIHSSHNIYIVPYPVFS 151


>gi|119485358|ref|ZP_01619686.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
 gi|119457114|gb|EAW38240.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
          Length = 263

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 7   GLFVCLIFFIMGFI-SFIRYVKQMHIPDH--PSVSAIVVLTGEPIRIERAFELLE-NQIG 62
           GL V L     G   S +R ++  +IP+   P  +AIVVL G           ++  + G
Sbjct: 44  GLLVLLTSSNSGVSQSLVRSLEWQNIPNGELPKATAIVVLGGGTKAPTPPRPWVDVGEAG 103

Query: 63  EKIFISGVHHSVSKDILL-----------QKIPIRQDLAECCIDIGYK---------ALN 102
           ++I    + +   K   L           ++ P   D+ E  +++G +         +LN
Sbjct: 104 DRILYGALLYKQDKAPWLILSGGRIQWDGKEPPESADMKEIAVEMGVRESAILQDPDSLN 163

Query: 103 TEGNAQEASA-WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDL 157
           T  NA       AE N    VL+VT   HMPR+ L  QR    ++ IP P    +   DL
Sbjct: 164 TYQNAVNVRQILAENNLTGKVLLVTSALHMPRSLLVFQR--QGIEVIPAPTDFLVSQQDL 221

Query: 158 EENSSI 163
           + +++I
Sbjct: 222 QPSTTI 227


>gi|197119576|ref|YP_002140003.1| hypothetical protein Gbem_3208 [Geobacter bemidjiensis Bem]
 gi|197088936|gb|ACH40207.1| YdcF-like protein of unknown function DUF218 [Geobacter
           bemidjiensis Bem]
          Length = 196

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 19/151 (12%)

Query: 37  VSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDI 96
             AIVVLTG   R+E   +L     G+ +F+ GV      D L++K  + Q      + +
Sbjct: 39  ADAIVVLTGGRGRVEEGVKLYRAGQGKLLFLIGV------DPLVKKHELYQGAGAENVYL 92

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR-TFLELQRINSTVQFIPYPIISH 155
              + NT  NA  A     K+    + ++T  YHM R T L        V   P+P+ S 
Sbjct: 93  EKTSRNTLENAIYARDMIMKHKVSSIKLITSRYHMKRSTILFRNAFPKDVAIYPHPVDSS 152

Query: 156 DLEEN------------SSIFKIKILRVLLI 174
           +L+E             S  +K  ILRV  +
Sbjct: 153 NLKEEWWNHKGSFKLLFSEFYKYCILRVFFL 183


>gi|253699685|ref|YP_003020874.1| hypothetical protein GM21_1055 [Geobacter sp. M21]
 gi|251774535|gb|ACT17116.1| protein of unknown function DUF218 [Geobacter sp. M21]
          Length = 195

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 57/123 (46%), Gaps = 7/123 (5%)

Query: 38  SAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIG 97
            AIVVLTG   R+E   +L     G+ +F+ GV      D L++K  + +      + + 
Sbjct: 40  DAIVVLTGGRGRVEEGVKLYRGGRGKLLFLIGV------DPLVKKHELYRGAGAENVYLE 93

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR-TFLELQRINSTVQFIPYPIISHD 156
             + NT  NA  A     K+    + ++T  YHM R T L    +   +   P+P+ S +
Sbjct: 94  KTSRNTLENAIYARDMITKHRVSSIKLITSRYHMKRSTILFRNALPKDIAIYPHPVDSSN 153

Query: 157 LEE 159
           L+E
Sbjct: 154 LKE 156


>gi|15893279|ref|NP_360993.1| hypothetical protein RC1356 [Rickettsia conorii str. Malish 7]
 gi|229587249|ref|YP_002845750.1| hypothetical protein RAF_ORF1242 [Rickettsia africae ESF-5]
 gi|29839740|sp|Q92FX1|Y1356_RICCN RecName: Full=Uncharacterized protein RC1356
 gi|15620500|gb|AAL03894.1| unknown [Rickettsia conorii str. Malish 7]
 gi|228022299|gb|ACP54007.1| Unknown [Rickettsia africae ESF-5]
          Length = 171

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 72/150 (48%), Gaps = 7/150 (4%)

Query: 9   FVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           F+  IF + +G   +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRI---NSTVQFIPYPIIS 154
           +Y+MP    +L++    ++ +  +PYP+ S
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPVFS 151


>gi|326803127|ref|YP_004320945.1| hypothetical protein HMPREF9243_0621 [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651604|gb|AEA01787.1| conserved hypothetical protein [Aerococcus urinae ACS-120-V-Col10a]
          Length = 190

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 62/133 (46%), Gaps = 13/133 (9%)

Query: 23  IRYV-KQMHIPDHPSVSAIVVLTGEPI--RIERAFELLENQI--GEKIFISGVHHSVSKD 77
           +RY+ K +     P VS ++++   P   R E+A +LL+      EK  +S  +  V +D
Sbjct: 19  LRYIYKHLDQGQAPQVSDLIIVAEGPAVERAEKAVQLLKAAYSRAEKNIVSPRYTDVGED 78

Query: 78  ILL---QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           +     Q    R++L E       +A +T  NA  +    +   +H  ++VT DYHM RT
Sbjct: 79  LFAGYQQLGAERENLIEEN-----QATSTWTNATTSLDLMDDLGYHSAIVVTSDYHMRRT 133

Query: 135 FLELQRINSTVQF 147
            L  QR N    F
Sbjct: 134 RLAFQRANRDYGF 146


>gi|157829194|ref|YP_001495436.1| hypothetical protein A1G_07445 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933919|ref|YP_001650708.1| hypothetical protein RrIowa_1586 [Rickettsia rickettsii str. Iowa]
 gi|157801675|gb|ABV76928.1| hypothetical protein A1G_07445 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165909006|gb|ABY73302.1| hypothetical protein RrIowa_1586 [Rickettsia rickettsii str. Iowa]
          Length = 171

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 72/150 (48%), Gaps = 7/150 (4%)

Query: 9   FVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           F+  IF + +G   +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNTTNAIIVFVGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRI---NSTVQFIPYPIIS 154
           +Y+MP    +L++    ++ +  +PYP+ S
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPVFS 151


>gi|51474043|ref|YP_067800.1| hypothetical protein RT0866 [Rickettsia typhi str. Wilmington]
 gi|51460355|gb|AAU04318.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 174

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 75/153 (49%), Gaps = 10/153 (6%)

Query: 8   LFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           L + L+ F +  G   +  Y+   +  +  + +AI+V  G   +IE    LL+      +
Sbjct: 6   LLIILVIFTLWVGGFCYYLYLINSYKLNSNTTNAIIVFAGGGHKIETCIALLKAGYAPIL 65

Query: 66  FISGVHHSVS-KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           FI+G+  +   K++L++   I Q +    I    K ++ E N ++A  +    N   +++
Sbjct: 66  FITGIESAEHFKNLLMEHNVIEQQV----ILAPNKIMSEEDNIKKAIDFIVTYNLTFIIL 121

Query: 125 VTHDYHMPRTFLELQRI---NSTVQFIPYPIIS 154
           V H+Y++P    +LQ+    ++ V  +PYP+ S
Sbjct: 122 VEHNYNIPFMLNKLQKAIPSSNNVYIVPYPVFS 154


>gi|308070011|ref|YP_003871616.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
 gi|305859290|gb|ADM71078.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
          Length = 249

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 64/134 (47%), Gaps = 18/134 (13%)

Query: 62  GEKIFI-SGVHHSVSKDILLQ-KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           G ++F  SG   ++++  LL   IP +  L E       ++LNT+ NA   S   EK+  
Sbjct: 124 GGQVFGDSGNEANIAQRQLLGLGIPAKDILIEN------RSLNTQQNAVYTSQILEKHQL 177

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDL-----EENSSIFKIKILRV 171
              ++VT  +HMPR  LE QR  + VQ I YP   + S  L     + + S   +     
Sbjct: 178 TRPVLVTSAFHMPRAALEFQR--AGVQAIAYPTDYLASEKLSLYAGKLSPSAGAMSTTGT 235

Query: 172 LLIEYLKILLLSIQ 185
            L EYL IL L ++
Sbjct: 236 ALKEYLGILALKLK 249


>gi|238651121|ref|YP_002916979.1| hypothetical protein RPR_07675 [Rickettsia peacockii str. Rustic]
 gi|238625219|gb|ACR47925.1| hypothetical protein RPR_07675 [Rickettsia peacockii str. Rustic]
          Length = 171

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 72/150 (48%), Gaps = 7/150 (4%)

Query: 9   FVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           F+  IF + +G   +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIISEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRI---NSTVQFIPYPIIS 154
           +Y+MP    +L++    ++ +  +PYP+ S
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPVFS 151


>gi|293607329|ref|ZP_06689669.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814279|gb|EFF73420.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 184

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 19/113 (16%)

Query: 41  VVLTGEP-----IRIERAFELLENQIGEKIFISGV-------HHSVSKDILLQK-IPIRQ 87
           V+ TG+P      R++RA++         +F+SG          +V +D L+ + +P  +
Sbjct: 41  VLPTGQPSPRLAARLDRAYDCYAAMQCRLVFVSGGVDPAGADEAAVMRDYLIARGVPAER 100

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
            + +   D      N+   A+ ASA+  ++ +   L+VT  +H+PRT L L+R
Sbjct: 101 IVTDSAGD------NSWATARHASAYMREHGYTRALVVTQYFHVPRTVLALRR 147


>gi|34581055|ref|ZP_00142535.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262440|gb|EAA25944.1| unknown [Rickettsia sibirica 246]
          Length = 171

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 71/148 (47%), Gaps = 7/148 (4%)

Query: 9   FVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           F+  IF + +G   +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRI---NSTVQFIPYPI 152
           +Y+MP    +L++    ++ +  +PYP+
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPV 149


>gi|183220138|ref|YP_001838134.1| hypothetical protein LEPBI_I0726 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910258|ref|YP_001961813.1| hypothetical protein LBF_0703 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774934|gb|ABZ93235.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778560|gb|ABZ96858.1| Conserved hypothetical protein; putative membrane protein
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 258

 Score = 44.3 bits (103), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 65/160 (40%), Gaps = 20/160 (12%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECC-I 94
           SV A   LT    RI  A  L +    +KI  +G        +LL       DLA+   I
Sbjct: 95  SVKARPELTDSADRITDAIRLYKAGKVKKILFTG-----GSGLLLSDTYREADLAKSLFI 149

Query: 95  DIGYK---------ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV 145
           D+G K         + NT  NA E      + NF   L++T  +HM R+    Q+ N  V
Sbjct: 150 DLGVKEEDIILENNSRNTHENAVETKKILMEKNFQSFLLITSAFHMKRSLGCFQKQNLNV 209

Query: 146 QFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
              P+P        +S  F++ +       YL +  LSI+
Sbjct: 210 --FPFPTDYRSFNTDSGAFELYLPSA---GYLDLTTLSIK 244


>gi|332711315|ref|ZP_08431247.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
 gi|332349864|gb|EGJ29472.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
          Length = 281

 Score = 44.3 bits (103), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 15/102 (14%)

Query: 84  PIRQDLAECCIDIGY---------KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           P  +D+A+   D+G          ++LNT  NA       ++ +F  VL+VT   HMPR+
Sbjct: 154 PESEDMAQILEDLGVPRAAIIQESRSLNTHQNAVNVRKILDQRDFPKVLLVTSAIHMPRS 213

Query: 135 FLELQRINSTVQFIPYP----IISHDLEENSSIFKIKILRVL 172
            L  +R    +  IP P    +  H+L+E SS  +  +L  L
Sbjct: 214 VLVFRR--QGIDVIPAPTDFLVSQHELDEPSSSSQAALLHSL 253


>gi|225849301|ref|YP_002729465.1| hypothetical protein SULAZ_1499 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644421|gb|ACN99471.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 242

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
           +T GNA       EKN F  +++VT  YHMPR+ +  Q+  + +  IPYP
Sbjct: 151 DTLGNAFFVKKICEKNGFKRIILVTSAYHMPRSVIVFQK--AGLDVIPYP 198


>gi|148265185|ref|YP_001231891.1| hypothetical protein Gura_3157 [Geobacter uraniireducens Rf4]
 gi|146398685|gb|ABQ27318.1| protein of unknown function DUF218 [Geobacter uraniireducens Rf4]
          Length = 199

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 71/161 (44%), Gaps = 8/161 (4%)

Query: 4   FWYGLF----VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           F+ G+F    + L+   + F+ F      +   D  S  AIVVL G   RIE    L   
Sbjct: 3   FFRGIFSLLVISLVVIAVLFVDFTYKTFSLRQRDVKS-DAIVVLAGGRGRIEEGVRLYRE 61

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
                +F+ GV  +V K  L  +   R + +   + +   + NT  NA  A     ++N 
Sbjct: 62  NRARWLFLIGVDPAVRKGELFTE--RRGERSGEGVFLENVSRNTLENALYAREMIVRHNV 119

Query: 120 HHVLIVTHDYHMPR-TFLELQRINSTVQFIPYPIISHDLEE 159
             + ++T  YHM R T +  Q +   +   P+P+ S +L+E
Sbjct: 120 SSIKLITSRYHMKRATLIFRQVLPKDIAIYPHPVDSKNLKE 160


>gi|207723593|ref|YP_002253992.1| hypothetical protein RSMK00882 [Ralstonia solanacearum MolK2]
 gi|206588795|emb|CAQ35758.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 190

 Score = 43.9 bits (102), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 25  YVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHHS--VSKDILLQ 81
           ++++  +P H  V  IVVL GE   R+  A EL    +  ++F+SG      + + +++ 
Sbjct: 36  WLREESMPGHADV--IVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCLLIVRRLVMA 93

Query: 82  KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
            +P  +   EC      ++ NT  NA+      +  +    ++VT  YH  R     +R+
Sbjct: 94  GVPAERIGHEC------ESGNTMENARMTRRMLDGQSVRSAVLVTSWYHTGRALRAFRRV 147

Query: 142 NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
              V +    +   D    S  F I     +L EYLK    +++
Sbjct: 148 WPEVAWGARGVFPGDTLAKS--FPIYESGSILAEYLKRAWYAVR 189


>gi|207742563|ref|YP_002258955.1| hypothetical protein RSIPO_00752 [Ralstonia solanacearum IPO1609]
 gi|206593956|emb|CAQ60883.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 190

 Score = 43.5 bits (101), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 13/157 (8%)

Query: 25  YVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHHS--VSKDILLQ 81
           ++++  +P H  V  IVVL GE   R+  A EL    +  ++F+SG      + + +++ 
Sbjct: 36  WLREESMPGHADV--IVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCLLIVRRLVMA 93

Query: 82  KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
            +P  +   EC      ++ NT  NA+      +  +    ++VT  YH  R     +R+
Sbjct: 94  GVPAERIGHEC------ESGNTMENARMTRRMLDGQSVRSAVLVTSWYHTGRALRAFRRV 147

Query: 142 NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
              V +    +   D    S  F I     +L EYLK
Sbjct: 148 WPEVAWGARGVFPGDTLAKS--FPIYESGSILAEYLK 182


>gi|91204866|ref|YP_537221.1| hypothetical protein RBE_0051 [Rickettsia bellii RML369-C]
 gi|157826504|ref|YP_001495568.1| hypothetical protein A1I_00645 [Rickettsia bellii OSU 85-389]
 gi|91068410|gb|ABE04132.1| unknown [Rickettsia bellii RML369-C]
 gi|157801808|gb|ABV78531.1| hypothetical protein A1I_00645 [Rickettsia bellii OSU 85-389]
          Length = 174

 Score = 42.7 bits (99), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 10/154 (6%)

Query: 7   GLFVCLIFFI--MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
            L +  IF I   GF+ ++ Y+   + P   + +AI+V  G   +IE    LL+      
Sbjct: 6   ALTILTIFAIWASGFVYYL-YLVNSYKPSSNTANAIIVFAGGGHKIETGIALLKAGYAPI 64

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           +FI+G+  S     LL++      L +  I    + ++ E   ++AS +  K N   V +
Sbjct: 65  LFITGIETSDQLKNLLKE---NNVLEQQVILAPNQIMSEEDYIKKASDFILKYNITSVRL 121

Query: 125 VTHDYHMPRTFLELQRI----NSTVQFIPYPIIS 154
           V ++Y +P     L       N+ +   PYP+I+
Sbjct: 122 VAYNYDIPSIVNNLTTAISSSNNNIYIAPYPVIA 155


>gi|282857535|ref|ZP_06266763.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
 gi|282584622|gb|EFB89962.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
          Length = 259

 Score = 42.7 bits (99), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 11/111 (9%)

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           R+ +A E+L      K+ +SG+   +    L   +P  + L E       ++LNTEGN +
Sbjct: 109 RLRKAREILSCCGDGKLLLSGIESPLMARWLRASLPREKVLLE------TRSLNTEGNLR 162

Query: 109 EASA-----WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
           E++      ++++ +   V +VT  +HM R +   ++     + +P P  S
Sbjct: 163 ESAVLLRRLYSDERSRPQVFLVTDRFHMARAWRWAKKFMPDFEVVPSPAPS 213


>gi|169830663|ref|YP_001716645.1| hypothetical protein Daud_0467 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637507|gb|ACA59013.1| protein of unknown function DUF218 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 264

 Score = 42.4 bits (98), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 78/159 (49%), Gaps = 8/159 (5%)

Query: 31  IPDHPSVSAI-VVLTGE-PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIR 86
           + D P+ + + VVL+G+   R+E AF L +  + +++ +SG  ++  +++  LL++  + 
Sbjct: 59  VADKPAPAEVLVVLSGDRGERLEYAFRLYQEGLADRLLLSGGPLYADLTEADLLRRHALM 118

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT---FLELQRINS 143
             + E  I +  +A NT  NA  +    E       ++++  YHM R    F E+ R  S
Sbjct: 119 LGVPEYKIIMEPRATNTYQNALYSREMMEYYGLDSAIVISSPYHMRRVRALFDEVYR-GS 177

Query: 144 TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
            ++ +  P+     +           RV+L EYL++ +L
Sbjct: 178 DIRLVYLPVEDSWFDPERWWESAAGRRVVLAEYLRLTML 216


>gi|111022413|ref|YP_705385.1| hypothetical protein RHA1_ro05447 [Rhodococcus jostii RHA1]
 gi|110821943|gb|ABG97227.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 187

 Score = 42.4 bits (98), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 5/114 (4%)

Query: 30  HIPDHP--SVSAIVVLTGE-PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIR 86
           + P+ P   V AIVVL GE   R+  A  L E  +  ++ IS  H +  +D    +    
Sbjct: 33  NAPEDPLRPVDAIVVLGGENDGRVPYAVSLAEQGLARQVVISNPHDA--RDPSTNEGCAT 90

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
            D       +      T G AQ     A +N +  VL+V+  YH+PR     QR
Sbjct: 91  TDPRFTVTCVAPHPATTRGEAQFTRTLAVQNGWTSVLVVSWRYHLPRARYIFQR 144


>gi|121604040|ref|YP_981369.1| hypothetical protein Pnap_1132 [Polaromonas naphthalenivorans CJ2]
 gi|120593009|gb|ABM36448.1| protein of unknown function DUF218 [Polaromonas naphthalenivorans
           CJ2]
          Length = 259

 Score = 42.4 bits (98), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY----PIISHDL 157
           +T GNA+  +   +++    + +VTH +HMPR     +R   +V   P     PI +H L
Sbjct: 170 DTSGNARLLAPLLQRDGVQRIALVTHSWHMPRALAAFERAGLSVTPAPMGFTEPIENHLL 229

Query: 158 EENSSIFKIKILRVLLIEYLKI 179
           +   S   ++  R++L E L +
Sbjct: 230 QWLPSAQGLQASRLVLRECLGL 251


>gi|220908126|ref|YP_002483437.1| hypothetical protein Cyan7425_2730 [Cyanothece sp. PCC 7425]
 gi|219864737|gb|ACL45076.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 279

 Score = 42.4 bits (98), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 13/119 (10%)

Query: 37  VSAIVVLTGEPIRIERAF---ELLENQIGEKIFISGVHHS--VSKDILLQKIPIRQDLAE 91
           V AIVVL   PI  +RA    EL +     K+F+SG   +  + K++    +      +E
Sbjct: 110 VDAIVVLGRGPISGDRAAVAAELWQAGRAPKVFVSGRGDAPYLVKELRKYGVSASALASE 169

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
            C      +  TE NAQ  +   +     H+L++T   HM R+++  +R+    Q IP+
Sbjct: 170 DC------SQTTEENAQFTARLLQPQGVQHILLITDSPHMLRSWMTFERVG--FQVIPH 220


>gi|67459774|ref|YP_247398.1| hypothetical protein RF_1382 [Rickettsia felis URRWXCal2]
 gi|67005307|gb|AAY62233.1| Uncharacterized conserved protein [Rickettsia felis URRWXCal2]
          Length = 174

 Score = 42.4 bits (98), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 68/141 (48%), Gaps = 6/141 (4%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSK 76
           +G + +  Y+   +  +  + +A++V  G   +IE    LL+      +FI+G+  +   
Sbjct: 17  VGGLGYYLYLINSYKLNSNTTNAVIVFAGGGHKIETGIALLKAGYAPILFITGIESTEQL 76

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             LL++   R  + +  I    K ++ E N ++A  +    N   +++V H+Y+MP    
Sbjct: 77  KNLLKE---RNVIEQQVILAPNKIMSEEDNIKKAVDFIVTYNLTSIILVEHNYNMPFMLN 133

Query: 137 ELQRI---NSTVQFIPYPIIS 154
           +L++    ++ +  +PY + S
Sbjct: 134 KLEKAIPSSNNIYIVPYLVFS 154


>gi|300865598|ref|ZP_07110374.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300336399|emb|CBN55524.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 236

 Score = 42.0 bits (97), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 78/190 (41%), Gaps = 34/190 (17%)

Query: 18  GFIS--FIRYVKQMHIPDHP--SVSAIVVLTG--EPIRIERAFELLENQIGEKIFISGVH 71
           G+I+   +R ++  ++P  P     AIVVL G  +P    R +  +  + G++I      
Sbjct: 26  GWIAQNLVRSLETQNLPPTPIPQTRAIVVLGGGIKPALPPRPWVEV-GEAGDRILYGSQL 84

Query: 72  HSVSKDILL-----------QKIPIRQDLAECCIDIGYK---------ALNTEGNAQEAS 111
           +   K   L              P   D+AE    +G           +LNT  NA    
Sbjct: 85  YRQGKAPWLILSGGRVEWKGGGPPESADMAEIAQAMGVPTSAILQDPTSLNTYQNAVNVR 144

Query: 112 AWAEKNN-FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENSSIFKI 166
              + NN    +L+VT   HMPR+ L  QR    ++ IP P    I   D+E + S F+ 
Sbjct: 145 KILKDNNILGPILLVTSALHMPRSLLIFQR--QGIETIPAPTDFSITQQDMEASQSSFQA 202

Query: 167 KILRVLLIEY 176
            +L +L   Y
Sbjct: 203 VLLNLLPDAY 212


>gi|220908702|ref|YP_002484013.1| hypothetical protein Cyan7425_3327 [Cyanothece sp. PCC 7425]
 gi|219865313|gb|ACL45652.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 202

 Score = 42.0 bits (97), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 53/127 (41%), Gaps = 6/127 (4%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           LF+  I F +GF+     +       +P   AI++L G   RI  A E         I+ 
Sbjct: 6   LFLGFILFWIGFVPLRLAIAHQQ---YPQPQAILLLEGHRQRIPFAAEFWNQHPTLPIWF 62

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G      ++   Q+I  +  +    I    ++ +T  N         + + HHV ++T 
Sbjct: 63  TGSRTDRPRN---QRIFQQAGVPAEMIHYDRRSTDTVTNFTAIVRDLVRQDIHHVFLITS 119

Query: 128 DYHMPRT 134
           DYHMPR 
Sbjct: 120 DYHMPRA 126


>gi|78188131|ref|YP_378469.1| hypothetical protein Cag_0148 [Chlorobium chlorochromatii CaD3]
 gi|78170330|gb|ABB27426.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 251

 Score = 41.6 bits (96), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 71/176 (40%), Gaps = 31/176 (17%)

Query: 4   FWYGLFVCLIFFIM----GFISFIRYVKQMHIPD--HPSVSAIVVLTGEPIRIERAFELL 57
            WY   V   F I     G + F+   + + +P   H    AIVVL G   R+E A E  
Sbjct: 34  LWYAALVLWAFSIPTVADGLMHFVEGNRTVALPQTLH-QADAIVVLGGMIRRVEGAAEGE 92

Query: 58  ENQIGEKIFISGV---------------------HHSVSKDILLQKIPIRQDLAECCIDI 96
            N   ++ F +GV                       +V +  LL +  +++ + E  + +
Sbjct: 93  WNDAADR-FEAGVTLYRAGKAPLLLFTRGRMPWSPDAVPEGELLVERALQRGVPEAALGL 151

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
                NTE  A + +    +     +++VT  YHM R+ L  +    +V+  PYP+
Sbjct: 152 TAPVANTEDEAADVARLLRERGAERIILVTSAYHMRRSQLLFEHTGLSVE--PYPV 205


>gi|323524387|ref|YP_004226540.1| hypothetical protein BC1001_0013 [Burkholderia sp. CCGE1001]
 gi|323381389|gb|ADX53480.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1001]
          Length = 186

 Score = 41.6 bits (96), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 49  RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R++RA +  +N +  +IF+SG        +   ++   +++ + +  I +    L+T   
Sbjct: 55  RLDRARQCYDNGLCHQIFVSGGIDKQGTDEARAMEDYLVKRGIPKERIVMDNMGLDTWDT 114

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
            + ASA+ + ++    L+VT  +H+PR  L L+R  
Sbjct: 115 VRNASAYMQTHHLKSALVVTQYFHVPRAALALRRFG 150


>gi|15604704|ref|NP_221222.1| hypothetical protein RP875 [Rickettsia prowazekii str. Madrid E]
 gi|7388444|sp|Q9ZC92|Y875_RICPR RecName: Full=Uncharacterized protein RP875
 gi|3861399|emb|CAA15298.1| unknown [Rickettsia prowazekii]
 gi|292572540|gb|ADE30455.1| hypothetical protein rpr22_CDS854 [Rickettsia prowazekii Rp22]
          Length = 174

 Score = 41.6 bits (96), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 68/142 (47%), Gaps = 8/142 (5%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS- 75
           +G   +  Y+   +  +  + +AI+V      +IE    LL+      +FI+G+  +   
Sbjct: 17  VGGFGYYLYLINSYKLNSNTTNAIIVFADGGHKIETCMALLKAGYAPILFITGIESTERF 76

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           K++L++   I Q +    I    K ++ E N +EA  +    N   + +V H+Y++P   
Sbjct: 77  KNLLMKHNVIEQQV----ILAPNKIMSEEDNIKEAINFIVTYNLTLITLVEHNYNIPFML 132

Query: 136 LELQRI---NSTVQFIPYPIIS 154
            +LQ+    ++ V  +PYP+ S
Sbjct: 133 NKLQKAIPSSNNVYIVPYPVFS 154


>gi|296139977|ref|YP_003647220.1| hypothetical protein Tpau_2273 [Tsukamurella paurometabola DSM
           20162]
 gi|296028111|gb|ADG78881.1| protein of unknown function DUF218 [Tsukamurella paurometabola DSM
           20162]
          Length = 188

 Score = 40.8 bits (94), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 25  YVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFIS---GVHHSVSKDILL 80
           Y++   I +     AIVVL G P  R E    L E  +  ++ +S   G   S  + +  
Sbjct: 34  YIRPRTIDELRPADAIVVLGGNPYDRFEYGITLAERGLAPQVVLSNSVGAQDSRMQQLCD 93

Query: 81  QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           +++P  Q    C + + +    T G AQE    A++  +  +++VT   H+ R    L+R
Sbjct: 94  ERVPDVQ--VTCFLPVPW---TTRGEAQELRRLAQERRWDEIIVVTTTAHVERARFILER 148

Query: 141 IN-STVQFIPYP 151
            + + +Q   +P
Sbjct: 149 CSRAQLQMTDFP 160


>gi|239946686|ref|ZP_04698439.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920962|gb|EER20986.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 171

 Score = 40.4 bits (93), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 73/156 (46%), Gaps = 9/156 (5%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      +I+GF  +  Y+   +  +  + +AI+V  G   +IE    +L+  
Sbjct: 2   IRKFLLTILAIFALWIVGF-GYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAMLKAG 60

Query: 61  IGEKIFISGVHHSVS-KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
               +FI+G+  +   K++L +   I Q      I    K ++ E N ++A  +    N 
Sbjct: 61  YAPILFITGIESAGQLKNLLKEHSVIEQQ----VILAPNKIMSEEDNIKKAVDFIVTYNL 116

Query: 120 HHVLIVTHDYHMPRTFLELQRI---NSTVQFIPYPI 152
             +++V H+Y+MP    +L++    ++ +  + YP+
Sbjct: 117 TSIILVEHNYNMPFMLNKLKKAIPSSNNIYIVSYPV 152


>gi|315445625|ref|YP_004078504.1| hypothetical protein Mspyr1_40830 [Mycobacterium sp. Spyr1]
 gi|315263928|gb|ADU00670.1| uncharacterized conserved protein [Mycobacterium sp. Spyr1]
          Length = 188

 Score = 40.4 bits (93), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 55/127 (43%), Gaps = 11/127 (8%)

Query: 12  LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEKIFISGV 70
           +I F+ G    + + +    P    V AIVVL GE   R      L E    + + +S  
Sbjct: 17  VILFLNGASGTLLFARAQADP-LAKVDAIVVLGGEHDGREAYGVGLAEQGYADTVLLSNP 75

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKAL---NTEGNAQEASAWAEKNNFHHVLIVTH 127
           +H     ++ +    R D+   C     KA     T G A  A A AE  +++ +++V+ 
Sbjct: 76  YHGTDA-VMAEACQPRSDIEVIC-----KAPVPGTTRGEALMARALAEARDWNSIIVVSW 129

Query: 128 DYHMPRT 134
            YH+PR 
Sbjct: 130 RYHLPRA 136


>gi|288817420|ref|YP_003431767.1| hypothetical protein HTH_0099 [Hydrogenobacter thermophilus TK-6]
 gi|288786819|dbj|BAI68566.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
 gi|308751027|gb|ADO44510.1| protein of unknown function DUF218 [Hydrogenobacter thermophilus
           TK-6]
          Length = 240

 Score = 40.4 bits (93), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 13/144 (9%)

Query: 28  QMHIPDHPSVSAIVVLTGEP----IRIERAFE------LLENQIGEKIFISGVHHSVSKD 77
           +  +P+     AIVVL G      I  E + +      +L  + G  I +SG   ++   
Sbjct: 65  KYSVPEKFQADAIVVLGGGSYSTGILKEDSMKRLLTALILHKRTGLPIVLSGGAENLPDA 124

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            +++ + +   + +  I    ++ +TE NA       ++ N+  V++VT  YH+PR    
Sbjct: 125 EIMKSLLVELGVDKRDIITEVRSRDTEENASYVREICQQRNYKSVVLVTSAYHLPRAVFL 184

Query: 138 LQRINSTVQFIPYPI-ISHDLEEN 160
            ++   +V  IPYP     DL  N
Sbjct: 185 FKKEGLSV--IPYPTDFKRDLRYN 206


>gi|227827121|ref|YP_002828900.1| hypothetical protein M1425_0793 [Sulfolobus islandicus M.14.25]
 gi|229584289|ref|YP_002842790.1| hypothetical protein M1627_0798 [Sulfolobus islandicus M.16.27]
 gi|227458916|gb|ACP37602.1| protein of unknown function DUF218 [Sulfolobus islandicus M.14.25]
 gi|228019338|gb|ACP54745.1| protein of unknown function DUF218 [Sulfolobus islandicus M.16.27]
          Length = 180

 Score = 40.4 bits (93), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 38  SAIVVLTGEPI---RIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIR-QDLAECC 93
            AIVVL G  +   RI+ A  L +  I + + I G    VS+  + +K+  + Q++    
Sbjct: 3   DAIVVLGGGKLSEGRIDEAIRLYKQGIAKYLIIVGGKEEVSE--MYKKVRSKIQNIENVY 60

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           +D    +L+T  NA  A    EK N   +LIVT ++H+ R  
Sbjct: 61  VD--NNSLSTADNAYYAKKIIEKLNIKSILIVTSNFHIKRAL 100


>gi|39997331|ref|NP_953282.1| hypothetical protein GSU2233 [Geobacter sulfurreducens PCA]
 gi|39984222|gb|AAR35609.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506268|gb|ADI84991.1| YdcF-like protein of unknown function DUF218 [Geobacter
           sulfurreducens KN400]
          Length = 199

 Score = 40.0 bits (92), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 63/157 (40%), Gaps = 10/157 (6%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L V LI   + F+ F      +   D  +  AIVVL G   R+E    L   + G  +++
Sbjct: 12  LIVVLIIVAVLFVDFAYKTFSLRQRD-VTTDAIVVLAGGRGRVEEGVRLFRERKGTYLYL 70

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCID---IGYKALNTEGNAQEASAWAEKNNFHHVLI 124
            GV   V K  L      R    E   D   +   + NT  NA        +     + +
Sbjct: 71  IGVDPVVKKRDLF-----RDREGERLADRVFLENLSRNTLENALYGREIIMRKEVRSIRL 125

Query: 125 VTHDYHMPR-TFLELQRINSTVQFIPYPIISHDLEEN 160
           +T  YHM R T L  Q +   +   P+P+ + +L+E 
Sbjct: 126 ITSRYHMKRATLLFRQVLPRDIAIYPHPVDTTNLKER 162


>gi|254523274|ref|ZP_05135329.1| periplasmic protein [Stenotrophomonas sp. SKA14]
 gi|219720865|gb|EED39390.1| periplasmic protein [Stenotrophomonas sp. SKA14]
          Length = 210

 Score = 40.0 bits (92), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 62/144 (43%), Gaps = 16/144 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-------EPI---RIERAFE 55
           + LFV L+ +++G  ++I +V +          AI+VL          P+   RI    +
Sbjct: 17  WRLFVVLVIWLLGVTAWIVWVGERD--QAAKADAIIVLGAAAYDAKPSPVFEERIRHGLD 74

Query: 56  LLENQIGEKIFISGVHHSV----SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           L E Q    +  +G +       S+  + ++  ++  + +  I I   + NT  N  EA 
Sbjct: 75  LYEAQYAPLLIFTGGYGGSGARFSESQVARRYALKHGVPDDAILIETASRNTVQNLIEAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTF 135
              ++ N H V+IV+   HM R  
Sbjct: 135 RLMDQRNLHRVIIVSDPLHMARAL 158


>gi|320530702|ref|ZP_08031746.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
 gi|320136989|gb|EFW28927.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
          Length = 258

 Score = 40.0 bits (92), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 62/147 (42%), Gaps = 34/147 (23%)

Query: 31  IPDHPSVSAIVVLTGEPI------------------------RIERAFELLENQIGEKIF 66
           +P+HP    I++L G  I                        R+ R + L     G ++F
Sbjct: 77  VPEHPQGDVIIMLGGGAIGGVQDVDGEGMLAPSPASRLLTAVRLHRLYGLPILLSGGQVF 136

Query: 67  I-SGVHHSVSKDILLQ-KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
             +G    +++ +L+   +P  Q   E       ++L T  NA+ ++    +  F H ++
Sbjct: 137 KDTGTEAEIARRVLISLGVPEEQIYTES------ESLTTRQNARYSAEILHREGFTHPIL 190

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYP 151
           VT  +H+PR  L  +++   ++  PYP
Sbjct: 191 VTSAFHLPRAVLNFEKLG--IEVTPYP 215


>gi|222055241|ref|YP_002537603.1| protein of unknown function DUF218 [Geobacter sp. FRC-32]
 gi|221564530|gb|ACM20502.1| protein of unknown function DUF218 [Geobacter sp. FRC-32]
          Length = 198

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 66/154 (42%), Gaps = 12/154 (7%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID 95
           +  AIVVL G   RIE    L        +F+ GV  SV K  L ++   + + +   + 
Sbjct: 38  NCDAIVVLAGGRGRIEEGSRLYRENHARWLFLIGVDPSVRKSDLFRE--RKGERSGEGVY 95

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQFIPYPIIS 154
           +   + NT  NA  A       N   + ++T  YHM R  L  + +    +   P+P+ +
Sbjct: 96  LEKVSRNTLENALYAREMIVGRNIDSIELITSRYHMKRATLIFRHVLPKDIAIYPHPVDT 155

Query: 155 HDLEE----NSSIFKIKILRVLLIEYLKILLLSI 184
            +L+E    +S  F     R+L  E+ K  L  +
Sbjct: 156 KNLKEEWWNHSGSF-----RLLFSEFYKYCLFRV 184


>gi|217077219|ref|YP_002334937.1| hypothetical protein THA_1144 [Thermosipho africanus TCF52B]
 gi|217037074|gb|ACJ75596.1| conserved hypothetical protein [Thermosipho africanus TCF52B]
          Length = 241

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 74/159 (46%), Gaps = 25/159 (15%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI---------------RIERAFELLEN 59
           F + F+S   Y+K+ +IPD  S ++++V+ G  I               R+ + FE+   
Sbjct: 54  FFVYFLSKSFYIKEKNIPD--SQNSVIVILGGGITFFDGKYEVGNHTLKRLLKGFEIYR- 110

Query: 60  QIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +    I ISG  +   +S+  +++ I +   +    I +  KA  T+ NA   S   +  
Sbjct: 111 KTNAPIIISGGVIGKGISESAIMKDILVTFGVNINDIIVEDKARTTKENAIFVSKLLKGK 170

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIP----YPI 152
           NF ++++VT   HM R+ +  ++  S    IP    YPI
Sbjct: 171 NFENIILVTSFLHMKRSIMLFEKY-SKKNIIPIVCDYPI 208


>gi|313896016|ref|ZP_07829570.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975441|gb|EFR40902.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 258

 Score = 39.7 bits (91), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 62/147 (42%), Gaps = 34/147 (23%)

Query: 31  IPDHPSVSAIVVLTGEPI------------------------RIERAFELLENQIGEKIF 66
           +P+HP    I++L G  I                        R+ R + L     G ++F
Sbjct: 77  VPEHPQGDVIIMLGGGAIGGVQDVDGEGMLAPSPASRLLTAVRLHRLYGLPILLSGGQVF 136

Query: 67  I-SGVHHSVSKDILLQ-KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
             +G    +++ +L+   +P  Q   E       ++L T  NA+ ++    +  F H ++
Sbjct: 137 KDTGTEAEIARRVLISLGVPEEQIYTES------ESLTTGQNARYSAEILHREGFMHPIL 190

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYP 151
           VT  +H+PR  L  +++   ++  PYP
Sbjct: 191 VTSAFHLPRAVLNFEKLG--IEVTPYP 215


>gi|310643123|ref|YP_003947881.1| protein of hypothetical function duf218 [Paenibacillus polymyxa
           SC2]
 gi|309248073|gb|ADO57640.1| Protein of hypothetical function DUF218 [Paenibacillus polymyxa
           SC2]
          Length = 249

 Score = 39.7 bits (91), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISH 155
           ++LNT+ NA   S   +++     ++VT  +HMPR  LE QR  + +Q   YP   + S 
Sbjct: 157 RSLNTQQNAVYTSKILKQHQLTKPILVTSAFHMPRAALEFQR--AGMQTTAYPTDYLASE 214

Query: 156 DL-----EENSSIFKIKILRVLLIEYLKILLLSIQ 185
            L     + + S   I      L EYL IL L ++
Sbjct: 215 KLSLYAAKLSPSAGAISTTGTALKEYLGILALKLK 249


>gi|85001627|ref|XP_955525.1| hypothetical protein [Theileria annulata]
 gi|65303671|emb|CAI76049.1| hypothetical protein TA17430 [Theileria annulata]
          Length = 223

 Score = 39.7 bits (91), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 23/138 (16%)

Query: 53  AFELLEN-------QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIG----YKAL 101
           +FE+LE          G K+F      + S++  ++ I + Q     C+++G    +  +
Sbjct: 84  SFEILEYLQDHDELAAGRKLFEDLASTNESRNSEIENIYVGQ-----CVNLGLPEMFPCV 138

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF-LELQRINSTVQFI---PYPIISH-D 156
           +  G  +   +     +FH V+++ +D  MP  F L  QR+    +F+    YP+ S   
Sbjct: 139 SLSGTMEVTRSRNRTEDFHKVIVLLYDVRMPSMFPLVYQRLGYKCEFMVTYTYPVDSGVG 198

Query: 157 LEENSSIFK--IKILRVL 172
           + EN  IF+  +K +RVL
Sbjct: 199 ISENKKIFEDIVKTIRVL 216


>gi|163790688|ref|ZP_02185115.1| hypothetical protein CAT7_00865 [Carnobacterium sp. AT7]
 gi|159873989|gb|EDP68066.1| hypothetical protein CAT7_00865 [Carnobacterium sp. AT7]
          Length = 196

 Score = 39.3 bits (90), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 65/144 (45%), Gaps = 14/144 (9%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL--TGEPIRIERAFELLEN--QIGE 63
           +F+CL+  +    S+   +  + I + P  S ++++    E +R  RA ELL        
Sbjct: 15  VFMCLVIGV----SYPIIINNLIIDEGPVQSDVIIVPEGQEYVRAYRAAELLHEGFSTSG 70

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           +I +S +  +  +      +   Q + E       KA +T  NA       E++ F   +
Sbjct: 71  QIIVSPIDKATVQGYKEFWVSQEQIIPET------KATSTYENAVITLRMMEEHGFDSAI 124

Query: 124 IVTHDYHMPRTFLELQRINSTVQF 147
           IV+ DYHM RT L  +RINS   F
Sbjct: 125 IVSSDYHMRRTKLIYERINSDYDF 148


>gi|91782979|ref|YP_558185.1| putative lipoprotein transmembrane [Burkholderia xenovorans LB400]
 gi|91686933|gb|ABE30133.1| Putative lipoprotein transmembrane [Burkholderia xenovorans LB400]
          Length = 225

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           H +   D  L  + +RQ +    I +   +  T  NA+  SA  E + +  +++VT  Y 
Sbjct: 106 HSATEADTYLPYL-LRQQVPRADIVLENSSRTTYENARNVSAILEGSRYDSLILVTSAYQ 164

Query: 131 MPRTFLELQRINSTVQFIPYPIISH 155
           MPR  L+  R      F P P+IS+
Sbjct: 165 MPRAMLDFHRFG----FAPQPMISN 185


>gi|81300267|ref|YP_400475.1| hypothetical protein Synpcc7942_1458 [Synechococcus elongatus PCC
           7942]
 gi|81169148|gb|ABB57488.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 188

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 8/128 (6%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECCI 94
           S  AI VL G+P R + A EL +      I++S G +   ++ +  Q       +    +
Sbjct: 28  SPQAIFVLGGDPQREQFAAELAQTHPDLPIWVSSGSNPEYAEWVFSQA-----GVPRSRL 82

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL--ELQRINSTVQFIPYPI 152
            + Y+A +T  N    +   ++    HV +VT DYHM R  +   +   +  + F P P+
Sbjct: 83  HLDYQATDTLSNFTSLADRFQQQGIQHVYLVTSDYHMRRALVIANIVFASRGITFEPVPV 142

Query: 153 ISHDLEEN 160
            S    E+
Sbjct: 143 PSDRASES 150


>gi|119493570|ref|ZP_01624235.1| hypothetical protein L8106_26002 [Lyngbya sp. PCC 8106]
 gi|119452624|gb|EAW33806.1| hypothetical protein L8106_26002 [Lyngbya sp. PCC 8106]
          Length = 216

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 10/133 (7%)

Query: 35  PSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECC 93
           P   AI++L G P R E   E  +     ++++S GV    + +I  Q      DL    
Sbjct: 46  PEPQAILMLGGNPNREEFTAEFAKKHDHLEVWVSSGVDRRTATEIFQQA---GVDLGRVH 102

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI---NSTVQFIPY 150
           +D  Y+A++T  N        +K +  HV ++T D+HM R  + +  I   +  + F P 
Sbjct: 103 LD--YRAVDTVTNFSTLVEDLKKRDISHVYLITSDFHMSRA-MAIASIVFGSQGIAFTPV 159

Query: 151 PIISHDLEENSSI 163
           PI +      S +
Sbjct: 160 PIPTQGYPSESEV 172


>gi|119509608|ref|ZP_01628755.1| hypothetical protein N9414_08580 [Nodularia spumigena CCY9414]
 gi|119465797|gb|EAW46687.1| hypothetical protein N9414_08580 [Nodularia spumigena CCY9414]
          Length = 198

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 58/135 (42%), Gaps = 16/135 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           + L  CL  F +     +R    +    HP   AI++L+G+  R +   E+ +      I
Sbjct: 8   FTLAGCLGMFTIATAIPLRLAIALQQKPHPQ--AILMLSGDSSRPKFTREMAQEFPDLPI 65

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIG------YKALNTEGNAQEASAWAEKNNF 119
           ++S V     + IL        DL    +  G       +A +T  N     A  ++NN 
Sbjct: 66  WVS-VGDPEIRSIL-------DDLDNQGLQGGDRIQYDNRATDTVTNFTTIVAKVQQNNI 117

Query: 120 HHVLIVTHDYHMPRT 134
            HV +VT DYHMPR+
Sbjct: 118 RHVYLVTSDYHMPRS 132


>gi|157826367|ref|YP_001494087.1| hypothetical protein A1C_06780 [Rickettsia akari str. Hartford]
 gi|157800325|gb|ABV75579.1| hypothetical protein A1C_06780 [Rickettsia akari str. Hartford]
          Length = 174

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 66/139 (47%), Gaps = 6/139 (4%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSK 76
           +G I +  Y+   +  +  + +AI+V  G   +IE    LL+      +FI G+  +   
Sbjct: 17  VGGIGYFLYLINSYKFNSNTTNAIIVFAGGGHKIETGIALLKAGYAPILFIIGIESTEQL 76

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             LL++   R  + +  I    K ++ E N ++A  +    N   V++V ++Y+MP    
Sbjct: 77  RNLLKE---RNVIEQQVILAPNKIMSEEDNIKKAVDFIVTYNLASVILVEYNYNMPFMLN 133

Query: 137 ELQR---INSTVQFIPYPI 152
           +L++    ++ +  + YP+
Sbjct: 134 KLEKEIPSSNNIYIVQYPV 152


>gi|194367604|ref|YP_002030214.1| hypothetical protein Smal_3832 [Stenotrophomonas maltophilia
           R551-3]
 gi|194350408|gb|ACF53531.1| protein of unknown function DUF218 [Stenotrophomonas maltophilia
           R551-3]
          Length = 210

 Score = 39.3 bits (90), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 62/144 (43%), Gaps = 16/144 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-------EPI---RIERAFE 55
           + LFV L+ +++G  ++I +V +          AI+VL          P+   RI    +
Sbjct: 17  WRLFVLLVIWLLGVTAWIVWVGERD--QAAKADAIIVLGAAAYDAKPSPVFEERIRHGLD 74

Query: 56  LLENQIGEKIFISGVHHSV----SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           L E +    +  +G +       S+  + ++  ++  + +  I I   + NT  N  EA 
Sbjct: 75  LYEARYAPLLIFTGGYGGTGARFSESQVARRYALKHGIPDDAILIETASRNTVQNLVEAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTF 135
              E+ + H V+IV+   HM R  
Sbjct: 135 RLMEQRDLHRVIIVSDPLHMARAL 158


>gi|160913536|ref|ZP_02076227.1| hypothetical protein EUBDOL_00012 [Eubacterium dolichum DSM 3991]
 gi|158434088|gb|EDP12377.1| hypothetical protein EUBDOL_00012 [Eubacterium dolichum DSM 3991]
          Length = 185

 Score = 38.9 bits (89), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 76/174 (43%), Gaps = 17/174 (9%)

Query: 10  VCLIFFIMGFISFIR---YVKQMH-------IPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           +CL F       + R   Y++Q H       +   PS +   +   +  R++ A  L + 
Sbjct: 6   ICLFFLFASCYPYHRFPLYIQQTHQGYDVCIVLGSPSNTDGSLSRIQKQRMDHAITLYQK 65

Query: 60  QIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
              +KI ISG  V +   +  +++   I Q++ E  I +   A NT  N + A+    K+
Sbjct: 66  GSIQKILISGAAVANCFIEAEVMKDYAIAQNVPEKDILLEKYAKNTYENLKYAADLCNKH 125

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV 171
           +F   +IVT  +H+ R     Q+  +   F  YP+     +EN   F  + LR+
Sbjct: 126 HFSKTIIVTSGFHIRRAGFFAQKFLTDFTF--YPVSE---KENQRYFITEYLRM 174


>gi|196232487|ref|ZP_03131340.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
 gi|196223559|gb|EDY18076.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
          Length = 193

 Score = 38.5 bits (88), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 2/101 (1%)

Query: 49  RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R++R  E        +I +SG        + I+++   +   L    I +  K + T  +
Sbjct: 63  RLDRTLECYRAGYFPEIIVSGGIGKEGYDEAIVMRDYLVAHGLPGEHILLDNKGVTTFAS 122

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
           A+     A++ NFH V +++  +H+PR  L L R   T  +
Sbjct: 123 ARNTRDIAQQRNFHSVFVISQYFHLPRARLALHRFGFTTVY 163


>gi|315283550|ref|ZP_07871714.1| putative cytoplasmic protein [Listeria marthii FSL S4-120]
 gi|313612811|gb|EFR86789.1| putative cytoplasmic protein [Listeria marthii FSL S4-120]
          Length = 183

 Score = 38.5 bits (88), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 65/157 (41%), Gaps = 22/157 (14%)

Query: 12  LIFFIMGFISFIRYVKQM--HIPDHPSVSAIVVL------TGEPI--------RIERAFE 55
           LI  ++GFI  +     M       P+ +A  VL       G+P         R++ A  
Sbjct: 3   LILIVIGFIYLLIVAAFMFSGARAKPNGNADTVLVLGARVNGDPAEPSSVLKERLDTAVA 62

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L      K+ +SG      S S+  ++++  + Q +A   I++  K+  TE N + +  
Sbjct: 63  YLNENPTLKVIVSGGQGEDESASEASVMEEYLVNQGIARNRINVEDKSTRTEENLKYSKG 122

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
              K N    +IVT DYHM R  +  +R       +P
Sbjct: 123 ---KFNLGKTVIVTSDYHMYRALMLAKRQGVDASGLP 156


>gi|119512087|ref|ZP_01631180.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
 gi|119463245|gb|EAW44189.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
          Length = 263

 Score = 38.1 bits (87), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 79/190 (41%), Gaps = 27/190 (14%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP--SVSAIVVLTGEPIRIERAFELLE-NQIGEK 64
           L VC   ++    S +R ++  ++P +P  +  AIVVL G           ++ ++ G++
Sbjct: 48  LLVCSNAWVAK--SLVRSLEWQYLPPNPVPNAEAIVVLGGATKSAYPPRPTVDLSETGDR 105

Query: 65  IFISGVHHSVSKDILL----QKIPIR-------QDLAECCIDIGYKA---------LNTE 104
           +  +   +  +K  ++     +I  R        D+A     IG  +         LNT 
Sbjct: 106 VIYAAQLYRQNKAPIIILSGGRIDWRGGGESESADMANVLTSIGIPSEVIVQEPDSLNTY 165

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR--INSTVQFIPYPIISHDLEENSS 162
            NA       E      VL+VT   HMPR+    QR  IN+      + +   +L+E SS
Sbjct: 166 QNAVNVKKILESRGIGKVLLVTSAMHMPRSIQIFQRQGINAIAAPTDFLVSQGELQELSS 225

Query: 163 IFKIKILRVL 172
             K  IL +L
Sbjct: 226 TPKAAILNLL 235


>gi|254479072|ref|ZP_05092426.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214034988|gb|EEB75708.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 192

 Score = 38.1 bits (87), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 15/155 (9%)

Query: 8   LFVCLIFFIMGFISFIRY-VKQMHIPDHPSVS-AIVVL-------TGEPI---RIERAFE 55
           L V LIF +   I+ + Y +      + P  S AI+VL       T  P    R+E A +
Sbjct: 7   LVVVLIFALFSIIAILAYQIVSFGFTEKPKKSDAIIVLGCAVYGDTPSPFFKERLEEALK 66

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           L +   G  I ISG      S+S+    ++  + + +A   I +  K+ +T  N   +  
Sbjct: 67  LYKEGYGHYIIISGGKGPGESISEAEAGKRYLLEKGVASKNILLDNKSFSTYENLLFSKE 126

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
             EKN+    +IV++ +H+ R  +  +RI     F
Sbjct: 127 IMEKNSLKTAIIVSNKFHLKRASVIAKRIGIDASF 161


>gi|315304604|ref|ZP_07874845.1| putative cytoplasmic protein [Listeria ivanovii FSL F6-596]
 gi|313627033|gb|EFR95925.1| putative cytoplasmic protein [Listeria ivanovii FSL F6-596]
          Length = 189

 Score = 38.1 bits (87), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 20/133 (15%)

Query: 34  HPSVSAIVVLT------GEPI--------RIERAFELLENQIGEKIFISG---VHHSVSK 76
            PS +A  VL       GEP         R++ A + L      ++ +SG      S ++
Sbjct: 33  KPSDNAKTVLILGAKVIGEPAQPSHVLQERLDAAVDYLNEHPKARVIVSGGQGTDESETE 92

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             ++++  + + +    ID   K+  TE N   +    EK      +IVT DYHM R  +
Sbjct: 93  ASVMEEYLVNEGIRRARIDTETKSKRTEENISNSK---EKFQLEKTVIVTSDYHMYRALM 149

Query: 137 ELQRINSTVQFIP 149
             +R N     +P
Sbjct: 150 LAKRQNIDATGLP 162


>gi|281418736|ref|ZP_06249755.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|281407820|gb|EFB38079.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
          Length = 251

 Score = 38.1 bits (87), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 65  IFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           I ISG     H+ S+  + + I +   + E  I +  ++LNT  NA       +K+ F+ 
Sbjct: 122 IIISGGQIPGHTTSEGEIARNILLSLGVPEEKIIVENRSLNTTQNAFYTKELLDKHGFNK 181

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            ++VT  +HM R   + ++  + V  IPYP    D + NS
Sbjct: 182 PILVTSAFHMKRAVKQFEK--NEVNVIPYPT---DYQTNS 216


>gi|289522163|ref|ZP_06439017.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503999|gb|EFD25163.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 254

 Score = 38.1 bits (87), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
           N + AS+        H ++VTH YHMPR  L  Q +   + + P+P+
Sbjct: 163 NIKNASSILRSLELKHAVLVTHGYHMPRAHLIAQGLAPEINWHPFPV 209


>gi|323525715|ref|YP_004227868.1| hypothetical protein BC1001_1372 [Burkholderia sp. CCGE1001]
 gi|323382717|gb|ADX54808.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1001]
          Length = 239

 Score = 38.1 bits (87), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           H +   D  L  + +R+ +    I +  ++L T  NA+  SA   ++ +  +++VT  YH
Sbjct: 120 HPATEADTYLPYL-LREQVPRSDIVLENRSLTTYENARNVSAIVGQSRYDSLILVTSAYH 178

Query: 131 MPRTFLELQRINSTVQFIPYPIIS 154
           MPR  L+ +         P P+IS
Sbjct: 179 MPRALLDFRHFG----LEPQPLIS 198


>gi|332283765|ref|YP_004415676.1| membrane protein [Pusillimonas sp. T7-7]
 gi|330427718|gb|AEC19052.1| membrane protein [Pusillimonas sp. T7-7]
          Length = 254

 Score = 38.1 bits (87), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 19/122 (15%)

Query: 33  DHPSVSAIVVLTG----------EP-------IRIERAFELLENQIGEKIFISG--VHHS 73
           + P+  AIVVL G          EP        RI++A  L + Q    I +SG  +  +
Sbjct: 74  NAPTAQAIVVLGGHTANGRQNWFEPYDKATAIARIDKAANLYKAQRAPLIVVSGAALEGN 133

Query: 74  VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR 133
           VS+  ++     + D+ E  I +  ++  T  NA   +    + +  ++L+VT   HMPR
Sbjct: 134 VSEAQIMANALKQHDIPESAIIMESRSFTTHENAIYTAETLRQRHIQNILLVTSALHMPR 193

Query: 134 TF 135
             
Sbjct: 194 AM 195


>gi|269120765|ref|YP_003308942.1| hypothetical protein Sterm_2157 [Sebaldella termitidis ATCC 33386]
 gi|268614643|gb|ACZ09011.1| protein of unknown function DUF218 [Sebaldella termitidis ATCC
           33386]
          Length = 243

 Score = 38.1 bits (87), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 57/111 (51%), Gaps = 9/111 (8%)

Query: 49  RIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R ++A E L+      +F++G   +   V + +++++  +   + E  I +  K+ NT  
Sbjct: 110 RSDKAIEYLKEYPHLNVFLTGGQGIDEKVPESVIMKEYFLENGIDENRIFLEDKSTNTNE 169

Query: 106 NAQ-EASAWAEKN-NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
           N +    A  + +  +H++L+VT D+HMPR  +  +  N TV    YP+ S
Sbjct: 170 NIKFYIDALKDTDMEYHNILLVTSDFHMPRAGVIARHYNLTV----YPLCS 216


>gi|20808561|ref|NP_623732.1| hypothetical protein TTE2177 [Thermoanaerobacter tengcongensis MB4]
 gi|20517188|gb|AAM25336.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 192

 Score = 37.7 bits (86), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 67/155 (43%), Gaps = 15/155 (9%)

Query: 8   LFVCLIFFIMGFISFIRY-VKQMHIPDHPSVSAIVVLTGEPI-----------RIERAFE 55
           L V LIF +   I+ + Y +      + P  S  +++ G  +           R+E A +
Sbjct: 7   LVVVLIFALFSIIAILAYQIISFGFTEKPKKSDAIIVLGCAVYGDAPSPFFKERLEEALK 66

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           L +   G  I ISG      S+S+    ++  + + +A   I +  K+ +T  N   +  
Sbjct: 67  LYKEGYGRYIIISGGKGPGESISEAEAGKRYFLEKGVASKNILLDNKSFSTYENLLFSKE 126

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
             EKN+    +IV++ +H+ R  +  +RI     F
Sbjct: 127 IMEKNSLKTAIIVSNKFHLKRASVIAKRIGIDASF 161


>gi|170755560|ref|YP_001782537.1| hypothetical protein CLD_1642 [Clostridium botulinum B1 str. Okra]
 gi|169120772|gb|ACA44608.1| conserved hypothetical protein [Clostridium botulinum B1 str. Okra]
          Length = 197

 Score = 37.7 bits (86), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 3/95 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           N + +    E NN    +IV++ YH+ R+ L  Q+
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRSELLCQK 159


>gi|187923614|ref|YP_001895256.1| hypothetical protein Bphyt_1622 [Burkholderia phytofirmans PsJN]
 gi|187714808|gb|ACD16032.1| protein of unknown function DUF218 [Burkholderia phytofirmans PsJN]
          Length = 262

 Score = 37.7 bits (86), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           H +   D  L  + +R+ +    I +  ++L T  NA+  S     + +  ++++T  Y 
Sbjct: 143 HRATEADTYLPYL-LRRQVPRADIVLENRSLTTYENARNVSGIVHGSRYDSLILITSAYQ 201

Query: 131 MPRTFLELQRINSTVQFIPYPIISH 155
           MPR  L+  R   T    P P+IS+
Sbjct: 202 MPRALLDFHRFGLT----PQPMISN 222


>gi|224500115|ref|ZP_03668464.1| hypothetical protein LmonF1_10719 [Listeria monocytogenes Finland
           1988]
          Length = 189

 Score = 37.7 bits (86), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 30  HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIR 86
            +  +P+V ++V+      R++ A   L      K+ +SG      S ++  ++++  + 
Sbjct: 47  KVKGNPAVPSLVLQE----RLDAAVAYLNEYPKAKVIVSGGQGADESATEASVMEEYLVN 102

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
           + +A   I+   K+  TE N + ++A   K N    +IVT DYHM R  +  +R      
Sbjct: 103 EGIARKRIETETKSKRTEENIKYSNA---KFNLGKTVIVTSDYHMYRALMLAKRQGIDAS 159

Query: 147 FIP 149
            +P
Sbjct: 160 GLP 162


>gi|59323997|gb|AAW84264.1| heterogeneous nuclear ribonucleoprotein L [Aplysia californica]
          Length = 237

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHH 72
           +F + G +  I+++K          SA++ L G+PI +ERA   L N      F + +  
Sbjct: 49  LFCLYGNVVRIKFLKSKE------GSAMIQL-GDPISVERAIANLNNVF---FFGNKLQL 98

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKA-LNTEGNAQEASAWAEKNNFHHVLIVTHDYHM 131
           S+SK   LQ++P   +LA+  +   YK  +    N       A+KN       V H ++ 
Sbjct: 99  SMSKQAFLQEVPNPHELADGTLS--YKDFMGNRNNRFTNPEAAQKNRIQSPSKVLHFFNA 156

Query: 132 PRTFLE 137
           P T  E
Sbjct: 157 PPTITE 162


>gi|56750108|ref|YP_170809.1| hypothetical protein syc0099_d [Synechococcus elongatus PCC 6301]
 gi|56685067|dbj|BAD78289.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 188

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECCI 94
           S  AI VL G+P R + A EL +      I++S G +   ++ +  Q       +    +
Sbjct: 28  SPQAIFVLGGDPQREQFAAELAQTHPDLPIWVSSGSNPEYAEWVFGQA-----GVPRSRL 82

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
            + Y+A +T  N    +   ++    HV +VT DYHM R  +
Sbjct: 83  HLDYQATDTLSNFTSLADRFQQQGIQHVYLVTSDYHMRRALV 124


>gi|119512125|ref|ZP_01631217.1| hypothetical protein N9414_08053 [Nodularia spumigena CCY9414]
 gi|119463215|gb|EAW44160.1| hypothetical protein N9414_08053 [Nodularia spumigena CCY9414]
          Length = 187

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 62/155 (40%), Gaps = 6/155 (3%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           +F+ L  FI+  +S I     +     P   AI+ L G P R E   E  +      I++
Sbjct: 1   MFLILAGFILALLSIIPIRLAIASYQSPHPQAILTLGGSPEREEFTAEFAKKHPHLDIWV 60

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           S          + Q      +++   + + Y A++T  N        + N+  H+ ++T 
Sbjct: 61  SSGIPPKQAQAIFQN----ANISNHRLHLDYLAVDTVTNFTSLVDDFKHNHIQHIYLITS 116

Query: 128 DYHMPR--TFLELQRINSTVQFIPYPIISHDLEEN 160
            YH+PR      L   +  + F P PI S    E+
Sbjct: 117 AYHLPRAKAIATLVLGSQGITFTPVPIPSQKPRES 151


>gi|313636439|gb|EFS02193.1| conserved hypothetical protein [Listeria seeligeri FSL S4-171]
          Length = 189

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 49  RIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++ A   L N     + +SG      SV++  ++++  + + +A   I+   K+  TE 
Sbjct: 62  RLDAAVVYLNNHPKVSVVVSGGKGADESVTEASVMEEYLVNEGIARNRIEKETKSKRTEE 121

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           N   ++   EK      +IVT DYHM R  +  +R N  V  +P
Sbjct: 122 NISNSN---EKFELGKTVIVTSDYHMYRALMLAERQNIDVSGLP 162


>gi|16804480|ref|NP_465965.1| hypothetical protein lmo2442 [Listeria monocytogenes EGD-e]
 gi|47096829|ref|ZP_00234410.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224503412|ref|ZP_03671719.1| hypothetical protein LmonFR_13022 [Listeria monocytogenes FSL
           R2-561]
 gi|254828017|ref|ZP_05232704.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254831135|ref|ZP_05235790.1| hypothetical protein Lmon1_07233 [Listeria monocytogenes 10403S]
 gi|254900420|ref|ZP_05260344.1| hypothetical protein LmonJ_11417 [Listeria monocytogenes J0161]
 gi|254913341|ref|ZP_05263353.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254937722|ref|ZP_05269419.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|255026377|ref|ZP_05298363.1| hypothetical protein LmonocytFSL_08615 [Listeria monocytogenes FSL
           J2-003]
 gi|255029934|ref|ZP_05301885.1| hypothetical protein LmonL_14269 [Listeria monocytogenes LO28]
 gi|16411930|emb|CAD00520.1| lmo2442 [Listeria monocytogenes EGD-e]
 gi|47014806|gb|EAL05758.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258600401|gb|EEW13726.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258610325|gb|EEW22933.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|293591346|gb|EFF99680.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 189

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 30  HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIR 86
            +  +P+V ++V+      R++ A   L      K+ +SG      S ++  ++++  + 
Sbjct: 47  KVKGNPAVPSLVLQE----RLDAAVAYLNEYPKAKVIVSGGQGADESATEASVMEEYLVN 102

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
           + +A   I+   K+  TE N + ++A   K N    +IVT DYHM R  +  +R      
Sbjct: 103 EGIARKRIETETKSKRTEENIKYSNA---KFNLGKTVIVTSDYHMYRALMLAKRQGIDAS 159

Query: 147 FIP 149
            +P
Sbjct: 160 GLP 162


>gi|313632066|gb|EFR99164.1| conserved hypothetical protein [Listeria seeligeri FSL N1-067]
          Length = 189

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 49  RIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++ A   L N     + +SG      SV++  ++++  + + +A   I+   K+  TE 
Sbjct: 62  RLDAAVVYLNNHPKVSVVVSGGKGADESVTEASVMEEYLVNEGIARNRIEKETKSKRTEE 121

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           N   ++   EK      +IVT DYHM R  +  +R N  V  +P
Sbjct: 122 NISNSN---EKFELGKTVIVTSDYHMYRALMLAERQNIDVSGLP 162


>gi|296158762|ref|ZP_06841591.1| protein of unknown function DUF218 [Burkholderia sp. Ch1-1]
 gi|295890967|gb|EFG70756.1| protein of unknown function DUF218 [Burkholderia sp. Ch1-1]
          Length = 262

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           H +   D  L  + +RQ +    I +   +  T  NA+  SA  E + +  ++++T  Y 
Sbjct: 143 HRATEADTYLPYL-LRQQVPRADIVLENSSRTTYENARNVSAVLEGSRYDSLILITSAYQ 201

Query: 131 MPRTFLELQRINSTVQFIPYPIISH 155
           MPR  L+  R        P P+IS+
Sbjct: 202 MPRAMLDFHRFG----LAPQPMISN 222


>gi|291532233|emb|CBL05346.1| Uncharacterized conserved protein [Megamonas hypermegale ART12/1]
          Length = 194

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 33  DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQ-DL 89
           D P V+    L   P         L+ ++G  I +SG  ++    ++  + +  +++  +
Sbjct: 32  DTPDVTGTGTLCSIPANRLLTAVRLQKKLGIPIIVSGGQIYEDSGREADIARRILKELGV 91

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           +E  I +  ++LNT  NA+ ++   +   +   L+VT  +HM R  +   ++   V  IP
Sbjct: 92  SEDMILLENRSLNTTQNAEYSTNILKSRKYKQPLLVTSAFHMERAVVNFNKLG--VDVIP 149

Query: 150 YP 151
           YP
Sbjct: 150 YP 151


>gi|254992747|ref|ZP_05274937.1| hypothetical protein LmonocytoFSL_06569 [Listeria monocytogenes FSL
           J2-064]
          Length = 189

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 20/133 (15%)

Query: 34  HPSVSAIVVL------TGEPI--------RIERAFELLENQIGEKIFISG---VHHSVSK 76
            PS +A  VL      TG P         R++ A   L      K+ +SG      S ++
Sbjct: 33  KPSENADTVLILGAKVTGTPAVPSLVLQERLDAAVAYLNEYPKAKVIVSGGQGADESATE 92

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             ++++  + + +A   I+   K+  TE N + ++A   K N    +IVT DYHM R  +
Sbjct: 93  ASVMEEYLVNEGIARKRIETETKSKRTEENIKYSNA---KFNLGKTVIVTSDYHMYRALM 149

Query: 137 ELQRINSTVQFIP 149
             +R       +P
Sbjct: 150 LAKRQGIDASGLP 162


>gi|289435703|ref|YP_003465575.1| hypothetical protein lse_2342 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171947|emb|CBH28493.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 189

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 49  RIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++ A   L N     + +SG      SV++  ++++  + + +A   I+   K+  TE 
Sbjct: 62  RLDAAVVYLNNHPKVSVVVSGGKGADESVTEASVMEEYLVNEGIARNRIEKETKSKRTEE 121

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           N   ++   EK      +IVT DYHM R  +  +R N  V  +P
Sbjct: 122 NISNSN---EKFELGKTVIVTSDYHMYRALMLAERQNIDVSGLP 162


>gi|125974798|ref|YP_001038708.1| hypothetical protein Cthe_2313 [Clostridium thermocellum ATCC
           27405]
 gi|256004933|ref|ZP_05429906.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|125715023|gb|ABN53515.1| protein of unknown function DUF218 [Clostridium thermocellum ATCC
           27405]
 gi|255991113|gb|EEU01222.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|316941930|gb|ADU75964.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           1313]
          Length = 251

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 8/100 (8%)

Query: 65  IFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           I ISG     H+ S+  +   I +   + E  I +  ++LNT  NA       +K+ F+ 
Sbjct: 122 IIISGGQIPGHTTSEGEIAMNILLSLGVPEEKIIVENRSLNTTQNAFYTKELLDKHGFNK 181

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            ++VT  +HM R   + ++  + V  IPYP    D + NS
Sbjct: 182 PILVTSAFHMKRAVKQFEK--NEVNVIPYPT---DYQTNS 216


>gi|170696469|ref|ZP_02887595.1| protein of unknown function DUF218 [Burkholderia graminis C4D1M]
 gi|170138622|gb|EDT06824.1| protein of unknown function DUF218 [Burkholderia graminis C4D1M]
          Length = 239

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           H +   D  L  + +R+ +    I +  ++L T  NA+  SA   ++ +  +++VT  YH
Sbjct: 120 HAATEADTYLPYL-LREQVPRSDIVLENQSLTTYENARNVSAIVGQSRYDSLILVTSAYH 178

Query: 131 MPRTFLELQRINSTVQFIPYPIIS 154
           MPR  L+ +         P P+IS
Sbjct: 179 MPRAMLDFRHFG----LEPQPLIS 198


>gi|168179334|ref|ZP_02613998.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226950331|ref|YP_002805422.1| hypothetical protein CLM_3296 [Clostridium botulinum A2 str. Kyoto]
 gi|182669557|gb|EDT81533.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226841604|gb|ACO84270.1| conserved hypothetical protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 198

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           N + +    E NN    +IV++ YH+ R  L  Q+
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQK 159


>gi|284802880|ref|YP_003414745.1| hypothetical protein LM5578_2637 [Listeria monocytogenes 08-5578]
 gi|284996021|ref|YP_003417789.1| hypothetical protein LM5923_2586 [Listeria monocytogenes 08-5923]
 gi|284058442|gb|ADB69383.1| hypothetical protein LM5578_2637 [Listeria monocytogenes 08-5578]
 gi|284061488|gb|ADB72427.1| hypothetical protein LM5923_2586 [Listeria monocytogenes 08-5923]
          Length = 189

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 30  HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIR 86
            +  +P+V ++V+      R++ A   L      K+ +SG      S ++  ++++  + 
Sbjct: 47  KVKGNPAVPSLVLQE----RLDAAVAYLNEYPKAKVIVSGGQGADESATEASVMEEYLVN 102

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
           + +A   I+   K+  TE N + ++A   K N    +IVT DYHM R  +  +R      
Sbjct: 103 EGIARKRIETETKSKRTEENIKYSNA---KFNLGKTVIVTSDYHMYRGLMLAKRQGIDAS 159

Query: 147 FIP 149
            +P
Sbjct: 160 GLP 162


>gi|295676250|ref|YP_003604774.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1002]
 gi|295436093|gb|ADG15263.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1002]
          Length = 262

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 5/87 (5%)

Query: 64  KIFISG----VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           ++ +SG     H +   D  L  + +RQ +    I +   +  T  NA+  S    ++++
Sbjct: 132 QVIVSGGNPQRHSATEADTYLPYL-LRQQVPRSDIVLEKSSRTTYENARNVSVIVGQSHY 190

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQ 146
             +++VT  YHMPR  L+ QR     Q
Sbjct: 191 DKLILVTSAYHMPRALLDFQRFGVEPQ 217


>gi|153938260|ref|YP_001392181.1| hypothetical protein CLI_2956 [Clostridium botulinum F str.
           Langeland]
 gi|152934156|gb|ABS39654.1| conserved hypothetical protein [Clostridium botulinum F str.
           Langeland]
          Length = 197

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           N + +    E NN    +IV++ YH+ R  L  Q+
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQK 159


>gi|108758987|ref|YP_633512.1| hypothetical protein MXAN_5362 [Myxococcus xanthus DK 1622]
 gi|15076969|gb|AAK83000.1|AF285783_5 unknown [Myxococcus xanthus]
 gi|108462867|gb|ABF88052.1| conserved hypothetical protein [Myxococcus xanthus DK 1622]
          Length = 258

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 49  RIERAFELLENQIGEKIFISG------VHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           R+ R FELL      ++ +SG          V  D+LL+++       E  +  G ++ N
Sbjct: 107 RVLRGFELLHEGRARRVLLSGGSLDPRPEAVVEADVLLRQLQQWGIPRERIVTEG-RSRN 165

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  NA E++   ++  +  +L+VT   HMPR 
Sbjct: 166 TRENAVESARIIQERGWKSLLLVTSAAHMPRA 197


>gi|169349813|ref|ZP_02866751.1| hypothetical protein CLOSPI_00551 [Clostridium spiroforme DSM 1552]
 gi|169293381|gb|EDS75514.1| hypothetical protein CLOSPI_00551 [Clostridium spiroforme DSM 1552]
          Length = 196

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 14/140 (10%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------RIERAFEL 56
           +V L F ++  + FI   K+       S     ++ G P             R+E+A EL
Sbjct: 10  YVVLCFVLINVLIFITVFKKTQKRQKQSKYDCAIVCGFPANSDGSPSLIMKSRVEKAIEL 69

Query: 57  -LENQIGEKIFISG-VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
              N+I   IF  G VH++  +  +++K  I   L +  I    KA++T  N    +   
Sbjct: 70  YCHNKIDYIIFSGGKVHNTYEEAAIMEKYAISLGLDKKIIIKENKAISTFHNLLYCTEIM 129

Query: 115 EKNNFHHVLIVTHDYHMPRT 134
            ++NF+  L+VT+ +H+ + 
Sbjct: 130 NEHNFNSCLVVTNGWHLRKA 149


>gi|209521954|ref|ZP_03270620.1| protein of unknown function DUF218 [Burkholderia sp. H160]
 gi|209497609|gb|EDZ97798.1| protein of unknown function DUF218 [Burkholderia sp. H160]
          Length = 212

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 64  KIFISGV----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           ++ +SG     H +   D  L  + +RQ +A   I +   +  T  NA+  SA   ++++
Sbjct: 82  QVIVSGGNPQRHSATEADTYLPYL-LRQQVARSDIVLEKTSRTTYENARNVSAIVGQSHY 140

Query: 120 HHVLIVTHDYHMPRTFLELQ 139
             +++VT  YHMPR  L+ Q
Sbjct: 141 DTLILVTSAYHMPRALLDFQ 160


>gi|322807220|emb|CBZ04794.1| hypothetical protein H04402_02990 [Clostridium botulinum H04402
           065]
          Length = 197

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLGLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           N + +    E NN    +IV++ YH+ R  L  Q+
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQK 159


>gi|322435976|ref|YP_004218188.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX9]
 gi|321163703|gb|ADW69408.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX9]
          Length = 218

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 72/178 (40%), Gaps = 32/178 (17%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHI---------PDHPSVSAIVVLTGEP----- 47
           R F    F  L+   MG+ S++  V+Q+++          D  +V      +G P     
Sbjct: 23  RRFLLWCFCFLVLAAMGWSSWV--VRQINLVAAQDQAQPADAIAVFGAAEYSGRPSPVYH 80

Query: 48  IRIERAFELLENQIGEKIFISG---------VHHSVSKDILL-QKIPIRQDLAECCIDIG 97
            R++ A  L   QI   +   G             V +D LL   IP  + +AE      
Sbjct: 81  ARLDHAVTLYRKQIAPIVITFGGGSDKDSGKTEGGVGRDYLLANGIPFDKIIAET----- 135

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
             +++TE   +  +  AE+NN  H+++V+ + H+ R     +R    V   P P + H
Sbjct: 136 -HSVDTEQQVELLAQIAEENNLSHIVLVSDNTHLFRIQELCRRAGLDVYTSPRPALGH 192


>gi|307592076|ref|YP_003899667.1| hypothetical protein Cyan7822_5740 [Cyanothece sp. PCC 7822]
 gi|306985721|gb|ADN17601.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7822]
          Length = 205

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 35  PSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDIL-LQKIPIRQDLAEC 92
           P   A  +L G+  R E   EL +     +I++S G +   +K++  +  +P R      
Sbjct: 40  PQPQAFFILGGDFRREEVVAELAKWYPSLEIWVSSGPNTQKTKELFQMAGVPPR------ 93

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
            + I  +A++T  N     A  +K +  H+ +VT DYHMPR 
Sbjct: 94  LLHIDARAIDTVTNFTSLVADFKKKHIQHLYLVTSDYHMPRA 135


>gi|148380856|ref|YP_001255397.1| hypothetical protein CBO2900 [Clostridium botulinum A str. ATCC
           3502]
 gi|153931082|ref|YP_001385163.1| hypothetical protein CLB_2864 [Clostridium botulinum A str. ATCC
           19397]
 gi|153935289|ref|YP_001388632.1| hypothetical protein CLC_2797 [Clostridium botulinum A str. Hall]
 gi|148290340|emb|CAL84464.1| putative exported protein [Clostridium botulinum A str. ATCC 3502]
 gi|152927126|gb|ABS32626.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           19397]
 gi|152931203|gb|ABS36702.1| conserved hypothetical protein [Clostridium botulinum A str. Hall]
          Length = 197

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L  +  G+ I +SG      ++S+   +QK  +++ L +  I    K+ NT  
Sbjct: 65  RLDEGLRLYNDGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIIPEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           N + +    E NN    +IV++ YH+ R  L  Q+
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQK 159


>gi|307730038|ref|YP_003907262.1| hypothetical protein BC1003_2008 [Burkholderia sp. CCGE1003]
 gi|307584573|gb|ADN57971.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1003]
          Length = 225

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           H +   D  L  + +R+ +    I +  ++L T  NA+  SA   ++ +  +++VT  YH
Sbjct: 106 HPASEADTYLPYL-LREQVPRSDIVLENQSLTTYENARNVSAIVGQSRYDSLILVTSAYH 164

Query: 131 MPRTFLELQRINSTVQFIPYPIIS 154
           MPR  L+ +         P P+IS
Sbjct: 165 MPRALLDFRHFG----LDPQPLIS 184


>gi|83309135|ref|YP_419399.1| hypothetical protein amb0036 [Magnetospirillum magneticum AMB-1]
 gi|82943976|dbj|BAE48840.1| Uncharacterized protein [Magnetospirillum magneticum AMB-1]
          Length = 526

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLA 90
           +++A V L G    + RA E+LE++IG ++   G H+  S     Q +   +DLA
Sbjct: 192 AIAAAVCLPGHRAGLARALEVLEHEIGRQVLPDGCHYERSPSYHFQVLGDLEDLA 246


>gi|255527086|ref|ZP_05393975.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296188150|ref|ZP_06856542.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
 gi|255509238|gb|EET85589.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296047276|gb|EFG86718.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
          Length = 197

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R +    L +   G+ I +SG      S+S+   +++  + + +    I +  K+ +T  
Sbjct: 60  RTDEGLRLFKEGYGKYIIVSGGKGQGESISEAEAMKRYLVSKGVDSSKIILEDKSASTMA 119

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
           N   + +  EK NF   +IV++ YH+ R  L
Sbjct: 120 NLINSKSIMEKKNFKTAIIVSNKYHLKRASL 150


>gi|223939730|ref|ZP_03631602.1| protein of unknown function DUF218 [bacterium Ellin514]
 gi|223891601|gb|EEF58090.1| protein of unknown function DUF218 [bacterium Ellin514]
          Length = 343

 Score = 36.2 bits (82), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 46/103 (44%), Gaps = 2/103 (1%)

Query: 49  RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+  A +L  + + +K+  SG     SV +   + ++ ++  +    I      LNT+  
Sbjct: 207 RVRTACQLYRDGLVKKLIFSGGPGDGSVHETESMTRMAVQLGVKPQDILTDRAGLNTQAT 266

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
                    + N  H+L+V+H YH+PR  +  +R    V  +P
Sbjct: 267 VNNTERLFSQINARHILVVSHFYHLPRIKMAYRRDGWDVYTVP 309


>gi|226224989|ref|YP_002759096.1| hypothetical protein Lm4b_02410 [Listeria monocytogenes Clip81459]
 gi|254825437|ref|ZP_05230438.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|254853556|ref|ZP_05242904.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|254933133|ref|ZP_05266492.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|255519961|ref|ZP_05387198.1| hypothetical protein LmonocFSL_01797 [Listeria monocytogenes FSL
           J1-175]
 gi|300765230|ref|ZP_07075215.1| hypothetical protein LMHG_11386 [Listeria monocytogenes FSL N1-017]
 gi|225877451|emb|CAS06165.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258606929|gb|EEW19537.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|293584691|gb|EFF96723.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293594680|gb|EFG02441.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|300514051|gb|EFK41113.1| hypothetical protein LMHG_11386 [Listeria monocytogenes FSL N1-017]
 gi|328471359|gb|EGF42256.1| hypothetical protein LM220_10065 [Listeria monocytogenes 220]
 gi|332312871|gb|EGJ25966.1| hypothetical protein LMOSA_4070 [Listeria monocytogenes str. Scott
           A]
          Length = 189

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 10/118 (8%)

Query: 35  PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAE 91
           P+V ++V+      R++ A   L      K+ +SG      S ++  ++++  + + +A 
Sbjct: 52  PAVPSLVLQE----RLDAAVAYLNEYPKAKVIVSGGQGADESATEASVMEEYLVNEGIAR 107

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             I+   K+  TE N + ++A   K N    +IVT DYHM R  +  +R       +P
Sbjct: 108 KRIETETKSKRTEENIKYSNA---KFNLGKTVIVTSDYHMYRALMLAKRQGIDASGLP 162


>gi|46908614|ref|YP_015003.1| hypothetical protein LMOf2365_2414 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47093642|ref|ZP_00231398.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|46881886|gb|AAT05180.1| conserved hypothetical protein [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47017977|gb|EAL08754.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|328465305|gb|EGF36562.1| hypothetical protein LM1816_14015 [Listeria monocytogenes 1816]
          Length = 189

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 10/118 (8%)

Query: 35  PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAE 91
           P+V ++V+      R++ A   L      K+ +SG      S ++  ++++  + + +A 
Sbjct: 52  PAVPSLVLQE----RLDAAVAYLNEYPKAKVIVSGGQGADESATEASVMEEYLVNEGIAR 107

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             I+   K+  TE N + ++A   K N    +IVT DYHM R  +  +R       +P
Sbjct: 108 KRIETETKSKRTEENIKYSNA---KFNLGKTVIVTSDYHMYRALMLAKRQGIDASGLP 162


>gi|168181584|ref|ZP_02616248.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|237796355|ref|YP_002863907.1| hypothetical protein CLJ_B3154 [Clostridium botulinum Ba4 str. 657]
 gi|182675224|gb|EDT87185.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|229261607|gb|ACQ52640.1| conserved hypothetical protein [Clostridium botulinum Ba4 str. 657]
          Length = 197

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ + +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGVDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           N + +    E NN    +IV++ YH+ R  L  Q+
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQK 159


>gi|170758739|ref|YP_001788223.1| hypothetical protein CLK_2294 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169405728|gb|ACA54139.1| conserved hypothetical protein [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 197

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   ++K  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMEKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           N + +    E NN    +IV++ YH+ R  L  Q+
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQK 159


>gi|260772652|ref|ZP_05881568.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio metschnikovii CIP 69.14]
 gi|260611791|gb|EEX36994.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio metschnikovii CIP 69.14]
          Length = 268

 Score = 35.8 bits (81), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 64/144 (44%), Gaps = 19/144 (13%)

Query: 16  IMGFISFIRYVKQMHIPDH--PSVS----AIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           I G + ++  +   H+ D   P  S    A ++   E IR+ R +       G K+ +SG
Sbjct: 75  IEGTVDYVMVLGNGHVVDDSIPPTSELTRAALMRLSEGIRVMRMYP------GAKLILSG 128

Query: 70  VHHS--VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
                 +S   +L K+ +   +A+  I +   A +T   A++A+A+ ++      ++VT 
Sbjct: 129 YAGGSEMSHARMLAKVALALGVAKSDIILLETAQDTWEEARQAAAFVQQRTL---VLVTS 185

Query: 128 DYHMPRTFLELQRINSTVQFIPYP 151
             HMPR   E Q    T   IP P
Sbjct: 186 ASHMPRAMNEFQSAGLTP--IPAP 207


>gi|119188591|ref|XP_001244902.1| hypothetical protein CIMG_04343 [Coccidioides immitis RS]
          Length = 1264

 Score = 35.4 bits (80), Expect = 4.3,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 68/163 (41%), Gaps = 19/163 (11%)

Query: 14   FFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------PIRIERAFELLENQIGEKIFI 67
            FF++G IS  R+  +M I       A V   G+      PI +ER +++    +G    +
Sbjct: 1100 FFVLGLISTSRHGLEMLI--EAGWDAPVDYKGQSLGSCMPINLERMYKISFGPVGSNSKV 1157

Query: 68   SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA-------WAEKNNFH 120
            +G  +   K  +    PI Q +    +D+G   L+    A   S        + +   F 
Sbjct: 1158 NGTANQRYKSAVTDSDPINQKILNLLVDMGNTVLSKRAAADLQSIKTKHPDHFRQTQLFR 1217

Query: 121  HVLIV--THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            + L++  +H + +P     L   + +V  +   ++  DLE +S
Sbjct: 1218 NTLVILESHHFRLPARRFALDLFDKSV--MGRIVLEDDLELDS 1258


>gi|258575787|ref|XP_002542075.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237902341|gb|EEP76742.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 1247

 Score = 35.4 bits (80), Expect = 4.4,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 59/147 (40%), Gaps = 17/147 (11%)

Query: 14   FFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------PIRIERAFELLENQIGEKIFI 67
            FF++G IS  R+  +M +       A V   G+      P+ +ER +++  N +G K   
Sbjct: 1083 FFVLGLISASRHGLEMLV--EAGWDAPVDYKGQSLGSCMPVNLERIYKIPFNSVGPKAET 1140

Query: 68   SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA-------QEASAWAEKNNFH 120
            +GV     +  +    PI Q +     D+G   L     A       +    + +   F 
Sbjct: 1141 NGVSDERYRSAVTDSDPINQKILNLLADMGNTVLTKRAAADLQRIKLKHPDNFRQTQLFR 1200

Query: 121  HVLIV--THDYHMPRTFLELQRINSTV 145
            + LI+  +H + +P     L   + +V
Sbjct: 1201 NTLIILESHHFRLPARRFALDLFDKSV 1227


>gi|293401028|ref|ZP_06645173.1| putative membrane protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306054|gb|EFE47298.1| putative membrane protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 261

 Score = 35.4 bits (80), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 13/135 (9%)

Query: 12  LIFFIMGFISFIRYVKQMHIPDHPSVSAIVV---LTGEPI------RIERAFELLENQIG 62
           +I   +G  S I Y + MH       +AI++   L G  I      R+ER  +  E    
Sbjct: 82  IIILFLGLQSCILY-QGMHTDKQQGEAAIILGAQLHGSSISRLLRYRLERGIQFAEEYPN 140

Query: 63  EKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             + +SG      + S+   +++  I+  +AE  I +   ++NT+ N   +    EK + 
Sbjct: 141 TYLIVSGGKGQAETCSEASAMKQYLIQHGVAESRILMEDASMNTQENLAFSKVLMEKYHI 200

Query: 120 HHVLIVTHDYHMPRT 134
               I+T+D+HM R 
Sbjct: 201 KSASIITNDFHMFRA 215


>gi|262376749|ref|ZP_06069977.1| flavoprotein [Acinetobacter lwoffii SH145]
 gi|262308459|gb|EEY89594.1| flavoprotein [Acinetobacter lwoffii SH145]
          Length = 400

 Score = 35.4 bits (80), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 63/141 (44%), Gaps = 22/141 (15%)

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT--EGNAQEASAWAEKNNFHHVLIV 125
           SG+ + ++K       P R  L       G+K + T   GNA EA+   E N+F   L+ 
Sbjct: 175 SGIGYEIAKQFGHHVYPTRAGLVPFTFSDGFKEVTTRLSGNAVEATLSNELNSFTEALLF 234

Query: 126 THDYHMPRTFLELQRI-----NSTVQFIPYPIISHDLEENSSIFKIK-------ILRVLL 173
           TH      + L+L        +  V F+P    S DL +    FK K       +LR LL
Sbjct: 235 THRGLSGPSSLQLSNYWNVGQSFKVDFLP----SVDLLD---FFKSKKQSQPKVLLRTLL 287

Query: 174 IEYL-KILLLSIQLSLSTQTA 193
            EYL K ++  +Q  + T++A
Sbjct: 288 NEYLPKSVVAELQSIIWTESA 308


>gi|262197868|ref|YP_003269077.1| hypothetical protein Hoch_4693 [Haliangium ochraceum DSM 14365]
 gi|262081215|gb|ACY17184.1| protein of unknown function DUF218 [Haliangium ochraceum DSM 14365]
          Length = 247

 Score = 35.4 bits (80), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           +A+NT  NA+ A+A         + +VTH +HMPR     +     +  +P P    D
Sbjct: 156 RAMNTHENARNAAAILSAEGIERIYLVTHAWHMPRALRSFE--AEGLDVVPAPTGFRD 211


>gi|229824214|ref|ZP_04450283.1| hypothetical protein GCWU000282_01518 [Catonella morbi ATCC 51271]
 gi|229786568|gb|EEP22682.1| hypothetical protein GCWU000282_01518 [Catonella morbi ATCC 51271]
          Length = 341

 Score = 35.0 bits (79), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 65/148 (43%), Gaps = 22/148 (14%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-------EPI---RIERAFELLENQIG 62
           IFF+   ++FI +VK       P  S IVVL          P+   RI++A +L   +  
Sbjct: 150 IFFVTNILNFIHFVK-------PRYSYIVVLGAGLNGTEVTPLLASRIDKAIKLWRRRPQ 202

Query: 63  EKIFI----SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
           +   I     G    +S+   ++   +RQ + +  I +  ++ NT  N   +    EK  
Sbjct: 203 DVTLIMSGGQGPDEVISEGEAMKAYALRQGVPQSAILVDNQSRNTHENLLFSYKLMEKGR 262

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQ 146
               +IVT+ YH+ R+ +  +R+    Q
Sbjct: 263 -EDFVIVTNYYHLLRSLILARRLGLKCQ 289


>gi|153873460|ref|ZP_02002036.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
 gi|152070073|gb|EDN67963.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
          Length = 195

 Score = 35.0 bits (79), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 73/170 (42%), Gaps = 30/170 (17%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTG-----EPIRIERAFELLENQIGEK-IFISGVHH 72
            +S  RY     I D+P V AIVV+ G     +P R  R F +     G++ I  + ++H
Sbjct: 1   MVSLERYHPSQDITDYPMVQAIVVIGGCLESAKPPR--RTFNV--GDAGDRVIHAARLYH 56

Query: 73  SVSKDILL--------QKIPIRQDLAECCID---IGYKALNTEG-------NAQEASAWA 114
           +    ++L        +K+P   D     ++   +  KA+ +E        NA  +    
Sbjct: 57  AGKAPLILVSGGTLPWRKVPPEADAMRAFLEELGVPTKAVMSEPDSITTYENALFSKKLL 116

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           +    H +L+VT  +HM R+    +++    + IP P     ++   S+F
Sbjct: 117 DNKGIHKILLVTSAFHMRRSAAVFRKVG--FEVIPAPTDFRVVKNPPSLF 164


>gi|221115165|ref|XP_002163743.1| PREDICTED: hypothetical protein, partial [Hydra magnipapillata]
          Length = 1322

 Score = 34.7 bits (78), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 78/161 (48%), Gaps = 20/161 (12%)

Query: 61  IGEKIFISGVHHSVSKDILLQKIPI----RQDLAECCID--IGYKALNTEGNAQ----EA 110
           IG K+FI   H   S D  L+K+      R+D   C +      K+++ E NAQ    ++
Sbjct: 729 IGCKVFICDFHREQSWDRWLKKLSSGCSNRKDDILCILRRLAWSKSIDEEENAQRILEQS 788

Query: 111 SAWAEKN--NFHHVL--IVTHDYHMPRTFLELQR-INSTVQFIPYPIISHDLEENSSIFK 165
             W++++   F   +      ++ M   +    R + S +   P+  + H L + S++  
Sbjct: 789 EFWSQESFTKFKQYIENYTDSNFKMDARYRRYARWVPSYLYNRPHSFVKHCLIKKSNVEN 848

Query: 166 IKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEITV 206
           + +  V++I++    +LS     ST+ A+++F++  +EIT+
Sbjct: 849 LDLSGVIMIKHGVFAVLS-----STKPATKYFVSFGDEITM 884


>gi|303323717|ref|XP_003071850.1| Hr1 repeat family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240111552|gb|EER29705.1| Hr1 repeat family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|320031794|gb|EFW13752.1| sterility protein Ste20 [Coccidioides posadasii str. Silveira]
          Length = 1309

 Score = 34.7 bits (78), Expect = 8.1,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 67/163 (41%), Gaps = 19/163 (11%)

Query: 14   FFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------PIRIERAFELLENQIGEKIFI 67
            FF++G IS  R+  +M I       A V   G+      PI +ER +++    +G    +
Sbjct: 1145 FFVLGLISTSRHGLEMLI--EAGWDAPVDYKGQSLGSCMPINLERMYKISFGPVGSNSRL 1202

Query: 68   SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA-------WAEKNNFH 120
             G  +   K  +    PI Q +    +D+G   L+    A   S        + +   F 
Sbjct: 1203 HGTANQRYKSAVTDSDPINQKILNLLVDMGNTVLSKRAAADLQSIKTKHPDHFRQTQLFR 1262

Query: 121  HVLIV--THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            + L++  +H + +P     L   + +V  +   ++  DLE +S
Sbjct: 1263 NTLVILESHHFRLPARRFALDLFDKSV--MGRIVLEDDLELDS 1303


>gi|238021623|ref|ZP_04602049.1| hypothetical protein GCWU000324_01525 [Kingella oralis ATCC 51147]
 gi|237866237|gb|EEP67279.1| hypothetical protein GCWU000324_01525 [Kingella oralis ATCC 51147]
          Length = 213

 Score = 34.7 bits (78), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 64/152 (42%), Gaps = 20/152 (13%)

Query: 1   MRYFWYGLFVCL--IFFIMGFISFIRYV---KQMHIPDHPSVSAIVVLTG-------EPI 48
           +RY  YG  + +  IF +  + ++  Y        +P H    A VVL          P+
Sbjct: 7   LRYLRYGFLLSILSIFALQAWCAWQVYQYAHAPAALPKH--ADAAVVLGAAAWGDKPSPV 64

Query: 49  ---RIERAFELLENQIGEK-IFISGVHHS--VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++  EK IF  G       S+  + +K  ++Q +    I    ++ +
Sbjct: 65  FRERINHAIALYQSERVEKLIFTGGTRKEGYPSEGEVARKFALKQGIPSHDIIYETRSKD 124

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N        +K+  HHV+IV+  YHM R 
Sbjct: 125 TYQNLVNTRLLMQKHKLHHVIIVSDPYHMARA 156


Searching..................................................done


Results from round 2




>gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040256|gb|ACT57052.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  286 bits (733), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ
Sbjct: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH
Sbjct: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL
Sbjct: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180

Query: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207
           LLSIQLSLSTQTASQFFITLIEEITVK
Sbjct: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207


>gi|218462839|ref|ZP_03502930.1| hypothetical protein RetlK5_26822 [Rhizobium etli Kim 5]
          Length = 236

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 70/185 (37%), Positives = 109/185 (58%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 32  LRWGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKG 91

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+E S W     + 
Sbjct: 92  AGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGHDAIDTIGNAEETSNWIHAKGYR 151

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT++YHMPRT  EL  ++  ++FIPYP+++ DL+  +       +RV+L EYLK+L
Sbjct: 152 SVLVVTNNYHMPRTLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYLKVL 211

Query: 181 LLSIQ 185
           L   +
Sbjct: 212 LAGAR 216


>gi|209551150|ref|YP_002283067.1| hypothetical protein Rleg2_3574 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536906|gb|ACI56841.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 238

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 107/183 (58%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 36  WGGFACVLAIALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKGAG 95

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+EAS W   N +  V
Sbjct: 96  KRLLISGVHPTTTPRQIRRMTQGSADLFSCCVDIGHDAIDTIGNAEEASNWIHANGYRSV 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 156 IVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 215

Query: 183 SIQ 185
             +
Sbjct: 216 GAR 218


>gi|218680941|ref|ZP_03528838.1| hypothetical protein RetlC8_19678 [Rhizobium etli CIAT 894]
          Length = 216

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 108/183 (59%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 14  WGGFACVLTMALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKGAG 73

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+EAS W   N +  V
Sbjct: 74  KRLLISGVHPTTTPRQIRRMTQGSADLFSCCVDIGHDAIDTIGNAEEASNWIHANGYRSV 133

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY+K+LL 
Sbjct: 134 IVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYVKVLLA 193

Query: 183 SIQ 185
             +
Sbjct: 194 GAR 196


>gi|327193562|gb|EGE60452.1| hypothetical protein RHECNPAF_150012 [Rhizobium etli CNPAF512]
          Length = 238

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 106/183 (57%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 36  WGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGAG 95

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      +L  CC+DIG+ AL+T GNA+E S W     +  V
Sbjct: 96  KRLLISGVHPTTTPAQIRKMTQGSANLFSCCVDIGHDALDTIGNAEETSNWIHAKGYRSV 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 156 LVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 215

Query: 183 SIQ 185
             +
Sbjct: 216 GAR 218


>gi|241206553|ref|YP_002977649.1| hypothetical protein Rleg_3867 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860443|gb|ACS58110.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 238

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 69/185 (37%), Positives = 108/185 (58%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 34  LRWGGFACLLAIALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKG 93

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH + +   + +      DL  CC+DIGY A++T GNA+EAS W     + 
Sbjct: 94  AGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGYDAIDTIGNAEEASNWIHTKGYR 153

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VLIVT++YHMPR+  EL  ++  ++FI YP+++ DL+  +       +RV+L EY+K+L
Sbjct: 154 SVLIVTNNYHMPRSLAELSYVDPDIEFIAYPVVNSDLKSRNWFTDPNAMRVMLAEYVKVL 213

Query: 181 LLSIQ 185
           L   +
Sbjct: 214 LTGAR 218


>gi|190893641|ref|YP_001980183.1| hypothetical protein RHECIAT_CH0004075 [Rhizobium etli CIAT 652]
 gi|190698920|gb|ACE93005.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 236

 Score =  267 bits (684), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 107/183 (58%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  +G
Sbjct: 34  WGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGVG 93

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      +L  CC+DIG+ AL+T GNA+E S W     +  V
Sbjct: 94  KRLLISGVHPTTTPAQIRKMTQGSANLFSCCVDIGHDALDTIGNAEETSNWIHAKGYRSV 153

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 154 LVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 213

Query: 183 SIQ 185
             +
Sbjct: 214 GAR 216


>gi|116254067|ref|YP_769905.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258715|emb|CAK09820.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 236

 Score =  265 bits (677), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 68/185 (36%), Positives = 107/185 (57%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 32  LRWGGFACLLAIALVFGGFLRFADSVTTLKPPTEPKADAIVVLTGGYQRIDQAVELLQKG 91

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISG H + +   + +      DL  CC+DIGY A++T GNA+EAS W     + 
Sbjct: 92  AGKRLLISGAHPTTTPAQIRKMTQGSADLFSCCVDIGYDAIDTIGNAEEASNWIHAKGYR 151

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VLIVT++YHMPR+  EL  ++  ++FI YP+++ DL+  +       +RV+L EY+K+L
Sbjct: 152 SVLIVTNNYHMPRSLAELSYVDPDIEFIAYPVVNSDLKSRNWFTDPNAMRVMLAEYVKVL 211

Query: 181 LLSIQ 185
           L   +
Sbjct: 212 LTGAR 216


>gi|86359387|ref|YP_471279.1| hypothetical protein RHE_CH03804 [Rhizobium etli CFN 42]
 gi|86283489|gb|ABC92552.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 191

 Score =  260 bits (666), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 66/170 (38%), Positives = 101/170 (59%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
             GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G+++ ISGVH + +
Sbjct: 2   FGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGAGKRLLISGVHPTTT 61

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
              + +      DL  CC+DIG+ A++T GNA+E S W     +  VL+VT++YHMPR+ 
Sbjct: 62  PAQIRKMTQGSADLFSCCVDIGHDAIDTIGNAEETSNWIHAKGYRSVLVVTNNYHMPRSL 121

Query: 136 LELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
            EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL   +
Sbjct: 122 AELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLTGAR 171


>gi|222149964|ref|YP_002550921.1| hypothetical protein Avi_4029 [Agrobacterium vitis S4]
 gi|221736946|gb|ACM37909.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 246

 Score =  260 bits (665), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 72/185 (38%), Positives = 104/185 (56%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +RY  Y + + +   + GF+ F   V  M  P  P   AIVVLTG   RI++A +LL   
Sbjct: 38  LRYGGYAILLLMACLVAGFLHFADDVTAMMPPAEPKADAIVVLTGGYQRIDQAVDLLRKG 97

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGVH S S   + +      DL  CC+D+GY+A++T GNA E + W     F 
Sbjct: 98  SGRRLLISGVHPSTSPATIRKMTQASPDLFACCVDMGYRAIDTIGNANETAQWIHDKGFS 157

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT +YHM R+ +EL+R +   QFIPYP+++ DL   +       LR L+ EY KIL
Sbjct: 158 SVLVVTSNYHMRRSLMELRRTDHETQFIPYPVVTADLRTRAWYADPNALRTLMSEYAKIL 217

Query: 181 LLSIQ 185
           +   +
Sbjct: 218 IAYTR 222


>gi|227823233|ref|YP_002827205.1| hypothetical protein NGR_c27030 [Sinorhizobium fredii NGR234]
 gi|227342234|gb|ACP26452.1| hypothetical protein NGR_c27030 [Sinorhizobium fredii NGR234]
          Length = 242

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 70/207 (33%), Positives = 117/207 (56%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  ++ L   L  F+ GF+ F   V  +  P  P   AIVVLTG   RIE+A ELL++ 
Sbjct: 35  LRRGFFVLLAFLAVFVAGFLYFADTVASLQPPAAPKADAIVVLTGGFQRIEQAVELLKSG 94

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGV+ + +   + +      DL +CC+DIG++A++T GNA EA  W   + + 
Sbjct: 95  AGNRLLISGVNPATTGSQIRRNTQSSADLFKCCVDIGHEAVDTIGNATEAGQWIHDHGYR 154

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT++YHMPR+ LEL+R+    +FI YP+++ DL+ ++ +   + ++ +L+EY K  
Sbjct: 155 SVLVVTNNYHMPRSLLELRRVRPDTEFIAYPVVNSDLKTSNWLRNPRFIKAILLEYAKYS 214

Query: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207
           +  ++   +   A          I  K
Sbjct: 215 IAFLRDFANAHLADSSRTDTAPPIQAK 241


>gi|92116288|ref|YP_576017.1| hypothetical protein Nham_0669 [Nitrobacter hamburgensis X14]
 gi|91799182|gb|ABE61557.1| protein of unknown function DUF218 [Nitrobacter hamburgensis X14]
          Length = 238

 Score =  257 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 60/195 (30%), Positives = 95/195 (48%), Gaps = 5/195 (2%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A ELL    G+++ ISG
Sbjct: 34  IGFVGAAVGFVGFLSQLRGVETKPASNADGIVVLTGGSSRISDAVELLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W ++  F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDNQRLLTCCVDLDRSAVNTRSNASETRRWVDEQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      +  IP+ +I     E         LR+LL EY K L   +++ L+
Sbjct: 154 HMPRAIVELSYAMPDITLIPFAVIGDKWREEPWWTSGATLRLLLSEYAKYLAAEVRVRLA 213

Query: 190 TQTASQFFITLIEEI 204
                   + L  EI
Sbjct: 214 -----YLGLELAPEI 223


>gi|299132206|ref|ZP_07025401.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
 gi|298592343|gb|EFI52543.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
          Length = 236

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 57/185 (30%), Positives = 93/185 (50%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             LF   + F+ GF  F   ++            IVVLTG   R+  A +LL    G+++
Sbjct: 26  RFLFSFFVIFLAGFAWFASQLRSEESKPDRHADGIVVLTGGASRVADALDLLSKGYGKRL 85

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH +     +L+  P  Q L +CC+D+   A+NT  NA E   W ++  FH +++V
Sbjct: 86  LISGVHPANGAADILRAQPESQALLKCCVDLDRSAVNTRSNATETRRWVKERGFHSLIVV 145

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T +YHMPR  +EL      +  I YP++S              +R++ +EY+K L+  ++
Sbjct: 146 TSNYHMPRATVELTHAMPDIDLIFYPVVSEAWRGEPWWNSPAGVRLVALEYVKYLVAQVR 205

Query: 186 LSLST 190
           + L+ 
Sbjct: 206 VRLAA 210


>gi|90426336|ref|YP_534706.1| hypothetical protein RPC_4865 [Rhodopseudomonas palustris BisB18]
 gi|90108350|gb|ABD90387.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB18]
          Length = 240

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 58/196 (29%), Positives = 97/196 (49%), Gaps = 5/196 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF+ F+  ++   I    +   IVVLTG   R+  A ELL    G ++ I
Sbjct: 31  LAIGFVGMASGFVVFLSQLRGAEIQPGRNADGIVVLTGGSSRVSDAIELLAAGYGRRLLI 90

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +   + + + +P  Q L  CC+D+   A+NT  NA EA  WA +  FH +++VT 
Sbjct: 91  SGVHPTNGANDISRSLPDSQQLLSCCVDLDRSAINTRSNAAEARRWAHERGFHSLIVVTS 150

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +E+      ++ IP+ ++     ++         R+LL EY K +    ++ 
Sbjct: 151 NYHMPRAIVEMSHAMPDIELIPFAVVGDKWRDDPWWTSGATFRLLLSEYAKYIAAEARVR 210

Query: 188 LSTQTASQFFITLIEE 203
           L+      F   L+ +
Sbjct: 211 LA-----GFGAELMPD 221


>gi|222087356|ref|YP_002545893.1| hypothetical protein Arad_4209 [Agrobacterium radiobacter K84]
 gi|221724804|gb|ACM27960.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 240

 Score =  255 bits (651), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 61/183 (33%), Positives = 100/183 (54%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +     +     GF+ F   +  +  P  P   AI+VLTG   RI++A ELL    G
Sbjct: 37  WGGFAFVFLVAIVFGGFLHFADSITTLKPPLEPKADAIIVLTGGYQRIDQAVELLRTGAG 96

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++ ISG H + +   + +      +L  CC+DIGY A++T GNA+EA+ W     +  +
Sbjct: 97  NRLLISGAHPTTTPSQIRKLTQSPANLFNCCVDIGYDAIDTIGNAREAAKWIHARGYKSI 156

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL+ ++    FIPYP+++ DL+  +       LR ++ EY K+LL 
Sbjct: 157 LVVTNNYHMPRSLAELKYVDPATDFIPYPVVNSDLKTKNWFTDPNALRTMIYEYAKVLLA 216

Query: 183 SIQ 185
             +
Sbjct: 217 GAR 219


>gi|85713578|ref|ZP_01044568.1| hypothetical protein NB311A_03539 [Nitrobacter sp. Nb-311A]
 gi|85699482|gb|EAQ37349.1| hypothetical protein NB311A_03539 [Nitrobacter sp. Nb-311A]
          Length = 239

 Score =  255 bits (651), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 58/180 (32%), Positives = 91/180 (50%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A ELL    G+++ ISG
Sbjct: 34  IAFVGAGVGFVGFLSQLRGVETKPVNNADGIVVLTGGSSRISDAVELLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W ++  F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDSQQLLTCCVDLDRSAVNTRSNASETRRWVDEQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      V  IP+ +I     E         LR+LL EY+K L    ++ L+
Sbjct: 154 HMPRAIVELSHAMPNVTLIPFAVIGDKWREEPWWTSGTTLRLLLSEYVKYLAAEARVRLA 213


>gi|153008321|ref|YP_001369536.1| hypothetical protein Oant_0986 [Ochrobactrum anthropi ATCC 49188]
 gi|151560209|gb|ABS13707.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 302

 Score =  254 bits (648), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 75/193 (38%), Positives = 117/193 (60%), Gaps = 5/193 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LFV L+ F++GF++F   V  M  P       AI+VLTG   RI+ A +LL+++ G+++ 
Sbjct: 105 LFVILLAFLVGFVAFGEKVTSMQPPAIDEPADAIIVLTGGQSRIQAAVDLLKDKRGKRLL 164

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH + ++  L +     Q L +CC+D+   ALNT GNA E+  W   NN+  V++VT
Sbjct: 165 ISGVHPATNEKALQRATHADQSLFDCCVDLDRSALNTIGNATESERWIRTNNYRRVILVT 224

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ D  E+S + +   LRVL IEY+K L  ++++
Sbjct: 225 NNYHIPRSTLEMSYRMKDVEFIPYPVVNGDRREHSWVSEGDTLRVLFIEYVKYLGAAVRV 284

Query: 187 S----LSTQTASQ 195
                  TQT   
Sbjct: 285 GTTELFGTQTNQS 297


>gi|75674776|ref|YP_317197.1| hypothetical protein Nwi_0578 [Nitrobacter winogradskyi Nb-255]
 gi|74419646|gb|ABA03845.1| Protein of unknown function DUF218 [Nitrobacter winogradskyi
           Nb-255]
          Length = 241

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 90/180 (50%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A +LL    G+++ ISG
Sbjct: 34  IAFVGAAVGFVGFLSQLRGVETKPAANADGIVVLTGGSSRISDAVDLLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W +   F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDSQRLLTCCVDLDRSAVNTRSNASETRRWVDGQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      V  IP+ +I     E         LR+LL EY+K L    ++ L+
Sbjct: 154 HMPRAIVELSHAMPDVTLIPFAVIGEKWREEPWWTSGATLRLLLSEYVKYLAAEARVRLA 213


>gi|150397743|ref|YP_001328210.1| hypothetical protein Smed_2545 [Sinorhizobium medicae WSM419]
 gi|150029258|gb|ABR61375.1| protein of unknown function DUF218 [Sinorhizobium medicae WSM419]
          Length = 232

 Score =  253 bits (646), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 68/185 (36%), Positives = 112/185 (60%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  ++ L   L  FI GF+ F   V  +  P  P   AIVVLTG   RI++A +LL+  
Sbjct: 25  LRRSFFVLLAFLAVFIAGFLQFADTVASLQPPPTPKADAIVVLTGGFQRIDQAVDLLKLG 84

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH S ++  + +      DL +CC+DIG +A++T GNA E S W     + 
Sbjct: 85  AGKRLLISGVHPSTTRSQIRRNTQSSADLFKCCVDIGREAVDTIGNATETSHWIRSRGYR 144

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +L+VT++YHMPR+ LEL+R     +F+ YP+++ DL+  + +    +L+ +L+EY+K  
Sbjct: 145 TILVVTNNYHMPRSLLELRRARPETEFVAYPVVNSDLKTTNWLRNPLVLKAILLEYVKYS 204

Query: 181 LLSIQ 185
           + S++
Sbjct: 205 VSSLR 209


>gi|239833000|ref|ZP_04681329.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239825267|gb|EEQ96835.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 302

 Score =  252 bits (644), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 73/197 (37%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LFV L+ F++GF++F   V  M  P       AI+VLTG   RI+ A  LL+++ G+++ 
Sbjct: 105 LFVILLAFLVGFVAFGEKVTSMQPPAIDEPADAIIVLTGGQSRIQAAVNLLKDKRGKRLL 164

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S ++ +L +     Q L +CC+D+   ALNT GNA E+  W   NN+  V++VT
Sbjct: 165 ISGVHPSTNEKVLQRATHADQSLFDCCVDLDRSALNTIGNAAESERWIRTNNYRRVILVT 224

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+  +   V+F+PYP+++ +  E+S + +   LRVL IEY+K L   +++
Sbjct: 225 NNYHIPRSTLEMSYLMKDVEFVPYPVVNGERREHSWVAEGDTLRVLFIEYVKYLGAVVRV 284

Query: 187 S----LSTQTASQFFIT 199
                  TQ        
Sbjct: 285 GASELFGTQPQQSATAA 301


>gi|39937792|ref|NP_950068.1| hypothetical protein RPA4734 [Rhodopseudomonas palustris CGA009]
 gi|39651652|emb|CAE30174.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 255

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 57/196 (29%), Positives = 96/196 (48%), Gaps = 5/196 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF+ F+  ++        +   IVVLTG   R+  A ELL    G+++ I
Sbjct: 46  LALGFLVGAGGFVVFLSQLRGAEQKPRHNADGIVVLTGGSSRVSDAVELLAAGYGKRLLI 105

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P  +D   CC+D+   A++T  NA E   W ++  F  +++VT 
Sbjct: 106 SGVHRTNGARDISRSVPESRDWFSCCVDLDRSAVDTRSNASETRRWVQERGFRSLIVVTS 165

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + +++ 
Sbjct: 166 NYHMPRAIAEMSHAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELRVR 225

Query: 188 LSTQTASQFFITLIEE 203
           L     S+  I ++ E
Sbjct: 226 L-----SKLGIEVMPE 236


>gi|192293574|ref|YP_001994179.1| hypothetical protein Rpal_5216 [Rhodopseudomonas palustris TIE-1]
 gi|192287323|gb|ACF03704.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           TIE-1]
          Length = 241

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 57/196 (29%), Positives = 96/196 (48%), Gaps = 5/196 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF+ F+  ++        +   IVVLTG   R+  A ELL    G+++ I
Sbjct: 32  LALGFLVGAGGFVVFLSQLRGAEQKPRHNADGIVVLTGGSSRVSDAVELLAAGYGKRLLI 91

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P  +D   CC+D+   A++T  NA E   W ++  F  +++VT 
Sbjct: 92  SGVHRTNGARDISRSVPESRDWFSCCVDLDRSAVDTRSNASETRRWVQERGFRSLIVVTS 151

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + +++ 
Sbjct: 152 NYHMPRAIAEMSHAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELRVR 211

Query: 188 LSTQTASQFFITLIEE 203
           L     S+  I ++ E
Sbjct: 212 L-----SKLGIEVMPE 222


>gi|13473042|ref|NP_104609.1| hypothetical protein mlr3524 [Mesorhizobium loti MAFF303099]
 gi|14023790|dbj|BAB50395.1| mlr3524 [Mesorhizobium loti MAFF303099]
          Length = 241

 Score =  251 bits (641), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 68/196 (34%), Positives = 108/196 (55%), Gaps = 1/196 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R     L +  + F  GF  F   V  +  P +P    AI+VLTG   R++ A +LL +
Sbjct: 35  LRISALSLLILAVLFAGGFGWFANKVAHLTTPANPEKADAIIVLTGGQSRLDAAMDLLAS 94

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GE++ ISGVH S S+  L       ++L  CC+DI   AL+T GNA+E++ W E + +
Sbjct: 95  GKGERLLISGVHPSASRRQLQAATGGDKNLFSCCVDIDRAALDTIGNAEESAKWVESHAY 154

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             V++VT++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K 
Sbjct: 155 GTVILVTNNYHMPRSLLEMGRLLHGAKLEPYPVVNSNLDNGGWLTKPRALRVLFTEYTKY 214

Query: 180 LLLSIQLSLSTQTASQ 195
           LL   +  +  +    
Sbjct: 215 LLALARGIVPVKPTPD 230


>gi|316936202|ref|YP_004111184.1| hypothetical protein Rpdx1_4910 [Rhodopseudomonas palustris DX-1]
 gi|315603916|gb|ADU46451.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           DX-1]
          Length = 241

 Score =  250 bits (639), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 58/196 (29%), Positives = 94/196 (47%), Gaps = 5/196 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF++F+  +    +    +   IVVLTG   R+  A ELL    G ++ I
Sbjct: 32  LALGFVAVAGGFVAFLAQLHSAELQPRRNAEGIVVLTGGSSRVSDAVELLAAGYGRRLLI 91

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P   D   CC+D+   A++T  NA E   W  +  F  +++VT 
Sbjct: 92  SGVHRTNGARDISRSVPESSDWFSCCVDLDRSAVDTRSNAAETRRWVRERGFRSLIVVTS 151

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + +++ 
Sbjct: 152 NYHMPRAIAEMSDAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELRVR 211

Query: 188 LSTQTASQFFITLIEE 203
           L     S+  I L+ E
Sbjct: 212 L-----SKLGIELMPE 222


>gi|91975425|ref|YP_568084.1| hypothetical protein RPD_0945 [Rhodopseudomonas palustris BisB5]
 gi|91681881|gb|ABE38183.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB5]
          Length = 241

 Score =  250 bits (639), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 59/198 (29%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF++F+  ++   +  + +   IVVLTG   R+  A ELL +  G+++ I
Sbjct: 32  LALGFVATAAGFVAFLAQLRGAELKPNRTADGIVVLTGGSSRVSDAVELLASGYGKRLLI 91

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P  +D  +CC+D+   A+NT  NA E   WA +  FH +++VT 
Sbjct: 92  SGVHRTNGASDISRSVPDSKDWLDCCVDLDRSAVNTRSNAAETRRWAHERGFHSLIVVTS 151

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +E+      V+ IP+ +I     +         LR+LL EY K + +  ++ 
Sbjct: 152 NYHMPRAIVEMSHAMPDVELIPFAVIGDKWRDEPWWTSGATLRLLLSEYAKYVAVEARVR 211

Query: 188 LSTQTASQFFITLIEEIT 205
           L+     +  I L  E +
Sbjct: 212 LA-----RLGIELAPEAS 224


>gi|15966410|ref|NP_386763.1| hypothetical protein SMc00715 [Sinorhizobium meliloti 1021]
 gi|307300553|ref|ZP_07580333.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
 gi|307318418|ref|ZP_07597853.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|15075681|emb|CAC47236.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896100|gb|EFN26851.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|306904719|gb|EFN35303.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
          Length = 232

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 68/191 (35%), Positives = 113/191 (59%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  ++ L   L  FI GF+ F   V  +  P  P   AIVVLTG   RI++A +LL+  
Sbjct: 25  LRRGFFVLLAFLTVFIAGFLQFADTVASLQPPATPKADAIVVLTGGFQRIDQAVDLLKLG 84

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH S ++  + +      DL +CC+DIG+ A++T GNA E S W     + 
Sbjct: 85  AGKRLLISGVHPSTTRSQIRRNTQSSADLFKCCVDIGHAAIDTIGNATETSLWIRNRGYR 144

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +L+VT++YHMPR+ LEL+R     +FI YP+++ DL+  + +    +L+ +L+EY K  
Sbjct: 145 TILVVTNNYHMPRSLLELRRARPETEFIAYPVVNSDLKTTNWLRNPLVLKAILLEYGKYS 204

Query: 181 LLSIQLSLSTQ 191
           + +++  +  +
Sbjct: 205 VATLRDVMGAR 215


>gi|332716396|ref|YP_004443862.1| hypothetical protein AGROH133_11928 [Agrobacterium sp. H13-3]
 gi|325063081|gb|ADY66771.1| hypothetical protein AGROH133_11928 [Agrobacterium sp. H13-3]
          Length = 243

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 107/185 (57%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R       + L  F  GF+ F   V  M  P+     AI+VLTG   RIE+A  LL + 
Sbjct: 31  IRGLILLCVITLGAFSGGFLWFADSVASMRPPEGAKGDAIIVLTGGYQRIEQAVGLLRDG 90

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           +G+++ ISGV+ + ++  + +      D+  CC+D+GYKA++T GNA EA++W   + + 
Sbjct: 91  VGKRLLISGVNPATTRTQIRKMTQGSSDMFSCCVDMGYKAIDTIGNANEAASWIRDHGYS 150

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +++VT++YHM R+  EL   +   QFI YP+IS DL   +   +  ++R +L EY+K +
Sbjct: 151 SIVVVTNNYHMHRSLHELHNASPQTQFIAYPVISADLARTNWFAEPDVVRTMLYEYMKFV 210

Query: 181 LLSIQ 185
           + + +
Sbjct: 211 IAAGR 215


>gi|209883916|ref|YP_002287773.1| hypothetical protein OCAR_4768 [Oligotropha carboxidovorans OM5]
 gi|209872112|gb|ACI91908.1| protein of unknown function [Oligotropha carboxidovorans OM5]
          Length = 234

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 58/198 (29%), Positives = 94/198 (47%), Gaps = 6/198 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             +   +I F+ GF  F   +    I        IVVLTG   R+  A +LL    G+++
Sbjct: 26  RFVVSFVIIFLAGFAWFAGQLHSEEIKPERHADGIVVLTGGASRVADALDLLSRGYGKRL 85

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH +     +L+  P R+ L  CC+D+   A+NT  NA E   W ++  F  +++V
Sbjct: 86  LISGVHPANGTADILRAQPERETLLSCCVDLDRSAVNTRSNATETRRWVKERGFRSLIVV 145

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T +YHMPR  +EL      +  I YP++S              +R++ +EY+K L   ++
Sbjct: 146 TSNYHMPRASVELSHAMPDIDLIFYPVVSEAWRGEPWWHSAAGIRLVALEYVKYLAAQVR 205

Query: 186 LSLSTQTASQFFITLIEE 203
           + L+       F  +  E
Sbjct: 206 VRLAA------FGIVFPE 217


>gi|148252746|ref|YP_001237331.1| hypothetical protein BBta_1178 [Bradyrhizobium sp. BTAi1]
 gi|146404919|gb|ABQ33425.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 221

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 59/199 (29%), Positives = 94/199 (47%), Gaps = 5/199 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +      +GFI F+  ++   I        IVVLTG   R+  A ELL    G ++ I
Sbjct: 13  LAIGFFVAAVGFIGFLSQLRGAEIKPERKADGIVVLTGGSSRVSDAVELLAGGYGRRLLI 72

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P  +    CC+D+ Y A+NT  NA +   WA +  F  +++VT 
Sbjct: 73  SGVHPTNEASDITRSLPEARSFINCCVDLDYSAINTRSNAAQTRRWAAERGFKSLIVVTS 132

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +EL     ++  IPY ++     +         LR+LL EY K +    +L 
Sbjct: 133 NYHMPRAIVELSHAMPSLDLIPYAVVGEKWRDEPWWTSGPTLRLLLSEYAKYVAAEARLR 192

Query: 188 LSTQTASQFFITLIEEITV 206
           L+        + L  E+ +
Sbjct: 193 LA-----DLGLDLAPEVDL 206


>gi|218531041|ref|YP_002421857.1| hypothetical protein Mchl_3091 [Methylobacterium chloromethanicum
           CM4]
 gi|218523344|gb|ACK83929.1| protein of unknown function DUF218 [Methylobacterium
           chloromethanicum CM4]
          Length = 234

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 105/202 (51%), Gaps = 1/202 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F     V L+    GF++F+  V++   P    V  IV +TG   R+  A +LL   
Sbjct: 15  LRAFVGLSLVGLLALAGGFLAFVAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEG 74

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGV+   ++D +++  P ++    CC+D+ Y+A NT GNA E   W  +++F 
Sbjct: 75  HGRRLLISGVNERTTRDEIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFG 134

Query: 121 HVLIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            V++VT +YHMPRT +EL+         IPYP++S  L+ +       + R+L  EYLK 
Sbjct: 135 TVVVVTSNYHMPRTLVELRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKF 194

Query: 180 LLLSIQLSLSTQTASQFFITLI 201
           L+   +    +      F  LI
Sbjct: 195 LVAWGRTRFESDPEQSRFAVLI 216


>gi|319781280|ref|YP_004140756.1| hypothetical protein Mesci_1548 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167168|gb|ADV10706.1| protein of unknown function DUF218 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 241

 Score =  247 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 67/196 (34%), Positives = 107/196 (54%), Gaps = 1/196 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R     + +    F  GF  F   V  +  P +P    AI+VLTG   R++ A +LL +
Sbjct: 35  LRLSALSVLILATLFAGGFGWFANKVSHLTTPANPARADAIIVLTGGQSRLDAAMDLLAS 94

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GE++ ISGVH S S+  L       ++L  CC+DI   AL+T GNA+E++ W E + +
Sbjct: 95  GKGERLLISGVHPSASRRQLQAATGGDKNLFSCCVDIDRAALDTIGNAEESAKWVESHAY 154

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             V++VT++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K 
Sbjct: 155 GTVILVTNNYHMPRSLLEMGRLLHGAKLEPYPVVNSNLDNGGWLTKPRALRVLFTEYNKY 214

Query: 180 LLLSIQLSLSTQTASQ 195
           LL   +  +  +    
Sbjct: 215 LLALARGIVPVKPTPN 230


>gi|146343248|ref|YP_001208296.1| hypothetical protein BRADO6468 [Bradyrhizobium sp. ORS278]
 gi|146196054|emb|CAL80081.1| conserved hypothetical protein; putative exported protein
           [Bradyrhizobium sp. ORS278]
          Length = 221

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 58/196 (29%), Positives = 92/196 (46%), Gaps = 5/196 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +      +GF+ F+  ++   I        IVVLTG   R+  A ELL    G ++ I
Sbjct: 13  LGLGFFIAAVGFVGFLSQLRGAEIKPERKADGIVVLTGGSSRVSDAVELLAGGYGRRLLI 72

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +   + + + +P  +    CC+D+ Y A+NT  NA +   WA +  F  +++VT 
Sbjct: 73  SGVHPTNDANDITRSLPEARSFINCCVDLDYSAINTRSNAAQTRRWAAERGFKSLVVVTS 132

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR   EL     ++  IPY ++     +         LR+LL EY K +    +L 
Sbjct: 133 NYHMPRAIAELSHAMPSMDLIPYAVVGEKWRDEPWWTSGPTLRLLLSEYAKYVAAEARLR 192

Query: 188 LSTQTASQFFITLIEE 203
           L+        + L  E
Sbjct: 193 LA-----DLGLDLAPE 203


>gi|158426237|ref|YP_001527529.1| hypothetical protein AZC_4613 [Azorhizobium caulinodans ORS 571]
 gi|158333126|dbj|BAF90611.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS
           571]
          Length = 256

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 103/189 (54%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
             + F+ GF+ F   +             IVVLTG   RI    +LL +  G+++ ISGV
Sbjct: 43  LALLFVGGFVVFTTAIAPREPAGLKPADGIVVLTGGASRIADGVQLLASGHGQRLLISGV 102

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           + + S+D + + +P  + L +CC+D+G++ALNT GNA EA+ W     F  +++VT  +H
Sbjct: 103 NRATSQDEIRRTLPDNEHLLDCCVDLGHRALNTFGNAIEAAEWTRAQGFRSLVVVTSAWH 162

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           MPR  +EL R    V+ + YP+++  ++        + +++LL EYLK ++   ++  + 
Sbjct: 163 MPRALVELGRALPEVELVAYPVVTDRMQSGGWWTDPQTVKLLLKEYLKYMMAMAKIRPAQ 222

Query: 191 QTASQFFIT 199
             A +  ++
Sbjct: 223 AVAPKATVS 231


>gi|254718046|ref|ZP_05179857.1| hypothetical protein Bru83_00605 [Brucella sp. 83/13]
          Length = 212

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 69/184 (37%), Positives = 108/184 (58%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF  F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 15  LFLAVIAFLGGFFVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 74

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 75  ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 134

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   +++
Sbjct: 135 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRV 194

Query: 187 SLST 190
             ++
Sbjct: 195 GSAS 198


>gi|220921160|ref|YP_002496461.1| hypothetical protein Mnod_1152 [Methylobacterium nodulans ORS 2060]
 gi|219945766|gb|ACL56158.1| protein of unknown function DUF218 [Methylobacterium nodulans ORS
           2060]
          Length = 245

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 63/206 (30%), Positives = 102/206 (49%), Gaps = 9/206 (4%)

Query: 5   WYGLFVCL--------IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFEL 56
           W  L + L        + F +GF++F+  + +     H     IV LTG   RI  A +L
Sbjct: 25  WRRLVLTLAALVGASGLAFGVGFLAFVGCLARTERQPHAPADGIVALTGGAQRIGDAIDL 84

Query: 57  LENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
           L    G ++ I+GV+   S++ + +  P +Q L  CC+D+ Y+A NT GNA E   W  +
Sbjct: 85  LAAGYGRRLLITGVNERTSREEIARLNPGQQHLIACCVDLDYRARNTIGNAIETRRWMRE 144

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           N F  V +VT +YHMPRT LEL    +   + +P+P++    + ++        R+L+ E
Sbjct: 145 NGFRTVAVVTSNYHMPRTLLELGHALADGNRVVPHPVVHDGFDPDAWWHHPASARLLVSE 204

Query: 176 YLKILLLSIQLSLSTQTASQFFITLI 201
           Y+K L+  I+    T         L+
Sbjct: 205 YVKFLVAWIRTRFETDPEDSRAAVLM 230


>gi|256112323|ref|ZP_05453244.1| hypothetical protein Bmelb3E_06514 [Brucella melitensis bv. 3 str.
           Ether]
          Length = 208

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 109/184 (59%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 11  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 70

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 71  ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 130

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 131 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 190

Query: 187 SLST 190
             ++
Sbjct: 191 GSAS 194


>gi|260466676|ref|ZP_05812863.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029539|gb|EEW30828.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
          Length = 241

 Score =  245 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 68/196 (34%), Positives = 105/196 (53%), Gaps = 1/196 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R     L V    F  GF  F   V  +  P +P    AI+VLTG   R++ A ELL +
Sbjct: 35  IRISALSLLVLATLFAGGFGWFANKVSHLTTPANPTKADAIIVLTGGQSRLDAAMELLAS 94

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GE++ ISGVH S S+  L       + L  CC+DI   AL+T GNA++++ W   + +
Sbjct: 95  GKGERLLISGVHPSASRRQLQAATGGDKKLFSCCVDIDRAALDTIGNAEQSAKWVTNHAY 154

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             V++VT++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K 
Sbjct: 155 GTVILVTNNYHMPRSLLEMGRLLHGARLEPYPVVNSNLDNGGWLTKPRALRVLFTEYTKY 214

Query: 180 LLLSIQLSLSTQTASQ 195
           LL   +  +  +    
Sbjct: 215 LLALARGIVPVKPTPD 230


>gi|148559698|ref|YP_001259812.1| hypothetical protein BOV_1921 [Brucella ovis ATCC 25840]
 gi|189025061|ref|YP_001935829.1| hypothetical protein BAbS19_I18730 [Brucella abortus S19]
 gi|237816354|ref|ZP_04595347.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260546109|ref|ZP_05821849.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260562906|ref|ZP_05833392.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567524|ref|ZP_05837994.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|265999274|ref|ZP_06111628.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|297247229|ref|ZP_06930947.1| hypothetical protein BAYG_00126 [Brucella abortus bv. 5 str. B3196]
 gi|148370955|gb|ABQ60934.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|189020633|gb|ACD73355.1| hypothetical protein BAbS19_I18730 [Brucella abortus S19]
 gi|237788421|gb|EEP62636.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260096216|gb|EEW80092.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260152922|gb|EEW88014.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260157042|gb|EEW92122.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|263092990|gb|EEZ17140.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|297174398|gb|EFH33745.1| hypothetical protein BAYG_00126 [Brucella abortus bv. 5 str. B3196]
          Length = 300

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 109/184 (59%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 103 LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 162

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 163 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 222

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 223 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 282

Query: 187 SLST 190
             ++
Sbjct: 283 GSAS 286


>gi|163759927|ref|ZP_02167011.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
 gi|162282885|gb|EDQ33172.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
          Length = 220

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 73/200 (36%), Positives = 111/200 (55%), Gaps = 1/200 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R    G  + + F ++GF  F   + ++  P     V AIVVLTG   RIE+A  LLE+
Sbjct: 9   LRILTIGAILGVTFVVIGFFRFTDEIAELKAPGTSVDVDAIVVLTGGYQRIEQALALLED 68

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
            IG+++ ISGV+ S S   L +    +    +CC+DIGY+AL+T GNA E + W  +NN+
Sbjct: 69  GIGDRLLISGVNPSTSSAALRRATGTQSATFDCCVDIGYQALDTIGNANETADWIRQNNY 128

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             VL+VT++YHMPR+ +EL + +  V F+ YP+   DL+  + +     LR L  EY K 
Sbjct: 129 VRVLVVTNNYHMPRSLMELSQASPDVSFVAYPVTHADLKTEAWLTDPVALRTLFTEYAKY 188

Query: 180 LLLSIQLSLSTQTASQFFIT 199
            L  ++      TA+     
Sbjct: 189 SLARLRNWSGATTATGLRAD 208


>gi|256059967|ref|ZP_05450151.1| hypothetical protein Bneo5_06389 [Brucella neotomae 5K33]
          Length = 212

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 108/184 (58%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+  I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 15  LFLAFIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 74

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 75  ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 134

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 135 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 194

Query: 187 SLST 190
             ++
Sbjct: 195 GSAS 198


>gi|265982992|ref|ZP_06095727.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264661584|gb|EEZ31845.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 250

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 69/184 (37%), Positives = 108/184 (58%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF  F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 53  LFLAVIAFLGGFFVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 112

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 113 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 172

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   +++
Sbjct: 173 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRV 232

Query: 187 SLST 190
             ++
Sbjct: 233 GSAS 236


>gi|23502843|ref|NP_698970.1| hypothetical protein BR1995 [Brucella suis 1330]
 gi|62290842|ref|YP_222635.1| hypothetical protein BruAb1_1970 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700754|ref|YP_415328.1| hypothetical protein BAB1_1995 [Brucella melitensis biovar Abortus
           2308]
 gi|254705003|ref|ZP_05166831.1| hypothetical protein Bsuib36_14000 [Brucella suis bv. 3 str. 686]
 gi|256370397|ref|YP_003107908.1| hypothetical protein BMI_I2019 [Brucella microti CCM 4915]
 gi|294851231|ref|ZP_06791904.1| hypothetical protein BAZG_00130 [Brucella sp. NVSL 07-0026]
 gi|23348869|gb|AAN30885.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196974|gb|AAX75274.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616855|emb|CAJ11951.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|256000560|gb|ACU48959.1| hypothetical protein BMI_I2019 [Brucella microti CCM 4915]
 gi|294819820|gb|EFG36819.1| hypothetical protein BAZG_00130 [Brucella sp. NVSL 07-0026]
 gi|326539710|gb|ADZ87925.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 212

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 109/184 (59%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 15  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 74

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 75  ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 134

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 135 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 194

Query: 187 SLST 190
             ++
Sbjct: 195 GSAS 198


>gi|15891332|ref|NP_357004.1| hypothetical protein Atu3608 [Agrobacterium tumefaciens str. C58]
 gi|15159715|gb|AAK89789.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 243

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 64/177 (36%), Positives = 106/177 (59%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
            + L  F  GF+ F   V  M  P+     AI+VLTG   RIE+A  LL + +G+++ IS
Sbjct: 39  VIALGAFSGGFLWFADSVASMRPPEGARGDAIIVLTGGYQRIEQAVGLLRDGVGKRLLIS 98

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           GV+ + ++  + +      D+  CC+D+GYKA++T GNA EA++W   +N+  +++VT++
Sbjct: 99  GVNPATTRSQIRKMTQGSSDMFTCCVDMGYKAIDTIGNANEAASWIRDHNYSSIVVVTNN 158

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           YHM R+  EL+  +   +FI YP+IS DL   +   +  ++R LL EYLK +  + +
Sbjct: 159 YHMHRSLHELRNASPQTEFIAYPVISADLVRTNWFVEPDVVRTLLYEYLKFVAAAGR 215


>gi|49476199|ref|YP_034240.1| hypothetical protein BH15440 [Bartonella henselae str. Houston-1]
 gi|49239007|emb|CAF28307.1| hypothetical protein BH15440 [Bartonella henselae str. Houston-1]
          Length = 230

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 67/191 (35%), Positives = 112/191 (58%), Gaps = 6/191 (3%)

Query: 2   RYF---WYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELL 57
           RYF    + L + ++FF  GF+ F    +Q+  P   P   AI+VLTG   RIE   +LL
Sbjct: 42  RYFPPTAFFLLMIVLFFCAGFVVFSEKTEQLTPPSPLPKADAIIVLTGGENRIETGLDLL 101

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +  +G ++ ISGV+ + +    +    I   L  CC+DIG+KA+NT+GNA+E++ W +K+
Sbjct: 102 QQGLGSRLLISGVNTTTTLKRFMHSTHITPQLFACCVDIGHKAINTKGNAEESAVWIKKH 161

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
           ++  V IVTHDYHM R+  EL+ +   + FI YP+      + S + ++  +R+L  +Y+
Sbjct: 162 HYKTVYIVTHDYHMWRSMRELKYLMPDINFIAYPVKKSG--DESIVQQLNQIRILAFQYI 219

Query: 178 KILLLSIQLSL 188
           K + + I+ + 
Sbjct: 220 KTIDVYIRTAF 230


>gi|261323939|ref|ZP_05963136.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261299919|gb|EEY03416.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 250

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 108/184 (58%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+  I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 53  LFLAFIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 112

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 113 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 172

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 173 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 232

Query: 187 SLST 190
             ++
Sbjct: 233 GSAS 236


>gi|261221047|ref|ZP_05935328.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265997008|ref|ZP_06109565.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260919631|gb|EEX86284.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262551476|gb|EEZ07466.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 254

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 109/184 (59%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 57  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 116

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 117 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 176

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 177 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 236

Query: 187 SLST 190
             ++
Sbjct: 237 GSAS 240


>gi|17986358|ref|NP_538992.1| hypothetical protein BMEI0074 [Brucella melitensis bv. 1 str. 16M]
 gi|260755671|ref|ZP_05868019.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758896|ref|ZP_05871244.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760620|ref|ZP_05872963.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884697|ref|ZP_05896311.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214946|ref|ZP_05929227.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261217820|ref|ZP_05932101.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261314966|ref|ZP_05954163.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316476|ref|ZP_05955673.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321332|ref|ZP_05960529.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751141|ref|ZP_05994850.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755703|ref|ZP_05999412.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265987548|ref|ZP_06100105.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265992020|ref|ZP_06104577.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993756|ref|ZP_06106313.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17981947|gb|AAL51256.1| hypothetical protein BMEI0074 [Brucella melitensis bv. 1 str. 16M]
 gi|260669214|gb|EEX56154.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671052|gb|EEX57873.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675779|gb|EEX62600.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874225|gb|EEX81294.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916553|gb|EEX83414.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260922909|gb|EEX89477.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294022|gb|EEX97518.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295699|gb|EEX99195.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303992|gb|EEY07489.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740894|gb|EEY28820.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745456|gb|EEY33382.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262764737|gb|EEZ10658.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003086|gb|EEZ15379.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659745|gb|EEZ30006.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 250

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 109/184 (59%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 53  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 112

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 113 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 172

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 173 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 232

Query: 187 SLST 190
             ++
Sbjct: 233 GSAS 236


>gi|27376503|ref|NP_768032.1| hypothetical protein blr1392 [Bradyrhizobium japonicum USDA 110]
 gi|27349644|dbj|BAC46657.1| blr1392 [Bradyrhizobium japonicum USDA 110]
          Length = 234

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 59/186 (31%), Positives = 91/186 (48%), Gaps = 5/186 (2%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDIL 79
           I+F+  ++   I        IVVLTG   R+  A ELL    G ++ ISGVH + +   +
Sbjct: 37  IAFLSQLRGAEIAPDRKADGIVVLTGGSSRVSDAMELLAAGYGRRLLISGVHPTSTASDI 96

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
            + +P  Q    CC+D+   AL+T GNA EA  WA+   F  +++VT +YHMPR  +E  
Sbjct: 97  SRTLPENQSFMTCCVDLDRTALSTRGNAAEARRWAQARRFKSLIVVTSNYHMPRALVEFS 156

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFIT 199
                   IP+ ++     E         LR+LL EY+K +   +++ L       F I 
Sbjct: 157 HAMPETILIPFAVVGDKWREEPWWASASTLRLLLSEYVKYIAAEVRVRL-----EDFGID 211

Query: 200 LIEEIT 205
           L  E++
Sbjct: 212 LSPEVS 217


>gi|306843432|ref|ZP_07476033.1| Hypothetical protein BIBO1_0084 [Brucella sp. BO1]
 gi|306276123|gb|EFM57823.1| Hypothetical protein BIBO1_0084 [Brucella sp. BO1]
          Length = 250

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 108/184 (58%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF  F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 53  LFLAVIAFLGGFFVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKERRGKRLL 112

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   N++H V++VT
Sbjct: 113 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVT 172

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 173 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 232

Query: 187 SLST 190
             ++
Sbjct: 233 GSAS 236


>gi|163852283|ref|YP_001640326.1| hypothetical protein Mext_2865 [Methylobacterium extorquens PA1]
 gi|163663888|gb|ABY31255.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 283

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 99/187 (52%), Gaps = 1/187 (0%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
             GF++F+  V++   P    V  IV +TG   R+  A +LL    G ++ ISGV+   +
Sbjct: 79  AGGFLAFVAVVERTDRPSLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLISGVNERTT 138

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           +D +++  P ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +YHMPRT 
Sbjct: 139 RDEIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSNYHMPRTL 198

Query: 136 LELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTAS 194
           +EL+         IPYP++S  L+ +       + R+L  EYLK L+   +    +    
Sbjct: 199 VELRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTRFESDPEQ 258

Query: 195 QFFITLI 201
             F  LI
Sbjct: 259 SRFAVLI 265


>gi|240139618|ref|YP_002964094.1| hypothetical protein MexAM1_META1p3069 [Methylobacterium extorquens
           AM1]
 gi|240009591|gb|ACS40817.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 234

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 105/202 (51%), Gaps = 1/202 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F     V L+    GF++F+  V++   P    V  IV +TG   R+  A +LL   
Sbjct: 15  LRAFVGLSLVGLLVLAGGFLAFVAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEG 74

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGV+   ++D +++  P ++    CC+D+ Y+A NT GNA E   W  +++F 
Sbjct: 75  HGRRLLISGVNERTTRDEIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFG 134

Query: 121 HVLIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            V++VT +YHMPRT +EL+         IPYP++S  L+ +       + R+L  EYLK 
Sbjct: 135 TVVVVTSNYHMPRTLVELRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKF 194

Query: 180 LLLSIQLSLSTQTASQFFITLI 201
           L+   +    +      F  LI
Sbjct: 195 LVAWGRTRFESDPEQSRFAVLI 216


>gi|261758934|ref|ZP_06002643.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp.
           F5/99]
 gi|261738918|gb|EEY26914.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp.
           F5/99]
          Length = 269

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 69/184 (37%), Positives = 108/184 (58%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 72  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 131

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GN  E+  W   N++H V++VT
Sbjct: 132 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNVAESERWIRANDYHRVIVVT 191

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 192 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 251

Query: 187 SLST 190
             ++
Sbjct: 252 GSAS 255


>gi|110635418|ref|YP_675626.1| hypothetical protein Meso_3089 [Mesorhizobium sp. BNC1]
 gi|110286402|gb|ABG64461.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 218

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 66/205 (32%), Positives = 103/205 (50%), Gaps = 8/205 (3%)

Query: 2   RYFWYGL-------FVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERA 53
           R  W G+       F+  + ++ GF  F  +V ++  P        IVVLTG   RI+  
Sbjct: 5   RRMWVGVRSAAATIFLFFVLYVAGFGIFADHVVRLRAPAELNPADGIVVLTGGQSRIDTG 64

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
            +LL+    +++ ISGV+     D L       + L  CC+DI   ALNT GNAQE++ W
Sbjct: 65  MDLLKAGKAKRLLISGVNPVARVDDLRLATGGDRALFNCCVDIDRAALNTVGNAQESAKW 124

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N +  +++VT++YHMPR+ LE++RI       PYP+++  L++ + I     LRVLL
Sbjct: 125 VSANTYGSIIVVTNNYHMPRSLLEMRRILPNADLQPYPVVNTPLDDGAWISNPDALRVLL 184

Query: 174 IEYLKILLLSIQLSLSTQTASQFFI 198
           IEY K +    +     +       
Sbjct: 185 IEYTKYIAALARGLFPAEKGETLSA 209


>gi|225628192|ref|ZP_03786227.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617017|gb|EEH14064.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 254

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 69/184 (37%), Positives = 108/184 (58%), Gaps = 1/184 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    LL+ + G+++ 
Sbjct: 57  LFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLL 116

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH S +++ L +     + L  CCID+   ALNT GN  E+  W   N++H V++VT
Sbjct: 117 ISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNVAESERWIRANDYHRVIVVT 176

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           ++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY+K L   ++L
Sbjct: 177 NNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRL 236

Query: 187 SLST 190
             ++
Sbjct: 237 GSAS 240


>gi|49474722|ref|YP_032764.1| hypothetical protein BQ12360 [Bartonella quintana str. Toulouse]
 gi|49240226|emb|CAF26695.1| hypothetical protein BQ12360 [Bartonella quintana str. Toulouse]
          Length = 230

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 67/184 (36%), Positives = 111/184 (60%), Gaps = 3/184 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEK 64
             L + + FF  GF+ F    +Q+  P+  P   AI+VLTG   RIE    LL+ ++G +
Sbjct: 49  LFLLMIVFFFCAGFVIFSEKTEQLKPPNPLPKADAIIVLTGGEKRIETGLNLLQQELGSR 108

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ + +    +    I   L  CC+DIG+KA+NT+GNA+E++ W +K+++  V I
Sbjct: 109 LLISGVNTTTNLKRFMYSTHITPQLFTCCVDIGHKAINTKGNAEESADWIKKHHYQTVYI 168

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VTHDYHM R+  EL+ +   + FI YP+   ++   S+I +I  +R+L+ +Y+K L + I
Sbjct: 169 VTHDYHMWRSLRELKYLMPDINFIAYPVKKSEI--ESTIQQINQIRILVFQYIKTLEVYI 226

Query: 185 QLSL 188
           + + 
Sbjct: 227 RTAF 230


>gi|254472459|ref|ZP_05085859.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211958742|gb|EEA93942.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 239

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 66/191 (34%), Positives = 103/191 (53%), Gaps = 1/191 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYV-KQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           +R+F+    +C + F  GF+ F+  +   +          IVVLTG   RI ++ +LLE 
Sbjct: 41  VRFFFLLFLICSVAFAAGFLWFVEVLQPAVQAVVPKHADGIVVLTGGRDRISQSLDLLET 100

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
              +++ ISGVH S S   + +    R  L +CC+D+  KALNT GNA+E ++W  KN F
Sbjct: 101 GSAKRLLISGVHPSTSAKQIARLNSKRMWLFDCCVDLDRKALNTIGNAEETASWVRKNQF 160

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
           + +L+VT  YHMPR   ELQ         P P+   +L+         I ++LL EY+K 
Sbjct: 161 NSLLVVTSAYHMPRALAELQVRLPEADLYPSPVYHKELDLEHWYESSSITKLLLREYVKY 220

Query: 180 LLLSIQLSLST 190
           +L+ +++ L T
Sbjct: 221 ILVRLRVELDT 231


>gi|315121772|ref|YP_004062261.1| hypothetical protein CKC_00110 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495174|gb|ADR51773.1| hypothetical protein CKC_00110 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 188

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 129/186 (69%), Positives = 160/186 (86%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRY WY L  CLIFFI GF+ FI+Y+ Q+ IP +PS++AIVVLTGEP RIE+AFELLEN+
Sbjct: 1   MRYLWYSLAACLIFFIGGFVLFIQYIVQIPIPANPSINAIVVLTGEPNRIEKAFELLENK 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IG+++FISGVHHSVSKDILLQKIPIR+DLAECC+DIGYKALNT GNA+EA  W  K+++H
Sbjct: 61  IGQRVFISGVHHSVSKDILLQKIPIRKDLAECCVDIGYKALNTAGNAKEALEWIRKHDYH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLI+THDYH+PR  LEL R NS  +F+PYPII+HDL++N+ I  +K+LR+  IEYLKIL
Sbjct: 121 HVLIITHDYHIPRILLELNRKNSMTKFVPYPIITHDLQKNTLILYMKMLRMTFIEYLKIL 180

Query: 181 LLSIQL 186
           LLS+Q+
Sbjct: 181 LLSLQI 186


>gi|304394191|ref|ZP_07376114.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303293631|gb|EFL88008.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 241

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 61/203 (30%), Positives = 101/203 (49%), Gaps = 3/203 (1%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYV---KQMHIPDHPSVSAIVVLTGEPIRIERAFELLE 58
           R F   LF+ +   + GF+ F   V   +Q+     P+  A+VVLTG   RI    +L+ 
Sbjct: 37  RLFLVLLFIGVGLLVGGFLKFSDGVTSTEQLEAARVPAADAVVVLTGGSARIAEGLDLIA 96

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G+++ ISGV+   S   L         L +CC+D+   AL+T GNA+E + W     
Sbjct: 97  AGKGKRLLISGVNEDTSVAALKAINTNHAPLFDCCVDVERAALDTIGNARETAKWVADKG 156

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  +++VT  YHMPR+ LE +R    +   P+ +I   L         + LR L++EY+K
Sbjct: 157 YSSLIVVTSSYHMPRSLLEFRRTMPKLNIKPHAVILEPLAREGWWKNPETLRFLVVEYVK 216

Query: 179 ILLLSIQLSLSTQTASQFFITLI 201
            +  +++  L  QT S    +++
Sbjct: 217 YVGAAMREYLKPQTISALRGSML 239


>gi|319404819|emb|CBI78420.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 231

 Score =  238 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 64/173 (36%), Positives = 108/173 (62%), Gaps = 3/173 (1%)

Query: 19  FISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           F++F   V Q+  P   P   AI+VLTG   RIE   +LL+ ++G ++ ISGV+ +   +
Sbjct: 60  FVAFTEKVGQLTPPQPLPKADAIIVLTGGKNRIETGLKLLQKKLGSRLLISGVNTTTHPN 119

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            L++ + I   L  CC+DI ++A+NT+GNA+E++ W +K+ +  + IVTHDYHM R+ LE
Sbjct: 120 RLIRIMNINPRLFSCCVDIDHQAVNTQGNAKESAHWIKKHRYKTLYIVTHDYHMIRSLLE 179

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            + +   V FI YPI  +    ++ I +   +R+L +EY+K + + I++ LS+
Sbjct: 180 FKYLMPDVNFIAYPIKQN--VADNWIKQANQIRLLALEYIKSISVKIRIILSS 230


>gi|319406304|emb|CBI79941.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 226

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 66/176 (37%), Positives = 110/176 (62%), Gaps = 3/176 (1%)

Query: 16  IMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
            + F++F   V+Q+  P   P V AI+VLTG   RIE   ELL+ ++G ++ ISGV+ ++
Sbjct: 52  CLTFVAFTEKVEQLTPPHPLPKVDAIIVLTGGKNRIETGLELLQKKLGSRLLISGVNTTI 111

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
             + L++++ I   L  CC+DI + A NT+GNA+E++ W  K+ +  + IVTHDYHM R+
Sbjct: 112 HPNKLIRRMNINPRLFACCVDIDHHATNTQGNAKESAHWINKHRYKTLYIVTHDYHMIRS 171

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            LE + +   + FI YPI  +    +S I +   +R+L +EY+K + + I++ LS+
Sbjct: 172 LLEFKYLMPNINFIAYPIKQN--VTDSWIKQANQIRLLALEYVKNISVKIRIILSS 225


>gi|170749389|ref|YP_001755649.1| hypothetical protein Mrad2831_2982 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655911|gb|ACB24966.1| protein of unknown function DUF218 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 258

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 93/197 (47%), Gaps = 1/197 (0%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
            G  + ++    GF+ F+  + +           IV LTG   RI  A +LL    G ++
Sbjct: 43  LGAGLGMLALFAGFLVFVSALARHERTPTDRADGIVALTGGAQRIGDAIDLLAGGYGRRL 102

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            I+GV+   S+D + +  P ++ L  CC+D+ Y+A NT GNA E   W   + F  V +V
Sbjct: 103 LITGVNERTSRDEIARLNPTQRALIACCVDLDYRARNTIGNAIETRRWMRAHRFSTVAVV 162

Query: 126 THDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           T +YHMPRT +EL        + +P+P+++   + +         R+L  EY+K L+  +
Sbjct: 163 TSNYHMPRTLVELDHALQDSDRVLPHPVVTEAFDADRWWQNPPAARLLASEYMKFLVSWV 222

Query: 185 QLSLSTQTASQFFITLI 201
           +              LI
Sbjct: 223 RTRFEADPERSRAAILI 239


>gi|170740433|ref|YP_001769088.1| hypothetical protein M446_2193 [Methylobacterium sp. 4-46]
 gi|168194707|gb|ACA16654.1| protein of unknown function DUF218 [Methylobacterium sp. 4-46]
          Length = 245

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 93/184 (50%), Gaps = 1/184 (0%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F+ F+  + +     +     IVVLTG   RI  A +LL    G ++ I+GV+   S+D 
Sbjct: 47  FLVFVGGLARTEQQPYARADGIVVLTGGAQRIGDAIDLLAAGFGRRLLITGVNERTSRDE 106

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + +  P +Q L  CC+D+ Y+A NT GNA E   W  +N F  + +VT +YHMPRT LEL
Sbjct: 107 IARLNPGQQHLISCCVDLDYRARNTIGNAIETRRWMRENGFRTIAVVTSNYHMPRTLLEL 166

Query: 139 QRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFF 197
                S  + +P+P++    + ++        R+L  EY+K L+  ++  +         
Sbjct: 167 DHALTSGDRVVPHPVVHEGFDADAWWHHPASARLLASEYVKFLVAWLRTRIEADPEDSRA 226

Query: 198 ITLI 201
             L+
Sbjct: 227 AVLM 230


>gi|86747962|ref|YP_484458.1| hypothetical protein RPB_0836 [Rhodopseudomonas palustris HaA2]
 gi|86570990|gb|ABD05547.1| Protein of unknown function DUF218 [Rhodopseudomonas palustris
           HaA2]
          Length = 240

 Score =  235 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 53/185 (28%), Positives = 92/185 (49%), Gaps = 5/185 (2%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F +F+  ++        +   IVVLTG   R+  A +LL +  G+++ ISGVH +     
Sbjct: 42  FAAFLLQLRVEESRPSRAADGIVVLTGGSSRVSDAVDLLASGYGKRLLISGVHRTSGASE 101

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + + +P  +D   CC+D+   A NT  NA E   WA +  F  +++VT +YHMPR   E+
Sbjct: 102 ISRSVPDSKDWLGCCVDLDRSAFNTRSNAAETRRWAHERGFRSLIVVTSNYHMPRAIAEM 161

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFI 198
                 ++ IP+ +I     + +       LR+LL EY K + +  ++ L+     +  I
Sbjct: 162 SHAMPDIELIPFSVIGEKWRDEAWWSSGATLRLLLSEYAKYVAVEARVRLA-----RLGI 216

Query: 199 TLIEE 203
            ++ E
Sbjct: 217 DIMPE 221


>gi|209967333|ref|YP_002300248.1| hypothetical protein RC1_4097 [Rhodospirillum centenum SW]
 gi|209960799|gb|ACJ01436.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 244

 Score =  234 bits (597), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 59/194 (30%), Positives = 88/194 (45%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +   + G     + +  G   F   + +    D     AIVVLTG   R+   FELL   
Sbjct: 33  LHALFGGALTLAVAWFAGLFLFAAGLPRTPPEDDRQTDAIVVLTGGSERLAAGFELLRAH 92

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
              K+FISGV+  V    LL+         ECCI +GY A +TEGNA E + W  +  F 
Sbjct: 93  RARKLFISGVYRGVDVQELLRLSRQAPGDLECCIVLGYAADDTEGNAAETALWVRQEGFR 152

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            + +VT +YHMPR+ +E +R    V  I +P+   ++             +++ EY K L
Sbjct: 153 SLRVVTANYHMPRSLVEFRRALPEVDLIAHPVAPPNVRLEHWWRWPGTASLIVGEYNKFL 212

Query: 181 LLSIQLSLSTQTAS 194
           L   +  L    A+
Sbjct: 213 LAWTRALLPVPAAT 226


>gi|163869202|ref|YP_001610454.1| hypothetical protein Btr_2487 [Bartonella tribocorum CIP 105476]
 gi|161018901|emb|CAK02459.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 221

 Score =  234 bits (597), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 69/182 (37%), Positives = 108/182 (59%), Gaps = 3/182 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L V +  F  GFI F    +++  P   P   AI+VLTG   RIE    LL+  +G ++ 
Sbjct: 42  LVVIVFIFWGGFIIFSEKTERLVPPTPLPKADAIIVLTGGEHRIETGLHLLQKGLGSRLL 101

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV+ S +    +  + I   L  CCIDIG++A+NT GNAQE++AW +K+++  + IVT
Sbjct: 102 ISGVNTSTNLKSFMHNMHISPQLISCCIDIGHQAINTRGNAQESAAWIKKHHYKTLYIVT 161

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           HDYH+ R+  EL+ +   + FI YP+     +  S+I +IK  R+L+ +Y+K L + I+ 
Sbjct: 162 HDYHIWRSMRELKYLMPDIHFIAYPVKKS--KAESTIQQIKQARILIFQYIKTLQVYIRT 219

Query: 187 SL 188
           + 
Sbjct: 220 AF 221


>gi|307943505|ref|ZP_07658849.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773135|gb|EFO32352.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 245

 Score =  233 bits (594), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 63/182 (34%), Positives = 93/182 (51%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
            G  V +   +  F SF   V  +  P  P   AIVVLTG   RI +A  LLE    E++
Sbjct: 58  LGFIVVVGLVVGSFASFAERVATIETPRDPRADAIVVLTGGKERISKAMRLLEEGRAERL 117

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH   S   + Q       L  CC+D+   ALNT GNA E ++W  ++ F  +L+V
Sbjct: 118 LISGVHPGSSARQIAQATSSDLPLFTCCVDLDRAALNTLGNATETASWVAEHEFETLLVV 177

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T  YH+PR  LEL  +      +PYP+ S + +  +       L++L+ EY+K  L  ++
Sbjct: 178 TSAYHLPRAELELAEVLPNAGLLPYPVFSSERDLTAWYSSFDTLKLLMREYVKYTLARLR 237

Query: 186 LS 187
           ++
Sbjct: 238 IT 239


>gi|319407779|emb|CBI81430.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 233

 Score =  233 bits (594), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 63/173 (36%), Positives = 103/173 (59%), Gaps = 3/173 (1%)

Query: 19  FISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           F++F   V Q   P   P   AI+VLTG   RIE   +LL+ ++G ++ ISGV+     +
Sbjct: 62  FVAFTEKVGQFTPPHPLPKADAIIVLTGGKNRIETGLKLLQKKLGSRLLISGVNTRTHPN 121

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            L++ + I   L  CC+DI ++A+NT GNA+E++ W +KN +  + IVT DYHM R+ LE
Sbjct: 122 KLIRIMNINPRLFSCCVDIDHQAINTRGNAEESAHWIKKNRYKTLYIVTDDYHMTRSLLE 181

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            + +   + FI YPI       +S I ++  +R+L +EY+K + + I++ L +
Sbjct: 182 FKYLMPDINFIAYPIKQD--VADSWIKQVNQIRLLALEYIKNISVKIRIILFS 232


>gi|240851278|ref|YP_002972681.1| hypothetical membrane protein [Bartonella grahamii as4aup]
 gi|240268401|gb|ACS51989.1| hypothetical membrane protein [Bartonella grahamii as4aup]
          Length = 229

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 66/182 (36%), Positives = 106/182 (58%), Gaps = 3/182 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
           L + +  F  GFI F    +++  P   P   AI+VLTG   RIE    LL+  +G ++ 
Sbjct: 50  LAIIVFIFWGGFIVFSEKTERLSPPKPLPKADAIIVLTGGENRIETGLHLLQKGLGSRLL 109

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV+ + +    +    I   L  CCIDIG++A+NT GNA+E++ W +K++F  + IVT
Sbjct: 110 ISGVNTTTNLKGFMHNRHITPRLVSCCIDIGHQAINTRGNAKESATWIKKHHFKTLYIVT 169

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           HDYHM R+  EL+ +   + FI YP+   +    S+I +I  +R+LL +Y+K L + ++ 
Sbjct: 170 HDYHMWRSMRELKYLMPDIHFIAYPVKKSN--AESAIQQINQIRILLFQYIKTLQVYLRT 227

Query: 187 SL 188
           + 
Sbjct: 228 AF 229


>gi|319899424|ref|YP_004159521.1| hypothetical protein BARCL_1288 [Bartonella clarridgeiae 73]
 gi|319403392|emb|CBI76960.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 225

 Score =  232 bits (591), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 67/171 (39%), Positives = 104/171 (60%), Gaps = 3/171 (1%)

Query: 21  SFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDIL 79
           +F   V +   P     V AI+VLTG   RIE   +LLE   G ++ ISGV  +   + L
Sbjct: 56  AFTEKVGRFTPPHPLQKVDAIIVLTGGKNRIETGLKLLEKGFGSRLLISGVSTTTHPNKL 115

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           ++ + I   L  CCIDIGY+A+NT+GNA+E++ W +K+ +  + IVTHDYHM R+ LE Q
Sbjct: 116 IRMMNINPQLFSCCIDIGYQAINTQGNAKESADWIKKHRYKTLYIVTHDYHMMRSLLEFQ 175

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            +   + FI YPI       +S I +   +R+L++EY+K + + I+++LS+
Sbjct: 176 YLMPNINFIAYPIKQD--VADSWIKEANQIRLLVLEYIKNICVKIRMTLSS 224


>gi|254562029|ref|YP_003069124.1| hypothetical protein METDI3633 [Methylobacterium extorquens DM4]
 gi|254269307|emb|CAX25273.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 234

 Score =  231 bits (590), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 58/180 (32%), Positives = 94/180 (52%), Gaps = 1/180 (0%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQK 82
           +  V++   P    V  IV +TG   R+  A +LL    G ++ ISGV+   ++D +++ 
Sbjct: 37  VAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLISGVNERTTRDEIVRL 96

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
            P ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +YHMPRT +EL+   
Sbjct: 97  NPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSNYHMPRTLVELRHAL 156

Query: 143 ST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                 IPYP++S  L+ +       + R+L  EYLK L+   +    +      F  LI
Sbjct: 157 KDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTRFESDPEQSRFAVLI 216


>gi|188582230|ref|YP_001925675.1| hypothetical protein Mpop_2985 [Methylobacterium populi BJ001]
 gi|179345728|gb|ACB81140.1| protein of unknown function DUF218 [Methylobacterium populi BJ001]
          Length = 234

 Score =  231 bits (590), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 91/180 (50%), Gaps = 1/180 (0%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQK 82
           +  V+Q   P    +  IV +TG   R+  A +LL    G+++ ISGV+   ++D +++ 
Sbjct: 37  VAVVEQAERPSLDGIDGIVAMTGGSQRVGDAIDLLAEGHGKRLLISGVNERTTRDEIVRL 96

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
            P ++    CC+D+ Y+A NT GNA E   W  ++ F  + +VT  YHMPRT +EL+   
Sbjct: 97  NPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHGFTAIAVVTSSYHMPRTLVELRHAL 156

Query: 143 ST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                 IPYP++S  L+         ++R+L  EYLK L+   +           F  LI
Sbjct: 157 RDGETLIPYPVVSDGLDLGRWWADPAVMRLLGAEYLKFLVAWGRTRFEADPEQSRFAVLI 216


>gi|115526818|ref|YP_783729.1| hypothetical protein RPE_4830 [Rhodopseudomonas palustris BisA53]
 gi|115520765|gb|ABJ08749.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisA53]
          Length = 233

 Score =  230 bits (588), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 84/167 (50%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKI 83
             ++   +    +   IVVLTG   R+  A ELL +  G+++ ISGVH +     + + +
Sbjct: 40  AQLRGAEVRPGRNADGIVVLTGGSSRVSDAIELLSSGYGKRLLISGVHRTNGVHDISRTV 99

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
           P      +CCID+   A+NT  NA EA  WA +  F  +++VT +YHMPR  +E+     
Sbjct: 100 PDSHRWLDCCIDLDRSAINTRSNAAEARRWAHERGFRSLIVVTSNYHMPRAIVEMSHAMP 159

Query: 144 TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            V+ IP+ ++     +          R+LL EY K L    ++ L++
Sbjct: 160 DVELIPFAVVGDKWRDEPWWSSGTTFRLLLSEYAKYLAAETRVRLAS 206


>gi|296447118|ref|ZP_06889050.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
 gi|296255387|gb|EFH02482.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
          Length = 232

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 96/187 (51%), Gaps = 6/187 (3%)

Query: 8   LFVCLIFF-----IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           L +CL  F     + GFI F   +++           +VVLTG   RI  A ELL     
Sbjct: 22  LLLCLAGFLASGFVAGFIGFALSLERAEPILTVQADGVVVLTGGSDRIHEAAELLARGQA 81

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF-HH 121
            ++ I+GV+ S     + + +P+ + L +CCID+GY+AL+T GNA E   WA+       
Sbjct: 82  RRLLITGVNKSTRGPEIAKLLPVSRQLFDCCIDLGYEALDTAGNAAETREWAKARGIGGS 141

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +++VT +YHMPR  +EL      V+  P+P++S  ++    +    + R++  EY+K L 
Sbjct: 142 LIVVTSNYHMPRALVELSAALPGVELYPFPVVSEHMQVADWLDDASVARLIGGEYVKYLF 201

Query: 182 LSIQLSL 188
              +  L
Sbjct: 202 ALARTRL 208


>gi|154252045|ref|YP_001412869.1| hypothetical protein Plav_1593 [Parvibaculum lavamentivorans DS-1]
 gi|154155995|gb|ABS63212.1| protein of unknown function DUF218 [Parvibaculum lavamentivorans
           DS-1]
          Length = 208

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 58/181 (32%), Positives = 91/181 (50%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R       +    ++ GF  F   ++++     P    IV LTG P RI  A++LL+  
Sbjct: 16  LRILVGFTALLAAAYVAGFFLFTAELERIPPVRVPVADGIVALTGGPDRITAAYKLLQEG 75

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ I+GVH  VS   L + +P      +CC+D+G+ A NT GNA E + W  + N+ 
Sbjct: 76  KGNRLLITGVHPDVSVASLKEMVPGGSAKFDCCVDLGHMAENTIGNATETAEWVRERNYR 135

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +++VT  YH+PR  LEL R    V+   +P+    L  +         R+L+ EY K L
Sbjct: 136 SIILVTSTYHLPRARLELARAMPDVEISAFPVFQDTLHLDGWWAYPGTTRLLISEYTKYL 195

Query: 181 L 181
           L
Sbjct: 196 L 196


>gi|118591370|ref|ZP_01548768.1| hypothetical protein SIAM614_27023 [Stappia aggregata IAM 12614]
 gi|118436042|gb|EAV42685.1| hypothetical protein SIAM614_27023 [Stappia aggregata IAM 12614]
          Length = 241

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 61/189 (32%), Positives = 95/189 (50%), Gaps = 1/189 (0%)

Query: 1   MRYFWYGLFVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           +R  +  +   L+    G F  F + V    +P   +  AIVVLTG   R+  A  LLE 
Sbjct: 49  LRVLFVAVVTALLAGTAGQFAMFAQKVANARVPATANADAIVVLTGGHARVNEAVRLLEE 108

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
               ++ ISGVH   +++ L         L    +D+   ALNT GNA E + W  KN F
Sbjct: 109 GRANRLLISGVHPGTTREQLAAVTASNMPLETNSVDLDRVALNTAGNAVETANWVRKNGF 168

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             +L+VT  YH+PR  +EL      V  I YP+ S DL+ +    +   +R+L+ EY+K 
Sbjct: 169 SSLLVVTSAYHLPRAKVELAGALPDVSLIAYPVFSKDLKLDHWYREPATMRLLMREYVKY 228

Query: 180 LLLSIQLSL 188
           +L  +++++
Sbjct: 229 ILARLRITV 237


>gi|167647181|ref|YP_001684844.1| hypothetical protein Caul_3219 [Caulobacter sp. K31]
 gi|167349611|gb|ABZ72346.1| protein of unknown function DUF218 [Caulobacter sp. K31]
          Length = 207

 Score =  228 bits (582), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 59/184 (32%), Positives = 98/184 (53%), Gaps = 2/184 (1%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPI-RIERAFELLENQIGEK 64
            L + ++ + +G ++F   V Q     + P    +VVLTG    R+E A +LLE   G++
Sbjct: 6   ALLIVVMVWFVGLLAFTSRVDQSTPALEPPVSDGVVVLTGASNVRLEVATKLLEAGKGKR 65

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+   S++ +L      + + ECC+D+GY A +T GNA E + WA   ++  +++
Sbjct: 66  LLISGVNREASREDVLGVTKAVRPIYECCVDLGYAAADTIGNASETAEWARAKDYRSLIV 125

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT DYHMPR+ LEL      V   PYP+++  L  +         R + +EY K L +  
Sbjct: 126 VTADYHMPRSMLELHASMPGVTLHPYPVVTESLNAHRWWQGGTSARRMTVEYCKYLAILG 185

Query: 185 QLSL 188
           + + 
Sbjct: 186 REAF 189


>gi|154243978|ref|YP_001414936.1| hypothetical protein Xaut_0020 [Xanthobacter autotrophicus Py2]
 gi|154158063|gb|ABS65279.1| protein of unknown function DUF218 [Xanthobacter autotrophicus Py2]
          Length = 300

 Score =  228 bits (581), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 61/175 (34%), Positives = 99/175 (56%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F++F   +            AIVVLTG P RI  A  LL +  G ++ I+GV+ + S D 
Sbjct: 84  FLAFTAQIAAREPAAVKPADAIVVLTGGPSRIVDAVGLLADGRGRRLLITGVNPTTSMDE 143

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + + +P  + L  CCID+G+KALNT GNA EA+ WA +  F  +++VT  +HMPR  +EL
Sbjct: 144 MRRALPDGEHLLGCCIDLGHKALNTRGNALEAAEWAREKRFRSLVVVTSSWHMPRAMMEL 203

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTA 193
            R    V+ + YP+++   +  S       L++L+ EYLK ++ ++++  +   A
Sbjct: 204 GRALPDVELVSYPVVTTRTQPESWWSDPGTLKLLVKEYLKFIMATVKIRPAQAVA 258


>gi|295690243|ref|YP_003593936.1| hypothetical protein Cseg_2870 [Caulobacter segnis ATCC 21756]
 gi|295432146|gb|ADG11318.1| protein of unknown function DUF218 [Caulobacter segnis ATCC 21756]
          Length = 205

 Score =  226 bits (577), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 95/184 (51%), Gaps = 3/184 (1%)

Query: 7   GLFVCLIFFIMGFISFIRYVK-QMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEK 64
            L + L+ + +G ++F   V      P+ P    +V LTG    R+E A  LLE   G++
Sbjct: 6   ALLIALMIWGLGLVAFTGRVDLSTPAPEPPEADGVVALTGASSLRLEAATRLLEEGKGKR 65

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+   ++  +       + + +CC+D+G+ A NT GNA E + WA    +  +++
Sbjct: 66  LLISGVNRETTRADVQSVTKAVKPIYDCCVDLGFTAANTVGNALETAEWARSKGYKSLIV 125

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT DYHMPR+ LEL      V+  PYP+ + DL  +         R +++EY K L +  
Sbjct: 126 VTADYHMPRSMLELSAAMPGVKLFPYPVKT-DLNAHRWWKTSISARRMIVEYCKYLAILG 184

Query: 185 QLSL 188
           + + 
Sbjct: 185 REAF 188


>gi|329847903|ref|ZP_08262931.1| hypothetical protein ABI_09720 [Asticcacaulis biprosthecum C19]
 gi|328842966|gb|EGF92535.1| hypothetical protein ABI_09720 [Asticcacaulis biprosthecum C19]
          Length = 220

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 64/191 (33%), Positives = 101/191 (52%), Gaps = 3/191 (1%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP--SVSAIVVLTGEPI-RIERAFELLEN 59
                  V ++ +  G + F   V +      P     AIVVLTG    R++    LLE 
Sbjct: 2   RSLIAFLVVVLLWAAGLLVFADRVIESTPAIEPEEPADAIVVLTGASDMRLKEGMRLLER 61

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           + GE++FISGV+  V +  L+      + L ECC+D+GY+A NT  NA+E + WA  ++F
Sbjct: 62  RKGERLFISGVNRDVKRPELMDVTEGSKRLYECCVDLGYQAENTVQNAREIAEWARGHDF 121

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             +++VT DYHMPR+ LEL+       FI YP+ + DL         K  R++++EY K 
Sbjct: 122 DTLIVVTSDYHMPRSLLELKADMPDAHFISYPVPTADLSARDWWKSGKGARLIVLEYCKY 181

Query: 180 LLLSIQLSLST 190
           L +  + ++ +
Sbjct: 182 LAILGRDAVLS 192


>gi|163844017|ref|YP_001628421.1| hypothetical protein BSUIS_A1836 [Brucella suis ATCC 23445]
 gi|163674740|gb|ABY38851.1| protein of unknown function DUF218 [Brucella suis ATCC 23445]
          Length = 177

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 63/163 (38%), Positives = 98/163 (60%), Gaps = 1/163 (0%)

Query: 28  QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ 87
           Q  +   P   AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     +
Sbjct: 2   QPPVLSEP-AEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADK 60

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            L  CCID+   ALNT GNA E+  W   NN+H V++VT++YH+PR+ LE+      V+F
Sbjct: 61  SLFACCIDLDRTALNTVGNAAESERWIRANNYHRVIVVTNNYHIPRSILEMSSRMKDVEF 120

Query: 148 IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           IPYP+++ +  E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 121 IPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|306837606|ref|ZP_07470477.1| Hypothetical protein BROD_0407 [Brucella sp. NF 2653]
 gi|306407313|gb|EFM63521.1| Hypothetical protein BROD_0407 [Brucella sp. NF 2653]
          Length = 177

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 61/163 (37%), Positives = 98/163 (60%), Gaps = 1/163 (0%)

Query: 28  QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ 87
           Q  +   P   AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     +
Sbjct: 2   QPPVLSEP-AEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADK 60

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            L  CCID+   ALNT GNA E+  W   N++H V++VT++YH+PR+ LE+      V+F
Sbjct: 61  SLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEF 120

Query: 148 IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           IPYP+++ +  E S + +   LRVL  EY+K L   +++  ++
Sbjct: 121 IPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRVGSAS 163


>gi|161619913|ref|YP_001593800.1| hypothetical protein BCAN_A2041 [Brucella canis ATCC 23365]
 gi|225853431|ref|YP_002733664.1| hypothetical protein BMEA_A2054 [Brucella melitensis ATCC 23457]
 gi|254690133|ref|ZP_05153387.1| hypothetical protein Babob68_08186 [Brucella abortus bv. 6 str.
           870]
 gi|254694623|ref|ZP_05156451.1| hypothetical protein Babob3T_08184 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696248|ref|ZP_05158076.1| hypothetical protein Babob28_00674 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700633|ref|ZP_05162461.1| hypothetical protein Bsuib55_07228 [Brucella suis bv. 5 str. 513]
 gi|254707480|ref|ZP_05169308.1| hypothetical protein BpinM_11037 [Brucella pinnipedialis
           M163/99/10]
 gi|254708978|ref|ZP_05170789.1| hypothetical protein BpinB_01690 [Brucella pinnipedialis B2/94]
 gi|254713593|ref|ZP_05175404.1| hypothetical protein BcetM6_09616 [Brucella ceti M644/93/1]
 gi|254716053|ref|ZP_05177864.1| hypothetical protein BcetM_06394 [Brucella ceti M13/05/1]
 gi|254731166|ref|ZP_05189744.1| hypothetical protein Babob42_08216 [Brucella abortus bv. 4 str.
           292]
 gi|256030505|ref|ZP_05444119.1| hypothetical protein BpinM2_07627 [Brucella pinnipedialis
           M292/94/1]
 gi|256045596|ref|ZP_05448476.1| hypothetical protein Bmelb1R_13928 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256158491|ref|ZP_05456389.1| hypothetical protein BcetM4_06532 [Brucella ceti M490/95/1]
 gi|256253910|ref|ZP_05459446.1| hypothetical protein BcetB_06374 [Brucella ceti B1/94]
 gi|256258387|ref|ZP_05463923.1| hypothetical protein Babob9C_13798 [Brucella abortus bv. 9 str.
           C68]
 gi|161336724|gb|ABX63029.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|225641796|gb|ACO01710.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|326409995|gb|ADZ67060.1| conserved hypothetical protein [Brucella melitensis M28]
          Length = 177

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 98/163 (60%), Gaps = 1/163 (0%)

Query: 28  QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ 87
           Q  +   P   AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     +
Sbjct: 2   QPPVLSEP-AEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADK 60

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            L  CCID+   ALNT GNA E+  W   N++H V++VT++YH+PR+ LE+      V+F
Sbjct: 61  SLFACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEF 120

Query: 148 IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           IPYP+++ +  E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 121 IPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|121602686|ref|YP_988436.1| hypothetical protein BARBAKC583_0098 [Bartonella bacilliformis
           KC583]
 gi|120614863|gb|ABM45464.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 202

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 65/188 (34%), Positives = 108/188 (57%), Gaps = 5/188 (2%)

Query: 6   YGLFVCLIFFIMG--FISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIG 62
               +  +F IMG  F+ F   V+Q++ P       AI+VLTG   RIE    LL+  +G
Sbjct: 14  VAFCLLSLFLIMGTHFVIFSEKVEQLYPPVSLSKADAIIVLTGGERRIETGLRLLKQGLG 73

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++ ISGV+ +     LL+ + I   L ECC+D+GY+A NT+ NA+E++ W +K+++  +
Sbjct: 74  SRLLISGVNATFHPKRLLRNMHIDPQLFECCVDLGYQATNTKSNAEESAVWIKKHHYKTL 133

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
            IVTHDYH+ R+ LEL+ +   + FI YPI  +  +    + ++  +R+L  EY+K +  
Sbjct: 134 YIVTHDYHIARSLLELRYLMPDINFIAYPIKENVTQNK--VKQLNKIRMLASEYIKNIGF 191

Query: 183 SIQLSLST 190
            I+    +
Sbjct: 192 QIRSVFQS 199


>gi|329890874|ref|ZP_08269217.1| hypothetical protein BDIM_25830 [Brevundimonas diminuta ATCC 11568]
 gi|328846175|gb|EGF95739.1| hypothetical protein BDIM_25830 [Brevundimonas diminuta ATCC 11568]
          Length = 218

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 62/191 (32%), Positives = 96/191 (50%), Gaps = 2/191 (1%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIVVLTG-EPIRIERAFELLENQI 61
           F   + V  + ++ G   F   V+     PD     AIV LTG    R+  A  LLE   
Sbjct: 3   FLTLIAVVALMWLTGLFVFAERVRGFTPAPDPARADAIVSLTGPSAERVNAAIRLLEQGK 62

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           G+++ ISGV+  V +  L    P    L  CC+D+G++A NT GNAQE +AWA    +  
Sbjct: 63  GDRLLISGVNREVRRQELRALTPGSSKLFNCCVDLGFEAENTVGNAQEIAAWARSKGYDD 122

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +++VT DYHMPR+ LE++     V+  PY + +  L+        +  R + +EY+K L 
Sbjct: 123 LIVVTSDYHMPRSLLEIRGAAPGVRLTPYAVSTPSLDNAGWWRATETARRMTLEYMKYLA 182

Query: 182 LSIQLSLSTQT 192
           +  +  +   T
Sbjct: 183 VLGREGMHRLT 193


>gi|16126457|ref|NP_421021.1| hypothetical protein CC_2218 [Caulobacter crescentus CB15]
 gi|221235238|ref|YP_002517674.1| hypothetical protein CCNA_02301 [Caulobacter crescentus NA1000]
 gi|13423723|gb|AAK24189.1| hypothetical protein CC_2218 [Caulobacter crescentus CB15]
 gi|220964410|gb|ACL95766.1| hypothetical protein CCNA_02301 [Caulobacter crescentus NA1000]
          Length = 205

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 59/201 (29%), Positives = 101/201 (50%), Gaps = 3/201 (1%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIVVLTGEPI-RIERAFELLENQIGEK 64
            L + L+ + +G ++F   V Q    P+ P    +V LTG    R+E A  LLE+  G++
Sbjct: 6   ALLIALMIWGLGLLAFTGRVDQSTPAPEPPISDGVVALTGASTLRLEAATRLLEDGKGQR 65

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+   ++  +       + + +CC+D+G+ A NT GNA+E + WA    +  +++
Sbjct: 66  LLISGVNREATRAEIQAVTKAVKPIYDCCVDLGFAAANTVGNARETAEWARSKGYKSLIV 125

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT DYHMPR+ LEL+     V   PYP+ + DL            R +++EY K L +  
Sbjct: 126 VTADYHMPRSMLELRAAMPNVVLHPYPVKT-DLNARRWWKTGVSARRMIVEYCKYLAILG 184

Query: 185 QLSLSTQTASQFFITLIEEIT 205
           + +              +E++
Sbjct: 185 REAFLGLGPEDKAAPAAKEVS 205


>gi|319409380|emb|CBI83024.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 225

 Score =  225 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 65/184 (35%), Positives = 110/184 (59%), Gaps = 3/184 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEK 64
             LF+ ++     F++F   ++ +  P+  P   AI+VLTG   RI+  F+LL+  +G +
Sbjct: 44  LALFITILLIGATFVTFSEKIEHLTPPNPLPQADAIIVLTGGENRIKTGFDLLQKGLGSR 103

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ ++  + L+    I   L    +D GY+A NT+GNA+E++AW +++N+  V I
Sbjct: 104 LLISGVNSTIDLNKLIDATYINPHLLVSRVDFGYEATNTKGNAEESAAWIKQHNYKTVYI 163

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VTHDYHM R+ LEL+ +   + FI YPI  +     S I +I  +R+L+ EY+K + + I
Sbjct: 164 VTHDYHMVRSLLELKYLMPHIDFIAYPIKENT--TGSWIKQINQMRILVSEYIKNIGVYI 221

Query: 185 QLSL 188
           + + 
Sbjct: 222 RTAF 225


>gi|254500805|ref|ZP_05112956.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436876|gb|EEE43555.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 243

 Score =  224 bits (571), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 60/187 (32%), Positives = 94/187 (50%), Gaps = 4/187 (2%)

Query: 8   LFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
           L  C+  F++G    F +F   V    +P      AIVVLTG   R+  A  LLE     
Sbjct: 55  LVACVTVFVVGTTIQFANFANRVSTATVPVSTQADAIVVLTGGQERVSEAVRLLEEGHAG 114

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ISGVH   ++  +       + L E  +++   ALNT GNA E + W  KN F  +L
Sbjct: 115 RLLISGVHPGTTRKQIAVVTASAKPLEEGSVELDRVALNTAGNATETANWVRKNGFDSLL 174

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT  YH+PR   EL      V  I YP+ + DL+  +   K   +R+L+ EY+K  +  
Sbjct: 175 VVTSAYHLPRATAELSGALPDVTLIGYPVFAKDLQLEAWHTKPATIRLLIREYVKYTVAR 234

Query: 184 IQLSLST 190
           +++++ +
Sbjct: 235 LRIAVRS 241


>gi|260169411|ref|ZP_05756222.1| hypothetical protein BruF5_13857 [Brucella sp. F5/99]
          Length = 177

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 61/163 (37%), Positives = 97/163 (59%), Gaps = 1/163 (0%)

Query: 28  QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ 87
           Q  +   P   AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     +
Sbjct: 2   QPPVLSEP-AEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADK 60

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            L  CCID+   ALNT GN  E+  W   N++H V++VT++YH+PR+ LE+      V+F
Sbjct: 61  SLFACCIDLDRTALNTVGNVAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEF 120

Query: 148 IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           IPYP+++ +  E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 121 IPYPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|300024263|ref|YP_003756874.1| hypothetical protein Hden_2757 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526084|gb|ADJ24553.1| protein of unknown function DUF218 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 214

 Score =  222 bits (565), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 90/172 (52%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
           + GF+ F   V +  +        IVVLTG  +R+E   +L+     +++ ISGV+  V 
Sbjct: 20  VFGFVLFSVTVTRDDVGGWDKADGIVVLTGGDLRVEAGAKLMNEGRAKRLLISGVNRKVR 79

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           ++ + + + +      CC+D+GY+AL+T GNA E   WA  N +  ++IVT  YHMPR+ 
Sbjct: 80  REEMQRLLGLDAKTFNCCVDLGYEALDTVGNADETRTWARNNGYTKLIIVTSRYHMPRSL 139

Query: 136 LELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            EL  +   V  IPYP+      E +        RVL+ EYLK L    +L+
Sbjct: 140 AELALVMPKVTLIPYPVTPRHFPETAWWLHSSTTRVLVSEYLKFLPAVARLA 191


>gi|328541756|ref|YP_004301865.1| hypothetical protein SL003B_0132 [polymorphum gilvum SL003B-26A1]
 gi|326411508|gb|ADZ68571.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 196

 Score =  220 bits (562), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 62/185 (33%), Positives = 105/185 (56%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
            +    + F+ F + V  +  P+  S   IVVLTG   RIERA  LL+ +   ++ ISGV
Sbjct: 12  LVAGLGISFLLFAQSVVSIRAPEEASADGIVVLTGGQDRIERAVGLLQEERARRLLISGV 71

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           + + +   ++++      L  CC+D+  KALNT GNA E +AWA  + F  +L+VT  YH
Sbjct: 72  YPATTDRQIVERTSGDLPLFRCCVDLDRKALNTVGNAVETAAWARTHGFSSLLLVTSAYH 131

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           +PR  LEL+ +   ++ +PYP+ + DL  +S   + + +R+LL E++K  L  +++    
Sbjct: 132 LPRAALELKAVMPELELVPYPVFAEDLMLSSWYRRPQTIRLLLREFVKYTLARLRIGTIG 191

Query: 191 QTASQ 195
             A++
Sbjct: 192 LPAAE 196


>gi|302384409|ref|YP_003820232.1| hypothetical protein Bresu_3303 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302195037|gb|ADL02609.1| protein of unknown function DUF218 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 208

 Score =  220 bits (561), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 62/190 (32%), Positives = 102/190 (53%), Gaps = 3/190 (1%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTG-EPIRIERAFELLE 58
           M++      V LI +++G  +F   V+ +   D P     IV LTG    R+  A  LLE
Sbjct: 1   MKFLALVGIVGLI-WLVGLFAFADRVRNLTPADEPARADGIVALTGPSAERVNAAVRLLE 59

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              GE++ ISGV+  V +  L +  P    L  CC+D+G++A +T GNAQE +AWA   N
Sbjct: 60  QDKGERVLISGVNREVRRQELRELTPGSNRLFNCCVDLGFEAEDTGGNAQEIAAWAGSKN 119

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  +++VT DYHMPR+ LE++     ++  PY + +  L+ +         R + +EY+K
Sbjct: 120 YTSLIVVTSDYHMPRSLLEIRSAAPGLELTPYAVSTPSLDNSRWWRAAVTARRMTLEYMK 179

Query: 179 ILLLSIQLSL 188
            L +  + ++
Sbjct: 180 YLAVLGREAV 189


>gi|114570926|ref|YP_757606.1| hypothetical protein Mmar10_2376 [Maricaulis maris MCS10]
 gi|114341388|gb|ABI66668.1| protein of unknown function DUF218 [Maricaulis maris MCS10]
          Length = 195

 Score =  218 bits (555), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 64/200 (32%), Positives = 107/200 (53%), Gaps = 10/200 (5%)

Query: 1   MRYFWYGL----FVCLIFFIMGFISFIRYVKQMHIPDHPSV-SAIVVLTGEPIRIERAFE 55
           M+  W  L    FV ++  ++GF ++   V    +P   +   AI+VLTG+  R+    E
Sbjct: 1   MKQSWLWLRGLCFVVVLASMIGFAAYAGKVTGYDLPATDNTVDAIIVLTGDAGRLSAGGE 60

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           LL++     + ISGVH SV+   + ++  +  D   CC+ +G +A +T GNA+EA+A+ +
Sbjct: 61  LLQDGRASHLMISGVHPSVTTADIRRQTGLGDDAFSCCVTLGREATDTVGNAREAAAYVQ 120

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            N +  ++IVT DYH+PR+ LE +     V  IPYP+ +           +  LR+ L E
Sbjct: 121 ANGYDRLIIVTSDYHLPRSLLEFRSHMPGVDLIPYPVRTQAP-----WQDVGALRLWLQE 175

Query: 176 YLKILLLSIQLSLSTQTASQ 195
           Y K   + ++ SL++QT   
Sbjct: 176 YAKYTTVQLRHSLTSQTEDA 195


>gi|298293358|ref|YP_003695297.1| hypothetical protein Snov_3404 [Starkeya novella DSM 506]
 gi|296929869|gb|ADH90678.1| protein of unknown function DUF218 [Starkeya novella DSM 506]
          Length = 228

 Score =  215 bits (549), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 60/197 (30%), Positives = 100/197 (50%), Gaps = 1/197 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R     L    +  + GF  F+  +K            IVVLTG   RI  A  LL   
Sbjct: 25  LRLGGVLLLAATVALLAGFGLFVAGIKGREAQTARRADGIVVLTGGAERITDATNLLVEG 84

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ I+GVH   +   + + +P  ++  ECC+++G  ALNT GNA E + WA ++ F 
Sbjct: 85  RGTRLLITGVHPDTTLAEIGRTVPATRESLECCVELGRAALNTRGNAIETAQWAREHRFR 144

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +L+VT  +HMPR  +EL+R    V+ +PYP++     EN     +  +R+L +EY+K +
Sbjct: 145 SLLVVTSAWHMPRALVELRRALPDVELVPYPVVPKRGPEN-WEASLANVRLLFVEYVKFI 203

Query: 181 LLSIQLSLSTQTASQFF 197
              + +    + ++Q  
Sbjct: 204 GAWLGVRSWPELSTQLG 220


>gi|323136484|ref|ZP_08071566.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
 gi|322398558|gb|EFY01078.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
          Length = 225

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 51/176 (28%), Positives = 97/176 (55%), Gaps = 1/176 (0%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           F+ G+++F   + +          A+V LTG   R+  A + L     +++ I+GV+ + 
Sbjct: 32  FVAGYVAFALSLARQEPILKVEAEAVVALTGGSDRVLDAADFLARGQAKRMLITGVNRAT 91

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF-HHVLIVTHDYHMPR 133
              +L + +P+ +DL  CC+D+GY+A++T GNA+E   WA+  N    +++VT +YHMPR
Sbjct: 92  RSSVLARILPVSRDLFNCCVDLGYQAMDTAGNARETREWAQSRNITRSLIVVTSNYHMPR 151

Query: 134 TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
             +EL      ++  P+P++S  ++       + + R++  EY+K L   ++  LS
Sbjct: 152 ALVELSAALPDIKLYPFPVVSEHVDVADWATDLGVARLVGSEYVKFLGALLRTRLS 207


>gi|46206241|ref|ZP_00047534.2| COG1434: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 178

 Score =  214 bits (545), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 84/160 (52%), Gaps = 1/160 (0%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           +TG   RI  A +LL    G+++ ISGV+   +++ +++  P ++    CC+D+ Y+A N
Sbjct: 1   MTGGAQRIGDAIDLLAGGRGKRLLISGVNERTTREEIIRLNPAQEQWISCCVDLDYRARN 60

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN-STVQFIPYPIISHDLEENS 161
           T GNA E   W  ++ F  V +VT  YHMPRT +EL+    +    IPYP+++  LE   
Sbjct: 61  TIGNAIETRRWMRRHRFGTVAVVTSSYHMPRTLVELRHALNAGETVIPYPVVTEGLEIER 120

Query: 162 SIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                   R+L  EYLK L+  ++    T      F  LI
Sbjct: 121 WWADPAATRLLGAEYLKFLVAWLRTRFETDPEQSRFAVLI 160


>gi|306842871|ref|ZP_07475508.1| Hypothetical protein BIBO2_2646 [Brucella sp. BO2]
 gi|306286958|gb|EFM58475.1| Hypothetical protein BIBO2_2646 [Brucella sp. BO2]
          Length = 162

 Score =  213 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 54/148 (36%), Positives = 91/148 (61%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           +TG   R++    LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALN
Sbjct: 1   MTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALN 60

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           T GNA E+  W   N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S 
Sbjct: 61  TVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSW 120

Query: 163 IFKIKILRVLLIEYLKILLLSIQLSLST 190
           + +   LRVL  EY+K L   +++  ++
Sbjct: 121 VAEGDTLRVLFTEYVKYLGAIVRVGSAS 148


>gi|90420238|ref|ZP_01228146.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335572|gb|EAS49322.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 244

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 66/192 (34%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 2   RYFWYGLFVCLIF---FIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELL 57
           R     + V ++       GF+ F   V  +  P    +   IVVLTG  +RI++A +LL
Sbjct: 37  RLCLAAVLVGVLLGGYLAGGFVRFAEEVSLLAKPAPIGAADGIVVLTGGALRIDQAIDLL 96

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +   G ++ ISGV+   S   L +     +DL  CC+D+ Y ALNT GNA+ A  WA + 
Sbjct: 97  KEGRGRRLLISGVNPGTSAATLARMTDTDRDLFACCVDLDYAALNTVGNAEIARNWAREQ 156

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            F  +++VT DYHMPR+  E  RI       PY +   DL     +     LRVLL EY 
Sbjct: 157 GFRDLILVTSDYHMPRSLREFDRIGELRSVTPYAVRRDDLWSAELMPNTAGLRVLLTEYA 216

Query: 178 KILLLSIQLSLS 189
           K++   ++L   
Sbjct: 217 KLIAARVRLVFG 228


>gi|288962085|ref|YP_003452380.1| hypothetical protein AZL_d00100 [Azospirillum sp. B510]
 gi|288914351|dbj|BAI75836.1| hypothetical protein AZL_d00100 [Azospirillum sp. B510]
          Length = 213

 Score =  211 bits (538), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 81/169 (47%), Gaps = 3/169 (1%)

Query: 20  ISFIRYVKQMHI---PDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSK 76
             +   + +             AIVVLTG   R+    ELL     +K+F+SGV+  V  
Sbjct: 36  FWYAADIPRSSPTGAEAERLTDAIVVLTGGRNRLSTGLELLAAGRAKKLFVSGVYDGVEV 95

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             LL+         ECCI +GY A +T GNA E + W     FH + +VT +YHM R+ L
Sbjct: 96  QELLKLSRHSPTEMECCITLGYSADSTIGNAYETADWMHDQGFHSLRLVTANYHMRRSLL 155

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           EL      V  +P+P+++  +  +          +L+ EY K+L++ ++
Sbjct: 156 ELSMAMPDVDLLPHPVVAPTVHLDDWWMWPGTANLLVTEYNKLLVVGLR 204


>gi|144898927|emb|CAM75791.1| Protein of unknown function DUF218 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 202

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 83/186 (44%), Gaps = 1/186 (0%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L      +  GF+ F+  V +          AIVVLTG   R+    +LLE  + +++FI
Sbjct: 16  LVALAALWSGGFLWFVDEVPRAVDDQTSHTDAIVVLTGGRERLTTGLDLLEAGLSQRLFI 75

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGV+  V    ++Q       L E  + +GY A +T GNA E + WA ++N   + IVT 
Sbjct: 76  SGVYKGVDLAEIIQLGRGHAGLKEAVV-LGYAADDTVGNAIETALWATEHNLRSLRIVTG 134

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            YHMPR   E +     +  I +P+    ++            +L  EY K L   I+  
Sbjct: 135 AYHMPRALAEFRHALPEITLIAHPVFPDQVKSREWWRWPGTAALLATEYSKYLAAIIRHW 194

Query: 188 LSTQTA 193
              + A
Sbjct: 195 FLPRKA 200


>gi|312116073|ref|YP_004013669.1| hypothetical protein Rvan_3387 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221202|gb|ADP72570.1| protein of unknown function DUF218 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 197

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 87/193 (45%), Gaps = 6/193 (3%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
           + GF  F   V  M         AIV LTG+  RI  A  LL      ++ ISGVH +  
Sbjct: 1   MCGFFIFAYSVSIMPSTRLKDADAIVALTGDEERIAAAVRLLSEGKARRLLISGVHKTTR 60

Query: 76  KDILLQKIPIRQD----LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHM 131
              ++     R      L  CC+D+   A NTE NA E + W  K  +  +++VT  YHM
Sbjct: 61  APQIMSLTTSRGSRSWSLFSCCVDLD-NAHNTEANAAETTNWVRKRGYRSIIVVTSTYHM 119

Query: 132 PRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQ 191
           PR  +EL +    V+ +PYP+ +  L+E       +   VL  EY+K +    +   ++ 
Sbjct: 120 PRALIELHQAMRDVELVPYPVRAPRLDER-WWRDSRTAWVLWKEYMKYITAMARYGANSI 178

Query: 192 TASQFFITLIEEI 204
           + +   +    ++
Sbjct: 179 SNASARVEHEPQL 191


>gi|315500246|ref|YP_004089049.1| hypothetical protein Astex_3264 [Asticcacaulis excentricus CB 48]
 gi|315418258|gb|ADU14898.1| protein of unknown function DUF218 [Asticcacaulis excentricus CB
           48]
          Length = 214

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 65/197 (32%), Positives = 103/197 (52%), Gaps = 4/197 (2%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGEPI-RIERAFELL 57
           MR     + + +  ++ G  +F   V        P  +A  IVVLTG    RI+    LL
Sbjct: 1   MRRL-LAVVLVIGLWLAGLYAFADRVIHSTPAAEPEEAADAIVVLTGASDMRIKEGMRLL 59

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           E + G ++ ISGV+  V ++ LL      + L ECC+D+GY+A  T GNA E + WA+  
Sbjct: 60  ERRKGARMLISGVNREVKREELLPVTEGSKKLYECCVDLGYEAQTTLGNAYEVAEWAKAK 119

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            F  +++VT DYH+PR+ LE++     V+   YP+ +  L+        +  RVL++EY 
Sbjct: 120 GFDDLIVVTSDYHVPRSLLEIKAALPGVKLHAYPVATPTLDAREWWKSWRSSRVLIVEYS 179

Query: 178 KILLLSIQLSLSTQTAS 194
           K L +  +   S+ T+S
Sbjct: 180 KYLAILARDIFSSLTSS 196


>gi|83859181|ref|ZP_00952702.1| hypothetical protein OA2633_12290 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852628|gb|EAP90481.1| hypothetical protein OA2633_12290 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 191

 Score =  207 bits (527), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 61/189 (32%), Positives = 93/189 (49%), Gaps = 5/189 (2%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           R+     F+ L  F++GF  F+R  +           AIVVLTG P R+  A  LL++  
Sbjct: 7   RFLRLTAFILLTAFVVGFALFVRQARTFTPDASVRGQAIVVLTGGPNRVSTAAALLQDGS 66

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           G ++ ISGV+       +       Q L ECC+D G +A +T GNA E +AWA ++ +  
Sbjct: 67  GRRLLISGVNPDSPPADIAAAAGASQALFECCVDFGLQAADTIGNAAETAAWARQHGYDR 126

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +++VT DYHMPR  LELQ     V+ + Y + +               R  L+EY+K   
Sbjct: 127 IIVVTSDYHMPRALLELQAAMPDVRLVAYGVPAPAP-----WSGGHEARRWLVEYVKYAA 181

Query: 182 LSIQLSLST 190
           +  +  + T
Sbjct: 182 VYGRERVRT 190


>gi|197104094|ref|YP_002129471.1| hypothetical protein PHZ_c0628 [Phenylobacterium zucineum HLK1]
 gi|196477514|gb|ACG77042.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 211

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 94/187 (50%), Gaps = 5/187 (2%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPI--RIERAFELLENQIGE 63
              V  + +  G  ++   V+Q       P    IV LTG     RI  A  LLE+  G 
Sbjct: 6   AFLVLALIWFAGLFAYAHRVQQSTPARLPPPADGIVALTGAGSKERIAAAIGLLEDGYGR 65

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ +SGV+   S++ +       + L +CC+D+G+ A +T GNA+E + W E   +  + 
Sbjct: 66  RVLVSGVNPEASREDIRNLSRAVRRLYDCCVDLGFTAADTVGNARETAEWTEAMRYRSLT 125

Query: 124 IVTHDYHMPRTFLELQRINS--TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           IVT DYHMPR  LEL+ +     V+   Y + +  L+ +    + +  R++++EY K L 
Sbjct: 126 IVTADYHMPRAMLELRAVFHGTGVRLSTYAVPTPALKSSHWWRQPRAARLMVVEYCKYLA 185

Query: 182 LSIQLSL 188
           +  + ++
Sbjct: 186 ILGREAV 192


>gi|83594586|ref|YP_428338.1| hypothetical protein Rru_A3256 [Rhodospirillum rubrum ATCC 11170]
 gi|83577500|gb|ABC24051.1| Protein of unknown function DUF218 [Rhodospirillum rubrum ATCC
           11170]
          Length = 226

 Score =  204 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 55/200 (27%), Positives = 89/200 (44%), Gaps = 1/200 (0%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERAFELLENQ 60
           R            ++ G   F   V    I D   +  AIVVLTG   R+    +LL   
Sbjct: 6   RRLGLLALTAFGLWLAGLALFASTVLPSAIEDDQTTTDAIVVLTGGSERLPVGLDLLARG 65

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           +G K+F+SGV   V+ D L   I    +     + +G+ AL+T GNA+E + W    +F 
Sbjct: 66  LGRKLFLSGVGVEVTLDDLRAAIVDVPENLRSRVVLGHAALDTVGNAEETAHWLATEHFT 125

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            + +VT  YHMPR+ +E +     V+ I +P+    +++          R++  EY K L
Sbjct: 126 SLRLVTAAYHMPRSLVEFRAAMPDVRIIAHPVFPGSVKQQEWWMWKGTARLMAEEYSKFL 185

Query: 181 LLSIQLSLSTQTASQFFITL 200
           +  ++ +LS          L
Sbjct: 186 VAWLRRTLSPVNVEALAAPL 205


>gi|163793809|ref|ZP_02187783.1| hypothetical protein BAL199_12291 [alpha proteobacterium BAL199]
 gi|159180920|gb|EDP65437.1| hypothetical protein BAL199_12291 [alpha proteobacterium BAL199]
          Length = 231

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 91/194 (46%), Gaps = 6/194 (3%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           +      + +G + +   +        P+  A+VVLTG   R++    LL       +F+
Sbjct: 27  VLSLATAWTIGLVRYASRIPTQPTLVEPAA-AVVVLTGGSKRMDAGVALLAKGTAPVLFV 85

Query: 68  SGVHHSVSKDILLQKIP-----IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           SGV H V    +   IP     + Q   +CC+ +GY A +T GNA+E + WA       +
Sbjct: 86  SGVDHRVDPARIRDLIPDAGDSLDQATIDCCVVLGYGASDTLGNARETALWARATERTSL 145

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT +YHMPR  LE       V+ +PYP+I  D+  ++       L ++  E+ K +  
Sbjct: 146 ILVTSNYHMPRARLEFTHALPEVRLVPYPVIPPDVRMDAWWRWPGTLGLVAGEWTKYVFA 205

Query: 183 SIQLSLSTQTASQF 196
            +++ L+   +S  
Sbjct: 206 RVRIGLADLVSSAA 219


>gi|83313543|ref|YP_423807.1| hypothetical protein amb4444 [Magnetospirillum magneticum AMB-1]
 gi|82948384|dbj|BAE53248.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 206

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 77/164 (46%)

Query: 22  FIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQ 81
           F   +            A+VVLTG   R+     LLE   G K+F+SGVH  V    LL+
Sbjct: 31  FAADLAIRVEDQSTVTDAVVVLTGGAERLNSGIALLEAGRGRKLFVSGVHRGVDLPDLLR 90

Query: 82  KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
           +  +  + A CCI +G+ A +T GNA E +AW  +  F  + +VT  YHM R+ LEL+R 
Sbjct: 91  QAHVSPERARCCIVLGHAADDTVGNATETAAWMGREGFSSLRLVTAAYHMRRSLLELRRA 150

Query: 142 NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
                 I +P+     + +          +L +EY K L    +
Sbjct: 151 LPDATIIAHPVFPDAFKRDQWWRWPGTAHLLAVEYTKYLAALAR 194


>gi|114705471|ref|ZP_01438379.1| hypothetical protein FP2506_11041 [Fulvimarina pelagi HTCC2506]
 gi|114540256|gb|EAU43376.1| hypothetical protein FP2506_11041 [Fulvimarina pelagi HTCC2506]
          Length = 234

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 66/193 (34%), Positives = 106/193 (54%), Gaps = 6/193 (3%)

Query: 2   RYFWYGLFVCLIFFIMGFIS--FIRYVKQM----HIPDHPSVSAIVVLTGEPIRIERAFE 55
           R   + +   ++    GFI   F+RY +       + + P   AIVVLTG   RIERA  
Sbjct: 26  RKRRFAILCLVVLVAGGFIVGSFLRYAETTAAVSRLENVPPADAIVVLTGGANRIERAIS 85

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           LL+N  G+++ ISGV+ + S   + +      DL ECC+DI   AL+T GNA EA  WA 
Sbjct: 86  LLKNGYGKRLLISGVNENTSARAIARATNTDLDLFECCVDIDVAALDTVGNAMEAVRWAA 145

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           +N F  +++VT DYHM R+ +E  R+    +  P  +   +L ++ +I   + L VL++E
Sbjct: 146 ENGFDELILVTSDYHMQRSLIEFDRVGDLDRITPVAVRLDELWQDDTIPTRRGLEVLVME 205

Query: 176 YLKILLLSIQLSL 188
           Y K++   ++ ++
Sbjct: 206 YAKLMAARVRAAI 218


>gi|258542112|ref|YP_003187545.1| hypothetical protein APA01_10160 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633190|dbj|BAH99165.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636247|dbj|BAI02216.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639302|dbj|BAI05264.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642356|dbj|BAI08311.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645411|dbj|BAI11359.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648466|dbj|BAI14407.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651519|dbj|BAI17453.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654510|dbj|BAI20437.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 194

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 62/183 (33%), Positives = 87/183 (47%), Gaps = 8/183 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLEN 59
           +R  +  + +    F  GF  F+     +  P + P    IV LTG   RI+ +  LL  
Sbjct: 4   IRLSFRLILLACFAFAGGFGWFVN--DALRPPGYLPHADGIVALTGGAGRIDTSLNLLAR 61

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GEK+ ISGV    +   LL        LAE  I +GY+A +T GNA E + W   N+ 
Sbjct: 62  NQGEKLLISGVDTQTTLGELLPPT-APPALAER-ITLGYQARSTIGNATETAVWVADNHI 119

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             +++VT  YHM R  LEL R    V   PYP++   +E      +   LR+L +EYLK 
Sbjct: 120 TSLIVVTASYHMRRALLELSRTLPDVTLYPYPVLPPAMEHP---LRRSSLRLLALEYLKW 176

Query: 180 LLL 182
           L  
Sbjct: 177 LGA 179


>gi|294010104|ref|YP_003543564.1| hypothetical protein SJA_C1-01180 [Sphingobium japonicum UT26S]
 gi|292673434|dbj|BAI94952.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 176

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 89/180 (49%), Gaps = 14/180 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             + V L+ +++GF  F  ++ Q    D     AIVVLTG   RI+R   LL++   +++
Sbjct: 4   RFIAVTLLGWMLGFAWFAIFLPQ--PLDGRQTDAIVVLTGGAGRIDRGLALLQDGAAKRM 61

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV  SV    L  +  + + L  CCI +G +A++T  NA E + W E+ +F  V ++
Sbjct: 62  LISGVDRSVRPVELAAQYKVPERLFSCCITLGREAIDTRSNAIETAHWLERRDFKTVRLI 121

Query: 126 THDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           T D+HM R+ LEL++     V  +   + S              L +L  EY K LL   
Sbjct: 122 TTDWHMRRSALELRQALPERVTLVYDAVPSR-----------PSLTMLAREYNKYLLRRA 170


>gi|307293520|ref|ZP_07573364.1| protein of unknown function DUF218 [Sphingobium chlorophenolicum
           L-1]
 gi|306879671|gb|EFN10888.1| protein of unknown function DUF218 [Sphingobium chlorophenolicum
           L-1]
          Length = 176

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 56/180 (31%), Positives = 88/180 (48%), Gaps = 14/180 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             + + L+ +++GF  F   + Q    D     AIVVLTG   RI+R   LL++   +++
Sbjct: 4   RFIALTLLAWMLGFAWFAILLPQ--PLDGRQTDAIVVLTGGAGRIDRGLSLLQDGAAKRM 61

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV  SV    L  +    + L  CCI +G +A++T  NA E + W E+ +F  V ++
Sbjct: 62  LISGVDRSVRPAELAAQYDAPERLFACCITLGREAIDTRSNAIETAHWLERRDFKTVRLI 121

Query: 126 THDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           T D+HM R+ LEL++     V  +   + S              L +L+ EY K LL   
Sbjct: 122 TTDWHMRRSALELRQALPGRVTLVYDAVPSR-----------PSLMMLVREYNKYLLRRA 170


>gi|94497844|ref|ZP_01304410.1| hypothetical protein SKA58_17288 [Sphingomonas sp. SKA58]
 gi|94422733|gb|EAT07768.1| hypothetical protein SKA58_17288 [Sphingomonas sp. SKA58]
          Length = 176

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 56/180 (31%), Positives = 87/180 (48%), Gaps = 14/180 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
               + L+ +++GF  F  ++      D     AIVVLTG P RI+R   L++     ++
Sbjct: 4   RLAALALLGWVLGFAWFAIFLP--EPLDGRRTDAIVVLTGGPGRIDRGIALMQQGAARRM 61

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV  SV    L  +    + L +CCI +G +A++T  N  E + W  + ++  V +V
Sbjct: 62  LISGVDRSVRPGELAAQYDAPEALFDCCITLGREAIDTRSNGLETARWLARRDYQTVRLV 121

Query: 126 THDYHMPRTFLEL-QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           T D+HM R+ LEL Q +   +  +   + SH             L VL+ EY K LL  I
Sbjct: 122 TTDWHMRRSALELTQALPPRIHIVYDAVPSH-----------PSLSVLMREYNKYLLRRI 170


>gi|329114135|ref|ZP_08242897.1| Hypothetical protein APO_0915 [Acetobacter pomorum DM001]
 gi|326696211|gb|EGE47890.1| Hypothetical protein APO_0915 [Acetobacter pomorum DM001]
          Length = 216

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 82/171 (47%), Gaps = 8/171 (4%)

Query: 13  IFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVH 71
             F  GF  F+     +  P + P    IV LTG   RI+ +  LL    GE++ ISGV 
Sbjct: 38  FAFAGGFGWFVN--DALRPPGYLPHADGIVALTGGAGRIDTSLNLLARNQGERLLISGVD 95

Query: 72  HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHM 131
              +   LL        LAE  I +GY+A +T GNA E + W   N+   +++VT  YHM
Sbjct: 96  TQTTLAALLPST-APPALAER-ITLGYQARSTIGNATETAVWVADNHITSLIVVTASYHM 153

Query: 132 PRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
            R  LEL R    V   PYP++   +E      +   LR+L +EYLK L  
Sbjct: 154 RRALLELSRTLPDVTLYPYPVLPPAMEHP---LRRSSLRLLALEYLKWLGA 201


>gi|330993951|ref|ZP_08317881.1| hypothetical protein SXCC_03846 [Gluconacetobacter sp. SXCC-1]
 gi|329758897|gb|EGG75411.1| hypothetical protein SXCC_03846 [Gluconacetobacter sp. SXCC-1]
          Length = 201

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 83/183 (45%), Gaps = 5/183 (2%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
             + +  G   F+    +  +   P    IV LTG   RIE +  LL      ++ ISGV
Sbjct: 4   AALAWTAGLAWFVHDAMRPPVLP-PRADGIVALTGGQGRIEESVRLLVQGRAGRLLISGV 62

Query: 71  HHSVSKDILLQKIPIRQDLAECC-IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
               ++   L+ +P    LA      +G +A +T GNA E +AW  +   H +++VT  Y
Sbjct: 63  DPHATRGDFLRHLPPPVPLAAWTHTTLGSRATSTLGNADETAAWVREYGLHSLIVVTAGY 122

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           H+ R  LE+ R    V+    PI S  L      F    +R++++EY K LL  + +   
Sbjct: 123 HIRRAMLEISRTVPGVRLYGDPIRSPALAHP---FHPATMRLMVVEYDKWLLACLDVVRL 179

Query: 190 TQT 192
           T+ 
Sbjct: 180 TRP 182


>gi|254292607|ref|YP_003058630.1| hypothetical protein Hbal_0231 [Hirschia baltica ATCC 49814]
 gi|254041138|gb|ACT57933.1| protein of unknown function DUF218 [Hirschia baltica ATCC 49814]
          Length = 197

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 88/185 (47%), Gaps = 3/185 (1%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           L  CL      F+SF     Q+  P  D  +  A++ LTG   RI  A E+ ++Q    +
Sbjct: 13  LVFCLFLIGYDFVSFSYRAAQLATPQFDTSNPHAVIALTGGSNRIAFAAEIAKDQNLP-L 71

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           FISGV+     D +     +     ECC  +GYKA  T  N  E + W+ K+ +  ++IV
Sbjct: 72  FISGVNREAKPDEVAIAAGVDTAFFECCTTLGYKARTTYENGLEVAQWSTKSGYTRLIIV 131

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T +YHM R  LEL+R    V      + S  ++ ++    ++  + + IE++K  ++  +
Sbjct: 132 TSNYHMERALLELERAMPNVTLTGLAVASPAIKADAWWTDMRSAKRMGIEWVKWRIIKTR 191

Query: 186 LSLST 190
               +
Sbjct: 192 RLFQS 196


>gi|148262062|ref|YP_001236189.1| hypothetical protein Acry_3082 [Acidiphilium cryptum JF-5]
 gi|146403743|gb|ABQ32270.1| protein of unknown function DUF218 [Acidiphilium cryptum JF-5]
          Length = 218

 Score =  186 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 51/187 (27%), Positives = 92/187 (49%), Gaps = 4/187 (2%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQ 60
           R+    +   ++ +++GF  F+  + +    +  P    IVVLTG   R++   ELL   
Sbjct: 24  RWPLRAVLALVVLWLVGFAWFLGDIAEERPINPMPHAGGIVVLTGGADRVKAGLELLMAG 83

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
              ++ ISG  +         +  I  +     I +G+ A  T GNA+E +AWA +++  
Sbjct: 84  AAPRLLISGAGNGTYLGDFTARDGIDANAKATDITVGHAAATTRGNARETAAWASRHHIG 143

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +++VT DYHMPR  LEL R    V  IP P+    +       +  +L++L+ E+ K +
Sbjct: 144 SLVVVTADYHMPRALLELHRALPGVTLIPEPVRPPAMTNPG---QPHMLKILVTEFCKYI 200

Query: 181 LLSIQLS 187
           ++ ++L 
Sbjct: 201 VVRLRLG 207


>gi|326405574|ref|YP_004285656.1| hypothetical protein ACMV_34270 [Acidiphilium multivorum AIU301]
 gi|325052436|dbj|BAJ82774.1| hypothetical protein ACMV_34270 [Acidiphilium multivorum AIU301]
          Length = 218

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 51/187 (27%), Positives = 92/187 (49%), Gaps = 4/187 (2%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQ 60
           R+    +   ++ +++GF  F+  + +    +  P    IVVLTG   R++   ELL   
Sbjct: 24  RWPLRAVLALVVLWLVGFAWFLGDIAEERPINPMPHAGGIVVLTGGADRVKAGLELLMAG 83

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
              ++ ISG  +         +  I  +     I +G+ A  T GNA+E +AWA +++  
Sbjct: 84  AAPRLLISGAGNGTYLGDFTARDGIDANAKATDITVGHAAATTRGNARETAAWASRHHIG 143

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +++VT DYHMPR  LEL R    V  IP P+    +       +  +L++L+ E+ K +
Sbjct: 144 SLVVVTADYHMPRALLELHRALPGVTLIPEPVRPPAMTNPG---QPHMLKILVTEFCKYI 200

Query: 181 LLSIQLS 187
           ++ ++L 
Sbjct: 201 VVRLRLG 207


>gi|326386450|ref|ZP_08208073.1| hypothetical protein Y88_2345 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209111|gb|EGD59905.1| hypothetical protein Y88_2345 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 194

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 47/183 (25%), Positives = 84/183 (45%), Gaps = 14/183 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
            F   L + ++ +++GF+ F  ++      DH    A++ LTG   RI+R  E+L     
Sbjct: 9   LFRRILSLMVLAWLLGFLWFALFLP--RPADHTRTDAVIALTGGSGRIQRGIEVLRADEA 66

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ +SGV   V       +  +   L  CC+ +GY++ +T  NA EA+ W  + +   V
Sbjct: 67  KRMLVSGVDSEVKPAEFEAEYGVPASLFACCMTLGYESFDTRSNALEAARWIARYDLRSV 126

Query: 123 LIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +VT D+HM R   +L       +  +   + SH             +R+L +EY K L 
Sbjct: 127 RLVTTDWHMRRAAFDLAVAAPKGLVIVEDAVPSH-----------PSMRILFVEYNKFLA 175

Query: 182 LSI 184
             +
Sbjct: 176 RML 178


>gi|56551314|ref|YP_162153.1| hypothetical protein ZMO0418 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241760967|ref|ZP_04759056.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753066|ref|YP_003225959.1| hypothetical protein Za10_0828 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542888|gb|AAV89042.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374586|gb|EER64047.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552429|gb|ACV75375.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 203

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 57/198 (28%), Positives = 90/198 (45%), Gaps = 16/198 (8%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             L    + ++ GF  F  +    H  +      IVVLTG   RI+R   +LE    +K+
Sbjct: 12  RFLICLFMLWLGGFWLFYSF--HAHPTNKQVTDGIVVLTGGAGRIDRGLMMLERHQAKKM 69

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            +SGV+  V  + L     I   L ECC+D+G +A++T  NAQE + W   N++H V ++
Sbjct: 70  LVSGVNRQVKAEELAALYDIPSHLIECCVDLGTQAVDTSSNAQETAEWITLNHYHSVRLI 129

Query: 126 THDYHMPRTFLELQ-RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS- 183
           T D+HM R   EL   I   ++ +   I SH              RV +IEY K L    
Sbjct: 130 TTDWHMARARFELSLMIGKDIKVVEDAIPSHA-----------GWRVWIIEYCKYLWRRS 178

Query: 184 -IQLSLSTQTASQFFITL 200
            + +  ++        ++
Sbjct: 179 SVAIGFNSIPYPSAPASI 196


>gi|296283193|ref|ZP_06861191.1| hypothetical protein CbatJ_06211 [Citromicrobium bathyomarinum
           JL354]
          Length = 176

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 86/180 (47%), Gaps = 14/180 (7%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
           W      ++ +++GFI F  ++      +     A++V TG   RIER  E+++    + 
Sbjct: 3   WRVGLAIVLVWVLGFIWFAGWLPGPAPME--RTDAVIVPTGYAGRIERGLEVVQTDSADT 60

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ++GV   V       +  + +D+ ECC+ +G+ A +T GNAQE   WAE +    + +
Sbjct: 61  LLVTGVDPEVKPGEFAAQFKVPEDVMECCVTLGFAATDTRGNAQETREWAEAHGIKSLRL 120

Query: 125 VTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           VT D+HM R   EL+R     V+ I   + S              L +LLIEY K L+  
Sbjct: 121 VTSDWHMRRAATELRRQLPGDVKLIKDAVRSE-----------PSLWLLLIEYHKWLVSR 169


>gi|114326797|ref|YP_743954.1| hypothetical protein GbCGDNIH1_0133 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314971|gb|ABI61031.1| hypothetical protein GbCGDNIH1_0133 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 216

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/192 (29%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
           F       L+    GF+ F    + +          IVVLTG   R+    +LL    G 
Sbjct: 31  FGLLGGFALLVLSGGFLWFAWQSQHVLRAPS-HADGIVVLTGGAERVATGLKLLAAGRGS 89

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
            + ISGV    S   L +   I     E  + +GY+A  T GNA E + WA + +   V+
Sbjct: 90  VLLISGVAKGASLGTLARVAGIDPTPLEGRVMLGYEAATTRGNALETADWAHERHLRSVI 149

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT  YHMPR   EL+R    V   P  +             + IL++L  EYLK L   
Sbjct: 150 VVTAGYHMPRALAELRRAMPDVILYPETVHPDQGGSL-----LNILKLLSSEYLKWLGAE 204

Query: 184 IQLSLSTQTASQ 195
           + LS  T     
Sbjct: 205 LHLSSLTPVRET 216


>gi|87198723|ref|YP_495980.1| hypothetical protein Saro_0699 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134404|gb|ABD25146.1| protein of unknown function DUF218 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 182

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 84/187 (44%), Gaps = 14/187 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
            F   L + +I + +GFI F  ++ +    +      IVVLTG   RI  A  LL+   G
Sbjct: 6   IFRRLLSLLMIAWALGFIWFAVFLPR-PAAEPARTDGIVVLTGGSGRIPHALRLLQTGAG 64

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            K+ +SGV   V       +  +   L  CCI +GY A++T  NA E++ W + N    V
Sbjct: 65  RKLLVSGVDREVRPREFAVEYDVPSRLMTCCIVLGYDAVDTRSNAVESARWMQTNRIRSV 124

Query: 123 LIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +VT D+HM R   +L +     +  +   ++S               R+L IEY K L+
Sbjct: 125 RLVTTDWHMRRAAFDLAQEAPKDLVIVEDAVVSR-----------PSFRILFIEYNK-LV 172

Query: 182 LSIQLSL 188
             +   L
Sbjct: 173 ARLAAWL 179


>gi|294085432|ref|YP_003552192.1| hypothetical protein SAR116_1865 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665007|gb|ADE40108.1| protein of unknown function DUF218 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 207

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 84/182 (46%), Gaps = 5/182 (2%)

Query: 10  VCLIFFIMGFISFIRYVKQMHI--PDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           + + F +  F  F+  + +             IVV TG   R+     LL +   +K+ I
Sbjct: 26  ILVAFMLASFQHFVLTLPRGETDFTKLDHTDGIVVTTGGQQRLVEGLNLLVSGTTDKVLI 85

Query: 68  SGVHHSVSKDILLQKIPIRQDLAE---CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SGV   V+K +L+Q++ +         CC+++ Y AL+T GNA  A AW + N    + +
Sbjct: 86  SGVGKGVNKAVLVQELNLDDQQVSALFCCVELEYGALDTRGNALAARAWIDLNGLKSIRL 145

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT +YHMPR  +   R    V    + +  + L+         I+R+L  EY K +   I
Sbjct: 146 VTANYHMPRAEIVFSRAIPNVDIHQWAVSPNALDVERWWQDPMIIRLLTREYAKYVAEII 205

Query: 185 QL 186
           +L
Sbjct: 206 RL 207


>gi|58038750|ref|YP_190714.1| hypothetical protein GOX0275 [Gluconobacter oxydans 621H]
 gi|58001164|gb|AAW60058.1| Hypothetical protein GOX0275 [Gluconobacter oxydans 621H]
          Length = 239

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           M+            ++ GF  FI+   +  +   P    IV LTG   R++    LL   
Sbjct: 43  MKRLLLTCLALGGLWLAGFAWFIQDASKASVTA-PVCDGIVALTGGEQRVDTGITLLRGG 101

Query: 61  IGEKIFISGVHHSVSKDILL--QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
            G  + ISGV   V+   +L  Q+  +   LAE  I +G +A +T GNA E + WA  N+
Sbjct: 102 YGHLLLISGVGPHVTLQHILHLQQESLSSPLAER-ITLGRRATSTIGNAHETAQWARDNH 160

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
            H +L+VT  YH+ R  LE+ R+   +  +PYP++   L+        + L ++  EY K
Sbjct: 161 LHRLLVVTAGYHIRRAVLEIHRVAPDLALVPYPVVPLALQAP---LSRRTLFLMFREYNK 217

Query: 179 ILLLSI 184
            L   I
Sbjct: 218 FLGAEI 223


>gi|85710207|ref|ZP_01041272.1| hypothetical protein NAP1_15018 [Erythrobacter sp. NAP1]
 gi|85688917|gb|EAQ28921.1| hypothetical protein NAP1_15018 [Erythrobacter sp. NAP1]
          Length = 178

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 85/180 (47%), Gaps = 14/180 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
           Y L   ++ + +GF  F   + Q    +  S  A++V TG P RI +  ++LE    +++
Sbjct: 6   YLLAASVLVWALGFFWFAAALPQ--PAEELSTDAVIVPTGGPGRIAQGLQVLEQGQAQRM 63

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ++GV   V++D    +  + +   +CCI +G +A++T  NA E + W   N+   + +V
Sbjct: 64  LVTGVDPEVTRDEFAAEFEVDEARMDCCITLGSEAVDTRSNATETAEWVAANDITSLRLV 123

Query: 126 THDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           T D+HM R   EL R    +V  +   + S              L  L +EY K++   I
Sbjct: 124 TTDWHMRRAAGELDRELPSSVTVVRDAVPSQ-----------PSLASLFLEYHKLIASFI 172


>gi|304320133|ref|YP_003853776.1| hypothetical protein PB2503_02792 [Parvularcula bermudensis
           HTCC2503]
 gi|303299036|gb|ADM08635.1| hypothetical protein PB2503_02792 [Parvularcula bermudensis
           HTCC2503]
          Length = 194

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 89/195 (45%), Gaps = 10/195 (5%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQM----HIPDHPSVSA---IVVLTGEPIR-IER 52
           MR+      +  +    GF  F+  + +           S  A   +V+LTG   R I+ 
Sbjct: 1   MRFVLKIAALMGLLCAAGFFVFVAALPRSSNEQAALRSLSADARTGMVILTGGAGRRIQH 60

Query: 53  AFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
             +L     G+++ ISG H  V K+ L  +    +D   CC+D+G +A  T GNA EA  
Sbjct: 61  GLDLFAQGYGDRVLISGTHPLVDKEDL--EGLGVRDSLHCCVDLGPRARTTIGNALEARD 118

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
           WA +  +  +L+VT D+H+PR  LEL+ +   +  I   + +      + +      RVL
Sbjct: 119 WARRRGYDTILLVTSDFHLPRALLELEAVAPELTVIGIAVDTRSAPSANWMRSPSAWRVL 178

Query: 173 LIEYLKILLLSIQLS 187
             EY+K +L   +  
Sbjct: 179 AEEYIKYILAWTRHR 193


>gi|148555918|ref|YP_001263500.1| hypothetical protein Swit_3011 [Sphingomonas wittichii RW1]
 gi|148501108|gb|ABQ69362.1| protein of unknown function DUF218 [Sphingomonas wittichii RW1]
          Length = 177

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 84/171 (49%), Gaps = 13/171 (7%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           +I GF++F  ++ Q   PD  +   IVV+TG   R+ER   LLE +  +++ ISG    V
Sbjct: 13  WIAGFMAFALFLPQ-PAPDGIATDGIVVMTGGRGRVERGLRLLEAKRAKRLLISGADRRV 71

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
               L  +      L ECC+D+G+++++T  NA EA+ W  +  +  + +VT D+HM R 
Sbjct: 72  RPHELAAQFKAPMALVECCVDLGHESVDTRSNAAEAADWIARRRYRSIRLVTSDWHMVRA 131

Query: 135 FLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
             +L+      ++ +   + +     +           L+ EY K LL  +
Sbjct: 132 RFDLRNATGDKLEIVADAVPTEPGLVD-----------LVREYNKYLLRRV 171


>gi|332188414|ref|ZP_08390138.1| hypothetical protein SUS17_3520 [Sphingomonas sp. S17]
 gi|332011560|gb|EGI53641.1| hypothetical protein SUS17_3520 [Sphingomonas sp. S17]
          Length = 177

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 91/188 (48%), Gaps = 16/188 (8%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
               + +  + + +GF +F+  +   H  ++ +  AIVV TG   RI+R   LL+    +
Sbjct: 1   MLRLIGLVALGWCLGFAAFMLSLP--HPLENNTTDAIVVPTGGAGRIDRGIALLQAHQAK 58

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ++GV   V    L +       L  CCID+G +A++T  NA+E + W  ++ +  V 
Sbjct: 59  RMLVTGVAPGVRPIDLARTYRTAPSLFSCCIDLGLEAVDTRSNAEETARWVREHGYRTVR 118

Query: 124 IVTHDYHMPRTFLEL-QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           +VT D+H+PR  +EL   +   V  +   + S              L  L+ EY K++L 
Sbjct: 119 LVTSDWHLPRARMELVAALGPQVVVLGDGVPSE-----------PRLGTLVNEYNKLILR 167

Query: 183 SIQLSLST 190
             +++L T
Sbjct: 168 --RIALWT 173


>gi|149185075|ref|ZP_01863392.1| hypothetical protein ED21_18517 [Erythrobacter sp. SD-21]
 gi|148831186|gb|EDL49620.1| hypothetical protein ED21_18517 [Erythrobacter sp. SD-21]
          Length = 201

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 14/185 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             L    + +  GF+ F   +            A++VLTG P RI R  E++E  + +++
Sbjct: 4   RLLAAIFLVYAFGFLGFAMTLP--APAAKTETDAVIVLTGGPGRIARGLEVVEQNMAKEM 61

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           F+SGV   V  +   ++  +   L +CC+ +GY A++T  NA E + W ++  F    +V
Sbjct: 62  FVSGVDPEVKPNEFAEQFEVSSRLMDCCVTLGYLAVDTRSNAGEVAQWMKEKEFTSARLV 121

Query: 126 THDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           T ++HM R + E+       +  +   ++SH             L  L +EY K+L   +
Sbjct: 122 TTNWHMARAYSEVAGTLPAGISIVKDAVVSH-----------PDLATLFLEYNKLLASEV 170

Query: 185 QLSLS 189
              L 
Sbjct: 171 SQGLP 175


>gi|296536740|ref|ZP_06898797.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296262933|gb|EFH09501.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 200

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 76/188 (40%), Gaps = 13/188 (6%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
             W    +  I  + GF  F    +            I VLTG P R++    LL     
Sbjct: 14  RLWLLPALLAILVVAGFALFTGQSRARPELPLRQTDGIAVLTGGPQRVDAGLRLLAEGHA 73

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDL---AECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             + ISG     + + L ++  +   L       + +G +A +T GN QE + WAE    
Sbjct: 74  RALIISGTGRDATLEELARRAGLPDPLPEGFAARVTLGREATSTRGNGQEVAEWAEARQI 133

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             + +VT  +HMPR  LEL+R    V  +P+P+ +                +LL EY K 
Sbjct: 134 GSLRVVTAAFHMPRALLELRRTLPGVALVPHPVQAAGPRPG----------LLLREYGKF 183

Query: 180 LLLSIQLS 187
           +   + LS
Sbjct: 184 IGAMLGLS 191


>gi|85375113|ref|YP_459175.1| hypothetical protein ELI_11430 [Erythrobacter litoralis HTCC2594]
 gi|84788196|gb|ABC64378.1| hypothetical protein ELI_11430 [Erythrobacter litoralis HTCC2594]
          Length = 176

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 14/181 (7%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
           W    + ++ + +GF+ F   + Q          A++V TG   RI+R  E+L+      
Sbjct: 3   WRLFLLVVVAYALGFMWFAAALPQPRFEGE--TDAVIVPTGAAGRIDRGLEVLDGGKARM 60

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ++GV   V       +  +  +   CC+ +G+ A++T GNA E + W  +N    + +
Sbjct: 61  MLVTGVDPEVRPAEFAAEFEVSMERMRCCVSLGFDAVDTRGNAAETADWVAENRIRSLRL 120

Query: 125 VTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           VT D+HM R   EL++     ++ +   + S              L +L +EY K+L   
Sbjct: 121 VTTDWHMRRASGELRQKLPTNIRIVEDAVASE-----------PSLGILFLEYNKLLATW 169

Query: 184 I 184
            
Sbjct: 170 A 170


>gi|209545186|ref|YP_002277415.1| hypothetical protein Gdia_3070 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532863|gb|ACI52800.1| protein of unknown function DUF218 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 213

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 80/183 (43%), Gaps = 10/183 (5%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           +  GF  F R   +      P    IV LTG   RIE +  LL    G ++ ISGV    
Sbjct: 31  WGAGFAWFFRDALR-PPAMPPIADGIVALTGGQGRIEASLRLLAQGRGRQLLISGVAPHA 89

Query: 75  SKDILL---QKIPIRQDLAECC---IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           +   +    Q       +       + +G  A +T GNA E + WA  N  H +++VT  
Sbjct: 90  TTGSVASRLQPQGGGDGIPAALWRHVTLGRHATSTIGNADETAEWAHANAIHSLIVVTAG 149

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
           YH+ R  +E++R    +   PYPI    L+      ++  +R++  EY K ++ S+ L+ 
Sbjct: 150 YHIRRATMEIRRTVPGIVLYPYPIQPPALQAP---LRVASVRLMATEYDKWIMASLGLTR 206

Query: 189 STQ 191
              
Sbjct: 207 DMD 209


>gi|162149067|ref|YP_001603528.1| hypothetical protein GDI_3297 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161787644|emb|CAP57240.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 197

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 80/183 (43%), Gaps = 10/183 (5%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           +  GF  F R   +      P    IV LTG   RIE +  LL    G ++ ISGV    
Sbjct: 15  WGAGFAWFFRDALR-PPAMPPIADGIVALTGGQGRIEASLRLLAQGRGRQLLISGVAPHA 73

Query: 75  SKDILL---QKIPIRQDLAECC---IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           +   +    Q       +       + +G  A +T GNA E + WA  N  H +++VT  
Sbjct: 74  TTGSVASRLQPQGGGDGIPAALWRHVTLGRHATSTIGNADETAEWAHANAIHSLIVVTAG 133

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
           YH+ R  +E++R    +   PYPI    L+      ++  +R++  EY K ++ S+ L+ 
Sbjct: 134 YHIRRATMEIRRTVPGIVLYPYPIQPPALQAP---LRVASVRLMATEYDKWIMASLGLTR 190

Query: 189 STQ 191
              
Sbjct: 191 DMD 193


>gi|296116632|ref|ZP_06835242.1| hypothetical protein GXY_12533 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976844|gb|EFG83612.1| hypothetical protein GXY_12533 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 227

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 80/184 (43%), Gaps = 5/184 (2%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           V ++ +  G   F+R  ++            V LTG   RIE + +L+      ++ ISG
Sbjct: 28  VLIMSWAAGLAWFVRDARRPPRMPP-PCDGAVALTGGQGRIEASLQLMAQHRARRLLISG 86

Query: 70  VHHSVSKDILLQKIPIRQDLAEC-CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           V    +    L + P    L       +G +A +T GNA E + W    + H +++VT  
Sbjct: 87  VDPHATLGDFLTRAPRVLPLEVWLRTTLGRQATSTLGNADETAQWVRAQDIHSLIVVTAG 146

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
           YH+ R  +E+ R    V   P+ +    L       ++   R+L++EY K LL  I  + 
Sbjct: 147 YHIRRAMMEIARAAPGVTLYPFAVQPPALLHP---RRLATWRLLVVEYDKWLLACIDTAR 203

Query: 189 STQT 192
            T+ 
Sbjct: 204 WTRP 207


>gi|103488367|ref|YP_617928.1| hypothetical protein Sala_2890 [Sphingopyxis alaskensis RB2256]
 gi|98978444|gb|ABF54595.1| protein of unknown function DUF218 [Sphingopyxis alaskensis RB2256]
          Length = 176

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 50/175 (28%), Positives = 79/175 (45%), Gaps = 14/175 (8%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             + +  + +++GF  F   +            AIVV+TG P RI+RA E LE    +++
Sbjct: 4   RLISLLFLVWVLGFAWFALLLPLPA--PPQKTDAIVVVTGGPGRIDRALERLEAGDAKRL 61

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGV   V    L  +      L +CCI +G+ A +T  NA E +AWA++  +  + +V
Sbjct: 62  LISGVAREVKPRELAAEYGRPVALFDCCIALGFDAEDTRSNATEVAAWAKRRKYKSIRLV 121

Query: 126 THDYHMPRTFLEL-QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
           T D+HM R   E+ + +   V  +   + S              L  L  EY K 
Sbjct: 122 TTDWHMRRAEYEIGRAVGRDVTIVTDAVRSQ-----------PNLATLFREYHKY 165


>gi|322420740|ref|YP_004199963.1| hypothetical protein GM18_3250 [Geobacter sp. M18]
 gi|320127127|gb|ADW14687.1| protein of unknown function DUF218 [Geobacter sp. M18]
          Length = 195

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 45/166 (27%), Positives = 70/166 (42%), Gaps = 9/166 (5%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F+ F+     +  P      AIVVLTG   R+E    L     G+K+F+ GV  SV K  
Sbjct: 22  FVDFVYKTFSLS-PRDTQADAIVVLTGGRGRVEEGVRLYRAGQGKKLFLIGVDPSVKKRE 80

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           L Q         E  + +   + NT  NA  A     K+    + ++T  YHM R+ +  
Sbjct: 81  LFQGDG------EGGVYLEQNSRNTLENAIYARDLIMKHKVRSIKLITSRYHMKRSTILF 134

Query: 139 QRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +      V   P+P+ S +L+E          ++L  E+ K  +L 
Sbjct: 135 RNALPRYVAIYPHPVDSSNLKEQ-WWRHSGSFKLLFSEFYKYCILR 179


>gi|253699685|ref|YP_003020874.1| hypothetical protein GM21_1055 [Geobacter sp. M21]
 gi|251774535|gb|ACT17116.1| protein of unknown function DUF218 [Geobacter sp. M21]
          Length = 195

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 76/185 (41%), Gaps = 9/185 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           ++  +  + + LI   + F+ F+     +         AIVVLTG   R+E   +L    
Sbjct: 4   LKVLFSLIVLILIVLSVLFVDFVYKTFSLS-QRDVKTDAIVVLTGGRGRVEEGVKLYRGG 62

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+ +F+ GV   V K  L +            + +   + NT  NA  A     K+   
Sbjct: 63  RGKLLFLIGVDPLVKKHELYRGAGAEN------VYLEKTSRNTLENAIYARDMITKHRVS 116

Query: 121 HVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            + ++T  YHM R+ +  +      +   P+P+ S +L+E          ++L  E+ K 
Sbjct: 117 SIKLITSRYHMKRSTILFRNALPKDIAIYPHPVDSSNLKEE-WWNHKGSFKLLFSEFYKY 175

Query: 180 LLLSI 184
            +L +
Sbjct: 176 CILRL 180


>gi|78223525|ref|YP_385272.1| hypothetical protein Gmet_2322 [Geobacter metallireducens GS-15]
 gi|78194780|gb|ABB32547.1| protein of unknown function DUF218 [Geobacter metallireducens
           GS-15]
          Length = 200

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 44/194 (22%), Positives = 81/194 (41%), Gaps = 7/194 (3%)

Query: 1   MRYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHP--SVSAIVVLTGEPIRIERAFELL 57
           M  F+ GLF + +IF ++  + F+ +  +         +  AIVVL G   R+E    L 
Sbjct: 1   MALFFRGLFSLLVIFLVVATVLFVDFAYKTFSVRQRDIATDAIVVLAGGRGRVEEGIRLF 60

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
             + G+ +F+ GV   V K  L Q+           + +   + NT  NA       ++ 
Sbjct: 61  RAKKGKYLFLIGVDPMVRKQELFQERKGES--LADRVVLENASRNTLENALYGREIIDRK 118

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
           +   + ++T  YHM R  L  +      +   P+P+ + +L+E +        R+L  E+
Sbjct: 119 DIRSISLITSRYHMKRATLIFRSTLPRDIAIYPHPVDTINLKE-AWWRDQGSFRLLFSEF 177

Query: 177 LKILLLSIQLSLST 190
            K  L       ++
Sbjct: 178 YKYCLFRFFFLFAS 191


>gi|197119576|ref|YP_002140003.1| hypothetical protein Gbem_3208 [Geobacter bemidjiensis Bem]
 gi|197088936|gb|ACH40207.1| YdcF-like protein of unknown function DUF218 [Geobacter
           bemidjiensis Bem]
          Length = 196

 Score =  163 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 76/185 (41%), Gaps = 9/185 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           ++  +  + + LI   + F+ F+     +         AIVVLTG   R+E   +L    
Sbjct: 4   LKGLFSLMVLILIVLSVLFVDFVYKTFSLS-QRDVHADAIVVLTGGRGRVEEGVKLYRAG 62

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+ +F+ GV   V K  L Q            + +   + NT  NA  A     K+   
Sbjct: 63  QGKLLFLIGVDPLVKKHELYQGAGAEN------VYLEKTSRNTLENAIYARDMIMKHKVS 116

Query: 121 HVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            + ++T  YHM R+ +  +      V   P+P+ S +L+E          ++L  E+ K 
Sbjct: 117 SIKLITSRYHMKRSTILFRNAFPKDVAIYPHPVDSSNLKEE-WWNHKGSFKLLFSEFYKY 175

Query: 180 LLLSI 184
            +L +
Sbjct: 176 CILRV 180


>gi|189425340|ref|YP_001952517.1| hypothetical protein Glov_2281 [Geobacter lovleyi SZ]
 gi|189421599|gb|ACD95997.1| protein of unknown function DUF218 [Geobacter lovleyi SZ]
          Length = 198

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 40/167 (23%), Positives = 67/167 (40%), Gaps = 5/167 (2%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F+ F         P      AIVVL G   R+E    L   + G  +F+ GV  +V K  
Sbjct: 22  FVDFTYKTFSAR-PRQVQADAIVVLAGGKGRVEEGVRLFRERRGTWLFLVGVDPTVRKSD 80

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           L +  P         + +   + NT  NA        ++    VL++T  YH+ R+ +  
Sbjct: 81  LYRPKPGDPP--ADNVVLEKLSRNTLENAIYGRDILAEHKVRSVLLITSRYHLKRSAILF 138

Query: 139 QRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +      V   PYP+ S +++E      +   R+L  E+ K  +  +
Sbjct: 139 RNALAPDVALYPYPVDSSNVKEE-WWHHLGTFRLLFSEFYKYCIFRV 184


>gi|148265185|ref|YP_001231891.1| hypothetical protein Gura_3157 [Geobacter uraniireducens Rf4]
 gi|146398685|gb|ABQ27318.1| protein of unknown function DUF218 [Geobacter uraniireducens Rf4]
          Length = 199

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 75/190 (39%), Gaps = 5/190 (2%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           R  +  L + L+   + F+ F      +         AIVVL G   RIE    L     
Sbjct: 5   RGIFSLLVISLVVIAVLFVDFTYKTFSLR-QRDVKSDAIVVLAGGRGRIEEGVRLYRENR 63

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
              +F+ GV  +V K  L  +    +      + +   + NT  NA  A     ++N   
Sbjct: 64  ARWLFLIGVDPAVRKGELFTERRGERSGEG--VFLENVSRNTLENALYAREMIVRHNVSS 121

Query: 122 VLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           + ++T  YHM R  L  +++    +   P+P+ S +L+E          R+L  E+ K  
Sbjct: 122 IKLITSRYHMKRATLIFRQVLPKDIAIYPHPVDSKNLKEE-WWSHGGSFRLLFSEFYKYC 180

Query: 181 LLSIQLSLST 190
           L  +    ++
Sbjct: 181 LFRLFFLFAS 190


>gi|118580810|ref|YP_902060.1| hypothetical protein Ppro_2396 [Pelobacter propionicus DSM 2379]
 gi|118503520|gb|ABL00003.1| protein of unknown function DUF218 [Pelobacter propionicus DSM
           2379]
          Length = 198

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 59/153 (38%), Gaps = 4/153 (2%)

Query: 33  DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
                 AIVVL G   R++    L     G  +F  GV  +V +  L +  P        
Sbjct: 35  REVRADAIVVLAGGKGRVDEGVRLFRQGKGHWLFFIGVDPTVRRSDLYRPRPGDPP--AS 92

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYP 151
            + +   + NT  NA        + N   +L++T  YHM R  + L+      V   PYP
Sbjct: 93  GVILEKASRNTLENAVYGRDVIMERNVRSILLITSRYHMKRASILLRNALPKDVAIYPYP 152

Query: 152 IISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           + + +L+E +         +L  E+ K  +   
Sbjct: 153 VDTANLKE-AWWSHRSSFHLLFGEFYKYCMFRA 184


>gi|222055241|ref|YP_002537603.1| protein of unknown function DUF218 [Geobacter sp. FRC-32]
 gi|221564530|gb|ACM20502.1| protein of unknown function DUF218 [Geobacter sp. FRC-32]
          Length = 198

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 62/162 (38%), Gaps = 4/162 (2%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID 95
           +  AIVVL G   RIE    L        +F+ GV  SV K  L ++    +      + 
Sbjct: 38  NCDAIVVLAGGRGRIEEGSRLYRENHARWLFLIGVDPSVRKSDLFRERKGERSGEG--VY 95

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIIS 154
           +   + NT  NA  A       N   + ++T  YHM R  L  + +    +   P+P+ +
Sbjct: 96  LEKVSRNTLENALYAREMIVGRNIDSIELITSRYHMKRATLIFRHVLPKDIAIYPHPVDT 155

Query: 155 HDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQF 196
            +L+E          R+L  E+ K  L  +    +       
Sbjct: 156 KNLKEE-WWNHSGSFRLLFSEFYKYCLFRVFFLFAPTELQSA 196


>gi|39997331|ref|NP_953282.1| hypothetical protein GSU2233 [Geobacter sulfurreducens PCA]
 gi|39984222|gb|AAR35609.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506268|gb|ADI84991.1| YdcF-like protein of unknown function DUF218 [Geobacter
           sulfurreducens KN400]
          Length = 199

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 75/195 (38%), Gaps = 9/195 (4%)

Query: 1   MRYFWYG----LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFEL 56
           M  F+ G    L V LI   + F+ F      +      +  AIVVL G   R+E    L
Sbjct: 1   MALFFRGIISLLIVVLIIVAVLFVDFAYKTFSLR-QRDVTTDAIVVLAGGRGRVEEGVRL 59

Query: 57  LENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
              + G  +++ GV   V K  L +     +      + +   + NT  NA        +
Sbjct: 60  FRERKGTYLYLIGVDPVVKKRDLFRDREGER--LADRVFLENLSRNTLENALYGREIIMR 117

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
                + ++T  YHM R  L  +++    +   P+P+ + +L+E          R+L  E
Sbjct: 118 KEVRSIRLITSRYHMKRATLLFRQVLPRDIAIYPHPVDTTNLKER-WWDDKGSFRLLFSE 176

Query: 176 YLKILLLSIQLSLST 190
           + K  L       ++
Sbjct: 177 FYKYCLFRFFFLFAS 191


>gi|157965010|ref|YP_001499834.1| hypothetical protein RMA_1350 [Rickettsia massiliae MTU5]
 gi|157844786|gb|ABV85287.1| hypothetical protein RMA_1350 [Rickettsia massiliae MTU5]
          Length = 171

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 80/180 (44%), Gaps = 18/180 (10%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L      ++ GF  +  Y+   +  +  + +AI+V  G   +IE    LL+      +FI
Sbjct: 6   LLTIFALWVGGF-GYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGSALLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +     LL++   R  + +  I    K ++ E N ++A  +    N   +++V H
Sbjct: 65  TGIESTEQLKNLLKE---RNVIEQQVILAPSKIMSEEDNIKKAVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRI---NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +Y+MP    +L+++   +  +  +PYP+ S    +           VLL  Y + L+  +
Sbjct: 122 NYNMPFMLNKLEKVIHSSHNIYIVPYPVFSKQKYD-----------VLLKSYHRYLMSIL 170


>gi|67459774|ref|YP_247398.1| hypothetical protein RF_1382 [Rickettsia felis URRWXCal2]
 gi|67005307|gb|AAY62233.1| Uncharacterized conserved protein [Rickettsia felis URRWXCal2]
          Length = 174

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 79/185 (42%), Gaps = 18/185 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      ++ G + +  Y+   +  +  + +A++V  G   +IE    LL+  
Sbjct: 2   IRKFLLTILAIFALWVGG-LGYYLYLINSYKLNSNTTNAVIVFAGGGHKIETGIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL++   R  + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFITGIESTEQLKNLLKE---RNVIEQQVILAPNKIMSEEDNIKKAVDFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            +++V H+Y+MP    +L++       +  +PY + S    +           VLL  Y 
Sbjct: 118 SIILVEHNYNMPFMLNKLEKAIPSSNNIYIVPYLVFSKQKYD-----------VLLKSYH 166

Query: 178 KILLL 182
           + L+ 
Sbjct: 167 RYLMS 171


>gi|239946686|ref|ZP_04698439.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920962|gb|EER20986.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 171

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/159 (20%), Positives = 71/159 (44%), Gaps = 7/159 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      +I+GF  +  Y+   +  +  + +AI+V  G   +IE    +L+  
Sbjct: 2   IRKFLLTILAIFALWIVGF-GYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAMLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL++      + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFITGIESAGQLKNLLKE---HSVIEQQVILAPNKIMSEEDNIKKAVDFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISHD 156
            +++V H+Y+MP    +L++       +  + YP+  + 
Sbjct: 118 SIILVEHNYNMPFMLNKLKKAIPSSNNIYIVSYPVFPNK 156


>gi|15893279|ref|NP_360993.1| hypothetical protein RC1356 [Rickettsia conorii str. Malish 7]
 gi|229587249|ref|YP_002845750.1| hypothetical protein RAF_ORF1242 [Rickettsia africae ESF-5]
 gi|29839740|sp|Q92FX1|Y1356_RICCN RecName: Full=Uncharacterized protein RC1356
 gi|15620500|gb|AAL03894.1| unknown [Rickettsia conorii str. Malish 7]
 gi|228022299|gb|ACP54007.1| Unknown [Rickettsia africae ESF-5]
          Length = 171

 Score =  139 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/180 (21%), Positives = 77/180 (42%), Gaps = 18/180 (10%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L      ++ GF  +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 6   LLTIFALWVGGF-GYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +Y+MP    +L++       +  +PYP+ S    +           VLL  Y + L+  +
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPVFSKQKYD-----------VLLKSYHRYLMSIL 170


>gi|238651121|ref|YP_002916979.1| hypothetical protein RPR_07675 [Rickettsia peacockii str. Rustic]
 gi|238625219|gb|ACR47925.1| hypothetical protein RPR_07675 [Rickettsia peacockii str. Rustic]
          Length = 171

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/180 (21%), Positives = 76/180 (42%), Gaps = 18/180 (10%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L      ++ GF  +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 6   LLTIFALWVGGF-GYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIISEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +Y+MP    +L++       +  +PYP+ S    +           VLL  Y   L+  +
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPVFSKQKYD-----------VLLKSYHHYLMSIL 170


>gi|157829194|ref|YP_001495436.1| hypothetical protein A1G_07445 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933919|ref|YP_001650708.1| hypothetical protein RrIowa_1586 [Rickettsia rickettsii str. Iowa]
 gi|157801675|gb|ABV76928.1| hypothetical protein A1G_07445 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165909006|gb|ABY73302.1| hypothetical protein RrIowa_1586 [Rickettsia rickettsii str. Iowa]
          Length = 171

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/180 (21%), Positives = 77/180 (42%), Gaps = 18/180 (10%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L      ++ GF  +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 6   LLTIFALWVGGF-GYYLYLINSYKLNSNTTNAIIVFVGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +Y+MP    +L++       +  +PYP+ S    +           VLL  Y + L+  +
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPVFSKQKYD-----------VLLKSYHRYLMSIL 170


>gi|34581055|ref|ZP_00142535.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262440|gb|EAA25944.1| unknown [Rickettsia sibirica 246]
          Length = 171

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 37/180 (20%), Positives = 76/180 (42%), Gaps = 18/180 (10%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L      ++ GF  +  Y+   +  +  + +AI+V  G   +IE     L+      +FI
Sbjct: 6   LLTIFALWVGGF-GYYLYLINSYKLNSNTTNAIIVFAGGGHKIETGIAWLKAGYAPILFI 64

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           +G+  +    ILL++   R  + +  I    K ++ E N ++   +    N   +++V H
Sbjct: 65  TGIESTEQLKILLKE---RNVIEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVEH 121

Query: 128 DYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +Y+MP    +L++       +  +PYP+      +           VLL  Y + L+  +
Sbjct: 122 NYNMPFMLNKLEKAIPSSNNIYIVPYPVFFKQKYD-----------VLLKSYHRYLMSIL 170


>gi|157826367|ref|YP_001494087.1| hypothetical protein A1C_06780 [Rickettsia akari str. Hartford]
 gi|157800325|gb|ABV75579.1| hypothetical protein A1C_06780 [Rickettsia akari str. Hartford]
          Length = 174

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/185 (20%), Positives = 77/185 (41%), Gaps = 18/185 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      ++ G I +  Y+   +  +  + +AI+V  G   +IE    LL+  
Sbjct: 2   IRKFLLTILAIFALWVGG-IGYFLYLINSYKFNSNTTNAIIVFAGGGHKIETGIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI G+  +     LL++   R  + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFIIGIESTEQLRNLLKE---RNVIEQQVILAPNKIMSEEDNIKKAVDFIVTYNLA 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            V++V ++Y+MP    +L++       +  + YP+      +           VLL  Y 
Sbjct: 118 SVILVEYNYNMPFMLNKLEKEIPSSNNIYIVQYPVFFKQKYD-----------VLLKSYN 166

Query: 178 KILLL 182
           + L+ 
Sbjct: 167 RYLMS 171


>gi|51474043|ref|YP_067800.1| hypothetical protein RT0866 [Rickettsia typhi str. Wilmington]
 gi|51460355|gb|AAU04318.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 174

 Score =  131 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 79/185 (42%), Gaps = 18/185 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           ++ F   + V    ++ GF  +  Y+   +  +  + +AI+V  G   +IE    LL+  
Sbjct: 2   IKKFLLIILVIFTLWVGGFC-YYLYLINSYKLNSNTTNAIIVFAGGGHKIETCIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL +      + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFITGIESAEHFKNLLME---HNVIEQQVILAPNKIMSEEDNIKKAIDFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            +++V H+Y++P    +LQ+       V  +PYP+ S    +           VLL  Y 
Sbjct: 118 FIILVEHNYNIPFMLNKLQKAIPSSNNVYIVPYPVFSTQKYD-----------VLLKSYH 166

Query: 178 KILLL 182
           + L+ 
Sbjct: 167 RYLMS 171


>gi|15604704|ref|NP_221222.1| hypothetical protein RP875 [Rickettsia prowazekii str. Madrid E]
 gi|7388444|sp|Q9ZC92|Y875_RICPR RecName: Full=Uncharacterized protein RP875
 gi|3861399|emb|CAA15298.1| unknown [Rickettsia prowazekii]
 gi|292572540|gb|ADE30455.1| hypothetical protein rpr22_CDS854 [Rickettsia prowazekii Rp22]
          Length = 174

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 76/185 (41%), Gaps = 18/185 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      ++ GF  +  Y+   +  +  + +AI+V      +IE    LL+  
Sbjct: 2   IRKFLLIILAIFTLWVGGF-GYYLYLINSYKLNSNTTNAIIVFADGGHKIETCMALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL K      + +  I    K ++ E N +EA  +    N  
Sbjct: 61  YAPILFITGIESTERFKNLLMK---HNVIEQQVILAPNKIMSEEDNIKEAINFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            + +V H+Y++P    +LQ+       V  +PYP+ S    +           VLL  Y 
Sbjct: 118 LITLVEHNYNIPFMLNKLQKAIPSSNNVYIVPYPVFSKPKYD-----------VLLKSYH 166

Query: 178 KILLL 182
           + L+ 
Sbjct: 167 RYLMS 171


>gi|42523257|ref|NP_968637.1| hypothetical protein Bd1767 [Bdellovibrio bacteriovorus HD100]
 gi|39575462|emb|CAE79630.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 184

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 77/176 (43%), Gaps = 5/176 (2%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTGEPIRIERAFELLE 58
           R FW   F+  +  +  F+   + V+   I      PS    VVLTG   R+   F+LL 
Sbjct: 4   RSFWALAFLSAVV-LYRFVDEFQKVQSERIQSWTKTPSADCAVVLTGGAGRVREGFDLLV 62

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
           NQ  +K+ ISGV+ +     ++   P   +L+E  + +  ++  T GNAQ++    E   
Sbjct: 63  NQNVKKLVISGVYSNARLREIMPVWPFYGNLSENDVVLDRRSETTYGNAQQSLPIVEALK 122

Query: 119 FHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              +L+VT   HM R++   +      +    + II    E +      + L+ L 
Sbjct: 123 CRDILLVTSRLHMYRSYRTFRATFPENIYIEKHAIIGGRFESSVWESGFEALKSLF 178


>gi|91204866|ref|YP_537221.1| hypothetical protein RBE_0051 [Rickettsia bellii RML369-C]
 gi|157826504|ref|YP_001495568.1| hypothetical protein A1I_00645 [Rickettsia bellii OSU 85-389]
 gi|91068410|gb|ABE04132.1| unknown [Rickettsia bellii RML369-C]
 gi|157801808|gb|ABV78531.1| hypothetical protein A1I_00645 [Rickettsia bellii OSU 85-389]
          Length = 174

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 68/160 (42%), Gaps = 8/160 (5%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R     +      +  GF+ +  Y+   + P   + +AI+V  G   +IE    LL+  
Sbjct: 2   IRKIALTILTIFAIWASGFV-YYLYLVNSYKPSSNTANAIIVFAGGGHKIETGIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  S     LL++  +   L +  I    + ++ E   ++AS +  K N  
Sbjct: 61  YAPILFITGIETSDQLKNLLKENNV---LEQQVILAPNQIMSEEDYIKKASDFILKYNIT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS----TVQFIPYPIISHD 156
            V +V ++Y +P     L    S     +   PYP+I+  
Sbjct: 118 SVRLVAYNYDIPSIVNNLTTAISSSNNNIYIAPYPVIAKQ 157


>gi|301165835|emb|CBW25408.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 212

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/203 (23%), Positives = 84/203 (41%), Gaps = 19/203 (9%)

Query: 1   MRYFWYGLFVCLIFFIMG------FISFIRYVKQMHIPD--HPSVSAIVVLTGEPIRIER 52
           +RY    +F+ L+  I+       F+   R   Q       + S   IVV TG+  RI  
Sbjct: 16  LRYLQNIVFISLVSIILYAIMSLIFVLIARNYNQETEKTFYNRSPDLIVVFTGDSGRIPL 75

Query: 53  AFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA-S 111
           A +L +      IFI+GV+   S D LL+ + I +++    + I Y A NT  N      
Sbjct: 76  AVQLAKKYKQSNIFITGVYSKNSVDSLLRPLKIDEEIDTNLLTIDYLARNTVENVISTLR 135

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRIN---STVQFIPYPIISHDLEENSSIFKIKI 168
              E+     +++++HDYH+ R  L   ++       Q   Y + S           ++ 
Sbjct: 136 HLRERKGNKKIIVISHDYHVMRIKLIFNKLMEADDDYQLYFYSVESD-------FDNMRN 188

Query: 169 LRVLLIEYLKILLLSIQLSLSTQ 191
           ++++  E  K +     L L + 
Sbjct: 189 IKIVAKEVYKWIRTYGFLMLWSP 211


>gi|332968000|gb|EGK07087.1| protein of hypothetical function DUF218 [Desmospora sp. 8437]
          Length = 190

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 77/171 (45%), Gaps = 22/171 (12%)

Query: 2   RYFWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVV----LTGEPI-----RI 50
           R+ W G+ +CLIF ++   F         + + DHP  +A+V+       +P      R+
Sbjct: 4   RWLWSGVILCLIFALLIIPFWVQASRYDDVRVADHPRDAALVLGAALWDSQPSPALRERL 63

Query: 51  ERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           + A  L      + I  SG      +S+   +++  + Q +    + +  ++ NT+ N Q
Sbjct: 64  QMALSLYHKGQVQWIICSGGVGDDGISEAEGMKRYLMEQGVPPKDLLLEEESTNTKENLQ 123

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTF---------LELQRINSTVQFIPY 150
            +    + N+  ++ +VTHDYHM R+           E   ++S+V F PY
Sbjct: 124 YSKKLLKPNDIQNIYLVTHDYHMYRSLALARQAGIRAEPAPVHSSVLFTPY 174


>gi|169830663|ref|YP_001716645.1| hypothetical protein Daud_0467 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637507|gb|ACA59013.1| protein of unknown function DUF218 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 264

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/189 (20%), Positives = 80/189 (42%), Gaps = 7/189 (3%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLEN 59
           +R    G  V      +   +  R++     P       +VVL+G+   R+E AF L + 
Sbjct: 32  LRNLALGTLVLAAVVWLSLPAVGRFLVVADKPAP--AEVLVVLSGDRGERLEYAFRLYQE 89

Query: 60  QIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
            + +++ +SG   +  +++  LL++  +   + E  I +  +A NT  NA  +    E  
Sbjct: 90  GLADRLLLSGGPLYADLTEADLLRRHALMLGVPEYKIIMEPRATNTYQNALYSREMMEYY 149

Query: 118 NFHHVLIVTHDYHMP--RTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
                ++++  YHM   R   +     S ++ +  P+     +           RV+L E
Sbjct: 150 GLDSAIVISSPYHMRRVRALFDEVYRGSDIRLVYLPVEDSWFDPERWWESAAGRRVVLAE 209

Query: 176 YLKILLLSI 184
           YL++ +L +
Sbjct: 210 YLRLTMLVL 218


>gi|167957605|ref|ZP_02544679.1| hypothetical protein cdiviTM7_02994 [candidate division TM7
           single-cell isolate TM7c]
          Length = 204

 Score = 97.6 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 61/155 (39%), Gaps = 6/155 (3%)

Query: 36  SVSAIVVLTGEP--IRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLA 90
            V AIV ++G     R + A +L +N     +  SG        S    ++K  +++ + 
Sbjct: 46  RVDAIVAVSGGDTDARTDEAVKLYKNGWSNLLIFSGAAADKTGPSNAKAMRKHALKKGVP 105

Query: 91  ECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ-RINSTVQFIP 149
           +  I I   +  T+ NA+ +     +     +++VT  YH  R  +E +      V+ I 
Sbjct: 106 DSAIVIEENSNTTQENARLSRNVFSERKISRIILVTSAYHQRRAGIEFRLAAGGNVEVIN 165

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           +P+       N          + + E +KI+    
Sbjct: 166 HPVAQDKQWSNWWWISPNGWWLAMSEIIKIIATYA 200


>gi|163857424|ref|YP_001631722.1| hypothetical protein Bpet3112 [Bordetella petrii DSM 12804]
 gi|163261152|emb|CAP43454.1| conserved hypothetical protein [Bordetella petrii]
          Length = 252

 Score = 97.6 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 36/208 (17%), Positives = 76/208 (36%), Gaps = 27/208 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------------- 48
           +           ++ G  +       + + + P+  AIVVL G                 
Sbjct: 44  WVLAWSLPATSLWLGG--ALESRYPHLPVAELPTADAIVVLGGNTANGRANWFLPYDKET 101

Query: 49  ---RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
              R++ A +L +     K+ +SG      VS+   +  +  +Q + E  + +   +  T
Sbjct: 102 AVVRVDTAIKLYQAHRAPKVVLSGGALEGDVSEARGMAFLMKQQGVPEDALLLENSSRTT 161

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLEEN 160
             NA       +++ F  +L+VT   HMPR      +          P   ++  D   +
Sbjct: 162 YENAMLTEEELKEHGFGKILLVTSALHMPRAMAAFSKQGVAAIPASTPPQIVLPPDGSVS 221

Query: 161 SSIFKIKIL---RVLLIEYLKILLLSIQ 185
             +  ++ L   R ++ EY  +L+  ++
Sbjct: 222 PWLPHMRTLDASRSIIKEYAGLLVYWLR 249


>gi|294498420|ref|YP_003562120.1| hypothetical protein BMQ_1655 [Bacillus megaterium QM B1551]
 gi|294348357|gb|ADE68686.1| conserved hypothetical protein [Bacillus megaterium QM B1551]
          Length = 198

 Score = 96.9 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 62/173 (35%), Gaps = 8/173 (4%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           + ++   + F  F    + +          I+VL+G+  R+E+  EL +      + +S 
Sbjct: 13  IFMLGLGIIFFLFAGK-ELVVNEKPVKSDVIIVLSGDNDRLEKGIELYKKGYAAHLILS- 70

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
              +  ++    +      + E  I +   A +T  NA+         +F   ++V+ +Y
Sbjct: 71  ---NGQENNFYHQAKES-GIPEDSIILENHATSTTENAKFTKRLMMNYHFQSAIVVSSNY 126

Query: 130 HMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HM R      +      +Q       S               +V   EY+K++
Sbjct: 127 HMKRAEKNFNKEFKDTQIQLTYCSSGSRYYNPQRWWETALNRKVTYTEYVKLI 179


>gi|187478721|ref|YP_786745.1| membrane protein [Bordetella avium 197N]
 gi|115423307|emb|CAJ49841.1| putative membrane protein [Bordetella avium 197N]
          Length = 254

 Score = 96.5 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/208 (17%), Positives = 72/208 (34%), Gaps = 27/208 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------------- 48
           +           ++ G  +       +     P+  AIVVL G                 
Sbjct: 46  WVLVWSLPATSLWLGG--ALEHRYPYLEPDSAPTADAIVVLGGNTANGRANWFLPYDKDT 103

Query: 49  ---RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
              R++ A +L       K+ +SG     +VS+   +     ++ + +  + +   + NT
Sbjct: 104 AVVRVDTATDLYLADRAPKVVLSGGALEGNVSEAQGMAHRMRQRGVPDSALVLENASRNT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLEEN 160
             NA         N+   VL+VT   HMPR      +        P P   +   D   +
Sbjct: 164 YENAALTEDTLRANHISKVLLVTSALHMPRAMAAFSKQGVEAIAAPTPPQIVPPTDGSLS 223

Query: 161 SSIFKIKIL---RVLLIEYLKILLLSIQ 185
             +  ++ L   R ++ EY  +L+  ++
Sbjct: 224 PWMPDMRTLDASRSIIKEYAGLLVYWLR 251


>gi|295703757|ref|YP_003596832.1| hypothetical protein BMD_1626 [Bacillus megaterium DSM 319]
 gi|294801416|gb|ADF38482.1| conserved hypothetical protein [Bacillus megaterium DSM 319]
          Length = 198

 Score = 95.7 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/173 (16%), Positives = 62/173 (35%), Gaps = 8/173 (4%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           + ++   + F  F    + +          I+VL+G+  R+E+  EL +      + +S 
Sbjct: 13  IFMLGLGIIFFLFAGK-ELVVNEKPVKSDVIIVLSGDNDRLEKGIELYKKGYASHLILS- 70

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
              +  ++    +      + E  I +   A +T  NA+         +F   ++V+ +Y
Sbjct: 71  ---NGQENNFYHQAKES-GIPEDSIILENHATSTTENAKFTKRLMMNYHFQSAIVVSSNY 126

Query: 130 HMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HM R      +      +Q       S               +V   EY+K++
Sbjct: 127 HMKRVEKNFNKEFKDTQIQLTYCSSGSRYYNPQRWWETALNRKVTYTEYVKLI 179


>gi|293604449|ref|ZP_06686856.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292817326|gb|EFF76400.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 254

 Score = 93.4 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 68/210 (32%), Gaps = 27/210 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------ 48
           + +           ++ G  +       +   D P+  AIVVL G               
Sbjct: 44  LLWALAWSLPVTSLWLGG--ALENRYPHLAPADSPTADAIVVLGGNTANGRANWFLPYDK 101

Query: 49  -----RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
                R++ A +L       K+ +SG      VS+   +     +Q + E  + +   + 
Sbjct: 102 DTAVVRVDTAAQLYLAGRAPKVLLSGGALEGDVSEARGMAHAIRQQGVPESALILENSSR 161

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLE 158
            T  NA       +      VL+VT   HMPR      +        P P   +   D  
Sbjct: 162 TTYENAALTEDALKSRGITKVLLVTSALHMPRAMAAFSKQGVEAIAAPAPPQIVAPADGS 221

Query: 159 ENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
            +  +   +     R ++ EY  + +  ++
Sbjct: 222 LSPWVPDQRTFDASRSIIKEYAGLFVYWLR 251


>gi|183220138|ref|YP_001838134.1| hypothetical protein LEPBI_I0726 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910258|ref|YP_001961813.1| hypothetical protein LBF_0703 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774934|gb|ABZ93235.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778560|gb|ABZ96858.1| Conserved hypothetical protein; putative membrane protein
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 258

 Score = 92.6 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/219 (20%), Positives = 81/219 (36%), Gaps = 35/219 (15%)

Query: 5   WYGLFVCLIFFIMG--FIS--FIRYVKQMHIP----DHPSVS-AIVV------------- 42
           +    +CL  ++    FI+   +  +++ + P    D P V  AIV+             
Sbjct: 40  FLFFIICLFLYLASSSFIANRLVTELEKEYPPVSLQDAPKVDVAIVLGGMIQTISSVKAR 99

Query: 43  --LTGEPIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCID 95
             LT    RI  A  L +    +KI  +G        +  +  L + + I   + E  I 
Sbjct: 100 PELTDSADRITDAIRLYKAGKVKKILFTGGSGLLLSDTYREADLAKSLFIDLGVKEEDII 159

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +   + NT  NA E      + NF   L++T  +HM R+    Q+ N  V   P    S 
Sbjct: 160 LENNSRNTHENAVETKKILMEKNFQSFLLITSAFHMKRSLGCFQKQNLNVFPFPTDYRSF 219

Query: 156 DLEEN------SSIFKIKILRVLLIEYLKILLLSIQLSL 188
           + +         S   + +  + + E++   +   +  L
Sbjct: 220 NTDSGAFELYLPSAGYLDLTTLSIKEWVGYFVYRTKSYL 258


>gi|332283765|ref|YP_004415676.1| membrane protein [Pusillimonas sp. T7-7]
 gi|330427718|gb|AEC19052.1| membrane protein [Pusillimonas sp. T7-7]
          Length = 254

 Score = 92.2 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/220 (18%), Positives = 87/220 (39%), Gaps = 35/220 (15%)

Query: 1   MRYFWYGLFVCLIFFIMGF------ISFIRYVKQMHI----PDHPSVSAIVVLTG----E 46
           +R   + + V  + + + +      +     ++Q+H      + P+  AIVVL G     
Sbjct: 32  LRKTAFVIAVAGLSWALFWSLPASSLWAGGRLEQLHPYEQAANAPTAQAIVVLGGHTANG 91

Query: 47  PI-------------RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAE 91
                          RI++A  L + Q    I +SG     +VS+  ++     + D+ E
Sbjct: 92  RQNWFEPYDKATAIARIDKAANLYKAQRAPLIVVSGAALEGNVSEAQIMANALKQHDIPE 151

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             I +  ++  T  NA   +    + +  ++L+VT   HMPR     ++        P  
Sbjct: 152 SAIIMESRSFTTHENAIYTAETLRQRHIQNILLVTSALHMPRAMAVFKKQGIAAIAAPLA 211

Query: 152 ---IISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
              ++  D   +     ++ L   R ++ EY+ +L+  ++
Sbjct: 212 PQIVVPDDPGFSFWQPDMRSLAASRSIVKEYVGLLVYWVR 251


>gi|33596348|ref|NP_883991.1| hypothetical protein BPP1716 [Bordetella parapertussis 12822]
 gi|33602366|ref|NP_889926.1| hypothetical protein BB3392 [Bordetella bronchiseptica RB50]
 gi|33566117|emb|CAE37017.1| conserved hypothetical membrane protein [Bordetella parapertussis]
 gi|33576805|emb|CAE33884.1| conserved hypothetical membrane protein [Bordetella bronchiseptica
           RB50]
          Length = 254

 Score = 91.5 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 68/210 (32%), Gaps = 27/210 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------ 48
           + +           ++ G  +       +     P+  AIVVL G               
Sbjct: 44  LLWALAWSLPATSLWLGG--ALESRYPHLPPDQSPTADAIVVLGGNTANGRANWFLPYDK 101

Query: 49  -----RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
                R++ A EL +     K+ +SG      +S+   +     +  + E  + +   + 
Sbjct: 102 ETAVVRVDTATELFQAGRAPKVVLSGGALEGDISEARGMAYRMRQHGVPESALILENASR 161

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLE 158
            T  NA        ++    VL+VT   HMPR      +        P P   +   D  
Sbjct: 162 TTYENAALTEDTLRQHGIQKVLLVTSALHMPRAMAAFSKQGVQAIAAPAPPQIVAPADGS 221

Query: 159 ENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
            +  +   +     R ++ EY  + +  ++
Sbjct: 222 LSPWLPDQRSFDASRSIIKEYAGLFVYWLR 251


>gi|33593317|ref|NP_880961.1| hypothetical protein BP2323 [Bordetella pertussis Tohama I]
 gi|33572673|emb|CAE42596.1| conserved hypothetical membrane protein [Bordetella pertussis
           Tohama I]
 gi|332382726|gb|AEE67573.1| hypothetical protein BPTD_2282 [Bordetella pertussis CS]
          Length = 254

 Score = 91.5 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 68/210 (32%), Gaps = 27/210 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------ 48
           + +           ++ G  +       +     P+  AIVVL G               
Sbjct: 44  LLWALAWSLPATSLWLGG--ALESRYPHLPPDQSPTADAIVVLGGNTANGRANWFLPYDK 101

Query: 49  -----RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
                R++ A EL +     K+ +SG      +S+   +     +  + E  + +   + 
Sbjct: 102 ETAVVRVDTATELFQAGRASKVVLSGGALEGDISEARGMAYRMRQHGVPESALILENASR 161

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLE 158
            T  NA        ++    VL+VT   HMPR      +        P P   +   D  
Sbjct: 162 TTYENAALTEDTLRQHGIQKVLLVTSALHMPRAMAAFSKQGVQAIAAPAPPQIVAPADGS 221

Query: 159 ENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
            +  +   +     R ++ EY  + +  ++
Sbjct: 222 LSPWLPDQRSFDASRSIIKEYAGLFVYWLR 251


>gi|317407644|gb|EFV87583.1| hypothetical protein HMPREF0005_04608 [Achromobacter xylosoxidans
           C54]
          Length = 254

 Score = 91.1 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 71/220 (32%), Gaps = 35/220 (15%)

Query: 1   MRYFWYGLFVCLIFFIMGF----------ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-- 48
           +R     L +  + + + +           +       +   + P+  AIVVL G     
Sbjct: 32  LRKTGGALILAGLLWALAWSLPVTSLWLGGALENRYPHLPPAESPTADAIVVLGGNTANG 91

Query: 49  ---------------RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAE 91
                          R++ A +L       K+ +SG      VS+   +     +Q + E
Sbjct: 92  RANWFLPYDKDTAVVRVDTAAQLYLAGRAPKVVLSGGALEGDVSEARGMAHAIRQQGVPE 151

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             + +   +  T  NA       +      VL+VT   HMPR      +        P P
Sbjct: 152 SALILENASRTTYENAALTEDQLKTRGIGKVLLVTSALHMPRAMAAFSKQGVIAIAAPAP 211

Query: 152 ---IISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
              +   D   N  +   +     R ++ EY  + +  ++
Sbjct: 212 PQIVAPADGSLNPWLPDQRTFDASRSIIKEYAGLFVYWLR 251


>gi|311105207|ref|YP_003978060.1| hypothetical protein AXYL_02016 [Achromobacter xylosoxidans A8]
 gi|310759896|gb|ADP15345.1| hypothetical protein AXYL_02016 [Achromobacter xylosoxidans A8]
          Length = 254

 Score = 89.9 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 70/220 (31%), Gaps = 35/220 (15%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYV----------KQMHIPDHPSVSAIVVLTGEPI-- 48
           +R     L V  + + + +      +            +   + P+  AIVVL G     
Sbjct: 32  LRKTGGALIVAGLLWALAWSLPATSLWLGGALESRYPHLAPSESPTADAIVVLGGNTANG 91

Query: 49  ---------------RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAE 91
                          R++ A +L       K+ +SG      VS+   +     +Q + E
Sbjct: 92  RANWFLPYDKDTAVVRVDTAAQLYLAGRAPKVLLSGGALEGDVSEARGMAHAIRQQGVPE 151

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             + +   +  T  NA       +      VL+VT   HMPR      +        P P
Sbjct: 152 TALILENSSRTTYENAALTEDQLKSRGIGKVLLVTSALHMPRAMAAFSKQGVEAVAAPAP 211

Query: 152 ---IISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
              +   D      +   +     R ++ EY  + +  ++
Sbjct: 212 PQIVAPADGSLPLWLPDQRTFDASRSIIKEYAGLFVYWLR 251


>gi|254423832|ref|ZP_05037550.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
 gi|196191321|gb|EDX86285.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
          Length = 263

 Score = 89.9 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 78/235 (33%), Gaps = 54/235 (22%)

Query: 3   YFWY-----GLFVCLIFFIMGF---------ISFIRYVKQMHIPDHPSVSAIVVLTGE-- 46
           + W         + L  FI+ F         +      +       P+  AIVVL G   
Sbjct: 28  WLWRHPRRASGAIALALFILFFSSNPIVSNKLLSSLEWRYFPPDPVPTADAIVVLGGATV 87

Query: 47  --------------PIRIERAFELLENQIGEKIFISGV------HHSVSKDILLQKIPIR 86
                           RI  A  L       K+ +SG           S+   ++   + 
Sbjct: 88  PAIAPRPWVEVSEAGDRILYAARLYNQGRAPKLILSGGRVQWRGGSDESEADDMKAFAMA 147

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
            ++ E  I +   +LNT  NA          +   VL+VT   HMPR+    Q++   + 
Sbjct: 148 MNVPEADIILEETSLNTRQNAVNVKKILAAQSIDSVLLVTSAVHMPRSVAIFQKL--DID 205

Query: 147 FIPYP----IISHDLEENSSIFKIKILRVL------------LIEYLKILLLSIQ 185
            IP P    + +   E      + +IL +L            + EY+  ++  ++
Sbjct: 206 VIPAPTDYLVTTPSDESGEITIEGRILSLLPRAEATGRFTRAMKEYVGFVIYRLR 260


>gi|227827121|ref|YP_002828900.1| hypothetical protein M1425_0793 [Sulfolobus islandicus M.14.25]
 gi|229584289|ref|YP_002842790.1| hypothetical protein M1627_0798 [Sulfolobus islandicus M.16.27]
 gi|227458916|gb|ACP37602.1| protein of unknown function DUF218 [Sulfolobus islandicus M.14.25]
 gi|228019338|gb|ACP54745.1| protein of unknown function DUF218 [Sulfolobus islandicus M.16.27]
          Length = 180

 Score = 88.0 bits (217), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 6/101 (5%)

Query: 38  SAIVVLTGE---PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCI 94
            AIVVL G      RI+ A  L +  I + + I G    VS   + +K+  +    E  +
Sbjct: 3   DAIVVLGGGKLSEGRIDEAIRLYKQGIAKYLIIVGGKEEVS--EMYKKVRSKIQNIEN-V 59

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
            +   +L+T  NA  A    EK N   +LIVT ++H+ R  
Sbjct: 60  YVDNNSLSTADNAYYAKKIIEKLNIKSILIVTSNFHIKRAL 100


>gi|188996942|ref|YP_001931193.1| protein of unknown function DUF218 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932009|gb|ACD66639.1| protein of unknown function DUF218 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 242

 Score = 87.6 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 69/176 (39%), Gaps = 22/176 (12%)

Query: 32  PDHPSVSAIVVLTGEP-----------IRIERAFELLENQIGEKIFISGVHHSVSK--DI 78
           P + S   IVVL G              R+   F +L  ++   I +SG     +     
Sbjct: 69  PKNISGDVIVVLGGGSYNTGILTEDSLKRVLTGF-VLHKRLNVPIILSGGSAITNLPESE 127

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
            ++ +     + +  I    ++ +T  NA       +K  +  V++VT  YHMPR+++  
Sbjct: 128 AMKSLLAELGIDKKMIFTDVQSRDTLENAFFTKKICKKYGYKTVILVTSAYHMPRSYMTF 187

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVL------LIEYLKILLLSIQLSL 188
           ++    V  IPYP      ++ +       + VL      + EY+ +    ++ S 
Sbjct: 188 KQAGLNV--IPYPTDFKMDKKYTVYSYFPKMNVLQDSTKAIREYIGLFAYYLRFSF 241


>gi|225849301|ref|YP_002729465.1| hypothetical protein SULAZ_1499 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644421|gb|ACN99471.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 242

 Score = 87.6 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 80/206 (38%), Gaps = 34/206 (16%)

Query: 10  VCLIFFIMGFISFIRYVKQM------------HIPDHPSVSAIVVLTGEP---------- 47
           + ++ F+  F  ++  ++ +             IP+  +   IVVL G            
Sbjct: 35  IFIVSFLSAFFIYLLSIEPVKDSLLRPLETKYPIPNKLNGDVIVVLGGGSYNTGILTEDS 94

Query: 48  -IRIERAFELLENQIGEKIFISGVHHSVSK--DILLQKIPIRQDLAECCIDIGYKALNTE 104
             R+   F +L  ++   I +SG     +     +++ I     + +  I     + +T 
Sbjct: 95  LKRVLTGF-VLHKKLNLPIILSGGSAITNLPEAEVMKNILNELGVDKSMIYTDVNSRDTL 153

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           GNA       EKN F  +++VT  YHMPR+ +  Q+    V  IPYP      +  +   
Sbjct: 154 GNAFFVKKICEKNGFKRIILVTSAYHMPRSVIVFQKAGLDV--IPYPTDFKMDKRYTVYS 211

Query: 165 KIKILRVL------LIEYLKILLLSI 184
               + VL      + EY+ ++   +
Sbjct: 212 YFPKMNVLQDSTKAIREYVGLIAYQL 237


>gi|288817420|ref|YP_003431767.1| hypothetical protein HTH_0099 [Hydrogenobacter thermophilus TK-6]
 gi|288786819|dbj|BAI68566.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
 gi|308751027|gb|ADO44510.1| protein of unknown function DUF218 [Hydrogenobacter thermophilus
           TK-6]
          Length = 240

 Score = 86.5 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 20/176 (11%)

Query: 31  IPDHPSVSAIVVLTGEP-----------IRIERAFELLENQIGEKIFISGVHHSVSKDIL 79
           +P+     AIVVL G              R+  A  +L  + G  I +SG   ++    +
Sbjct: 68  VPEKFQADAIVVLGGGSYSTGILKEDSMKRLLTAL-ILHKRTGLPIVLSGGAENLPDAEI 126

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           ++ + +   + +  I    ++ +TE NA       ++ N+  V++VT  YH+PR     +
Sbjct: 127 MKSLLVELGVDKRDIITEVRSRDTEENASYVREICQQRNYKSVVLVTSAYHLPRAVFLFK 186

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
           +    +  IPYP         +    +  + VL      L EY+ +L L +   L 
Sbjct: 187 K--EGLSVIPYPTDFKRDLRYNLYSLLPKMSVLNDSVKALREYVALLSLRLPEWLP 240


>gi|308070011|ref|YP_003871616.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
 gi|305859290|gb|ADM71078.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
          Length = 249

 Score = 86.1 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 53/199 (26%), Positives = 75/199 (37%), Gaps = 32/199 (16%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------------IRIERAFELL 57
           + G +      KQ   P       IVVL G                     R+  A  L 
Sbjct: 54  LAGDLLISSLEKQYPQPRTVQGDVIVVLGGGATQGTPDINGQGNLLGSAANRLLTAARL- 112

Query: 58  ENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
               G  I  SG      S ++  + Q+  +   +    I I  ++LNT+ NA   S   
Sbjct: 113 HEATGLPILFSGGQVFGDSGNEANIAQRQLLGLGIPAKDILIENRSLNTQQNAVYTSQIL 172

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDL-----EENSSIFKI 166
           EK+     ++VT  +HMPR  LE QR    VQ I YP   + S  L     + + S   +
Sbjct: 173 EKHQLTRPVLVTSAFHMPRAALEFQRA--GVQAIAYPTDYLASEKLSLYAGKLSPSAGAM 230

Query: 167 KILRVLLIEYLKILLLSIQ 185
                 L EYL IL L ++
Sbjct: 231 STTGTALKEYLGILALKLK 249


>gi|254481130|ref|ZP_05094376.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
 gi|214038925|gb|EEB79586.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
          Length = 245

 Score = 85.3 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 39/212 (18%), Positives = 73/212 (34%), Gaps = 33/212 (15%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDH--PSVSAIVVLTGE----------------P 47
             L+ C    +  F+                P V AIVVL G                  
Sbjct: 38  VWLYACSTALVADFLMASLEDDFRPKAMSVVPKVDAIVVLGGATRGDTYWSSMADLNAAA 97

Query: 48  IRIERAFELLENQIGEKIFISGVHHSVSK--DILLQKIPIRQDLAECCIDIGYKALNTEG 105
            R+  A  L + +    + +SG   + S+     L+   +   L +  + +  ++L+T+ 
Sbjct: 98  DRLTHAVSLYKAKKAPLVLLSGGSTTGSRPEAEQLRDYMVLMGLPDRALLMERQSLDTQQ 157

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV--------QFIPYPIISHDL 157
           NA+ ++   +  +   +L+VT  YHM R     +R    V        + +  P +   L
Sbjct: 158 NARYSALILQGRDVRRILLVTSAYHMSRAVPLFERQGFEVIPAPTDYQRLVGKPAVPRWL 217

Query: 158 E-ENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
              +        ++    EY+  L    Q  L
Sbjct: 218 PTADDLWRSTAAIK----EYVGFLYYRAQGWL 245


>gi|317485960|ref|ZP_07944815.1| DUF218 domain-containing protein [Bilophila wadsworthia 3_1_6]
 gi|316922733|gb|EFV43964.1| DUF218 domain-containing protein [Bilophila wadsworthia 3_1_6]
          Length = 185

 Score = 84.5 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 77/194 (39%), Gaps = 14/194 (7%)

Query: 1   MRYFWYG----LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFE 55
           M   WYG    L +  +      I        + +P       IVVL GE   R+  A E
Sbjct: 1   MGQGWYGAIGKLAIAALLIGAVLIWRAEAWLHVDVPLE-HADVIVVLGGESGQRVIGAAE 59

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           L    +  K+F++G   S    ++++++ +       C     ++ +T  NA       E
Sbjct: 60  LYHQGVAPKVFVTG---SGDGGLIVRRLGMAGVPDAAC---ESQSRSTYENAVLTKKALE 113

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            ++   V++VT  +H  R     + +   V F  +P+ +         F+I  +  +  E
Sbjct: 114 ASHPRSVMLVTSWFHSRRALAVFRDVWPEVTFGVHPVYAGATFTAR--FRIYEMGYIFSE 171

Query: 176 YLKILLLSIQLSLS 189
           Y+K L   ++  ++
Sbjct: 172 YVKTLWYMVRYGIA 185


>gi|239833683|ref|ZP_04682011.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239821746|gb|EEQ93315.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 206

 Score = 83.8 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/187 (19%), Positives = 70/187 (37%), Gaps = 11/187 (5%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIG 62
               +  C I F +  + F + V  +   D      IVV  G  P R  +A  L +    
Sbjct: 2   MLLVVLPCAILFGIAAMFFSQPVLTLQ-DDGGRADVIVVPGGDGPPRAAQAARLWKEGRS 60

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQD-LAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
             I ++G    +    ++ +  +    +   C     ++ +T  NAQ ++    +     
Sbjct: 61  PVILVTGDGDCLYNKRIMVRNGVNPSAIFVEC-----QSGSTWQNAQFSAPVLREIRARS 115

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--I 179
            L+VT+ YH  R     +     ++FI  PI   D            + ++  EY+K   
Sbjct: 116 ALVVTNWYHSRRAIASFRAACPQMRFISSPIGGDDGR-PGFPATPADMELVAKEYVKLGW 174

Query: 180 LLLSIQL 186
            L+S ++
Sbjct: 175 YLVSGRI 181


>gi|153010699|ref|YP_001371913.1| hypothetical protein Oant_3378 [Ochrobactrum anthropi ATCC 49188]
 gi|151562587|gb|ABS16084.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 206

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 66/174 (37%), Gaps = 9/174 (5%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIF 66
           +  C + F +  + F   V  +   D      IVV  G  P R   A  L +      I 
Sbjct: 6   ILPCAVLFGLVAMFFSEPVLTLQ-DDGGRADVIVVPGGDGPPRAAEAARLWKEGRSPVIL 64

Query: 67  ISGVHHSVSKDILLQKIPI-RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           ++G    +S   ++ +  +    +   C     ++ +T  NA+ ++    +      LIV
Sbjct: 65  VTGDGDCLSNKRIMVRKGVTPSAIFVEC-----QSGSTWQNARFSAPLMREIQARSALIV 119

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
           T+ YH  R     +     ++FI  PI   D            + +++ EY+K+
Sbjct: 120 TNWYHSRRAIASFRAACPQMRFISSPIGGDDGR-PGFPTTPTDMELVVKEYVKL 172


>gi|78045108|ref|YP_360909.1| hypothetical protein CHY_2090 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77997223|gb|ABB16122.1| conserved hypothetical protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 203

 Score = 82.6 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 76/196 (38%), Gaps = 17/196 (8%)

Query: 3   YFWYGLFVCLIFFIMGF-ISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIRI 50
           + ++GL +  +     F +++   +      +     A+VVL+G              R+
Sbjct: 8   FAFFGLTLIFLIAAWFFPLNYYLALPLTIKENPQPADAVVVLSGGLTKKGDLGESTRERL 67

Query: 51  ERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
                L +N  G  + +SG   +       L+ K  +++ +    + +   + NT  N  
Sbjct: 68  NLGINLWKNDYGRYLLLSGGSFTREPKDASLMAKEALKKGVPAPALLLESSSENTYENVL 127

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             +    +N +  +L+VT  YH  R              + YP  + +L     + +++ 
Sbjct: 128 LTANIYYQNRWKRILVVTSAYHTLRVKKMYNDRGVNATVV-YP--AGELPNARGLLRLRQ 184

Query: 169 LRVLLIEYLKILLLSI 184
             V++ EYLK+L   I
Sbjct: 185 TIVVVEEYLKLLYYFI 200


>gi|270157480|ref|ZP_06186137.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289164131|ref|YP_003454269.1| hypothetical protein LLO_0787 [Legionella longbeachae NSW150]
 gi|269989505|gb|EEZ95759.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288857304|emb|CBJ11131.1| hypothetical protein LLO_0787 [Legionella longbeachae NSW150]
          Length = 197

 Score = 82.2 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 74/197 (37%), Gaps = 22/197 (11%)

Query: 8   LFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVL-TGEPI----------RIERAF 54
           +F+  +    G  F   +  ++     +      I+VL T              R++ A 
Sbjct: 7   VFIFFLILSAGIYFSLALYIIRNAEKDEKKHADVIIVLGTKSYHGDKYNPCLVARVQHAV 66

Query: 55  ELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           +L +     K+  SG   +    S+  ++++I +   ++E  I +   + +T  N   + 
Sbjct: 67  DLYKANYAPKLLFSGGKDTKNGPSEAQVMKEIALHLGVSEQDILLESASASTYENLLFSE 126

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV 171
                  F+ +L+VT  +H+PR  L  Q++   V        S  ++           R 
Sbjct: 127 KIVSAKKFNSILLVTEPFHLPRAILVAQKLGLKVS------GSPAIQSLCWQKNSYFSRH 180

Query: 172 LLIEYLKILLLSIQLSL 188
            L E L I+   I+  L
Sbjct: 181 FLREPLAIIYYKIKNQL 197


>gi|147677433|ref|YP_001211648.1| hypothetical protein PTH_1098 [Pelotomaculum thermopropionicum SI]
 gi|146273530|dbj|BAF59279.1| uncharacterized conserved protein [Pelotomaculum thermopropionicum
           SI]
          Length = 148

 Score = 81.8 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 55/148 (37%), Gaps = 5/148 (3%)

Query: 40  IVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYK 99
           I+ L G+  R   A EL    +  +I +SG   +  +   +        + E  I +  K
Sbjct: 2   IIALGGDSERELYAAELYRRGLAPRIIMSGCGSAAKQ---MAMKAAAAGVGEQDIIVENK 58

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDL 157
           + +T  NA           F   ++VT  YHM R  L  +R+     V+       +   
Sbjct: 59  SGSTYQNALYTKDIVLSRGFKSAIVVTSPYHMRRARLVFERVFRNTGVKLFYCAAKNSGF 118

Query: 158 EENSSIFKIKILRVLLIEYLKILLLSIQ 185
             +         ++ L E++K++    +
Sbjct: 119 NADGRCSSKADRQITLREWIKLVYYWFR 146


>gi|163783486|ref|ZP_02178477.1| hypothetical protein HG1285_08734 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881250|gb|EDP74763.1| hypothetical protein HG1285_08734 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 239

 Score = 81.8 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 67/185 (36%), Gaps = 24/185 (12%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IRIERAFELLENQIGEKIFIS 68
           + F         P       IVVL G              R+   F LL  + G+ + +S
Sbjct: 57  VLFYPLESPFKTPKRIRGDVIVVLGGGAYNSGYLKASSYKRLIAGF-LLHRRTGKPLILS 115

Query: 69  G-----VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           G     V        +++++ +   + E  I    ++ +T  NA+      EK     + 
Sbjct: 116 GGAAIGVIPEAK---VMKELLLEFGVEEKDIYADLRSRDTYENAKYVRNICEKIGCRSIT 172

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPI-ISHDLEENSSIFKIKIL---RVLLIEYLKI 179
           +VT  +HM R  +  ++    VQ  P  +         S+  K  +     + + EY+ +
Sbjct: 173 LVTSAFHMRRALMVFKKTGLEVQPYPTDLKFEGRYNLYSAFPKYSVFYDSSIAIREYVGL 232

Query: 180 LLLSI 184
           L  S+
Sbjct: 233 LFYSL 237


>gi|320161035|ref|YP_004174259.1| hypothetical protein ANT_16330 [Anaerolinea thermophila UNI-1]
 gi|319994888|dbj|BAJ63659.1| hypothetical protein ANT_16330 [Anaerolinea thermophila UNI-1]
          Length = 202

 Score = 81.8 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 66/184 (35%), Gaps = 13/184 (7%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--IRIERAFELLENQIGEKIFI 67
           +C+  F++G I  +  +     P      AIVVL+G     R+E+A  L++      + +
Sbjct: 21  LCITPFLLGSIGSLLVISTPLQP----ADAIVVLSGGRDLQRLEKAVNLMKEGQAGYLIL 76

Query: 68  SGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +           + D L  +   R       +     + NTE  A        +  +  +
Sbjct: 77  TKTEDITESGRQTADYLASEAHQRGIPVPKIVITQKTSKNTEQEAIATLEILRERGWKTL 136

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIIS--HDLEENSSIFKIKILRVLLIEYLKIL 180
           ++VT  YH  R+ +  + +        Y + S   D+            R +  E L +L
Sbjct: 137 IVVTDPYHTLRSRIIFREVMRKDSIKVYTVPSKKPDVPSWLWYIDGNSRRAVWREILSLL 196

Query: 181 LLSI 184
              +
Sbjct: 197 AYLL 200


>gi|269963292|ref|ZP_06177623.1| hypothetical protein VME_40070 [Vibrio harveyi 1DA3]
 gi|269831931|gb|EEZ86059.1| hypothetical protein VME_40070 [Vibrio harveyi 1DA3]
          Length = 207

 Score = 81.8 bits (201), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 58/143 (40%), Gaps = 8/143 (5%)

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEG 105
           ++  A  L + +   K+ +SG + ++ +      +++  +   + +  I +   A NT  
Sbjct: 62  KMPTAVRLYKEKKVSKLLLSGGNLAIDQKPEFESMKEYALDNGVPDSDIILERHAKNTVE 121

Query: 106 NAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSS 162
           NAQ +S    ++      V I+T  +H+ R     +      ++   Y +       ++ 
Sbjct: 122 NAQYSSEIILESEIAKRSVAILTTAFHIKRAKYLFKNALPQYLELHSYFVNDRSTRRDNW 181

Query: 163 I-FKIKILRVL-LIEYLKILLLS 183
              +  I RV+   E +K L + 
Sbjct: 182 WLTESAISRVMHSHEVIKRLGVK 204


>gi|325681016|ref|ZP_08160548.1| hypothetical protein CUS_5709 [Ruminococcus albus 8]
 gi|324107245|gb|EGC01529.1| hypothetical protein CUS_5709 [Ruminococcus albus 8]
          Length = 193

 Score = 81.4 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 65/168 (38%), Gaps = 14/168 (8%)

Query: 33  DHPSVSAIVVLTGEPI----RIERAFELLENQIGEKIFISGVH-HSVSKDIL-----LQK 82
           D  +   I+VL G       R+  A  L ++     +  SG      +   +     ++ 
Sbjct: 27  DGSAADLIMVL-GSRKACEYRVPEAVRLYKSGRAPMMLFSGGKVQKTALGEMAEWLSMET 85

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK--NNFHHVLIVTHDYHMPRTFLELQR 140
             I   ++E  I +   ++NT  N   +     +   +   +++VT  YHM R  L  ++
Sbjct: 86  AAISLGVSERDILLEKCSMNTAENFSCSENLLREVLPDGGRIILVTTAYHMRRALLTAEK 145

Query: 141 INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
           I    +FI  P+      + +     K  R +L E+ K L   I+  +
Sbjct: 146 ILPQYEFISCPVQKGSATKENWYKTDKGRRTVLDEWGK-LRYYIRAGI 192


>gi|160913536|ref|ZP_02076227.1| hypothetical protein EUBDOL_00012 [Eubacterium dolichum DSM 3991]
 gi|158434088|gb|EDP12377.1| hypothetical protein EUBDOL_00012 [Eubacterium dolichum DSM 3991]
          Length = 185

 Score = 81.4 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 70/184 (38%), Gaps = 20/184 (10%)

Query: 11  CLIFFIMGFISFIRYVKQMHIP-----DHPSVSAIVVL-----TGEP------IRIERAF 54
            +I  I  F  F         P      H      +VL     T          R++ A 
Sbjct: 1   MMIIIICLFFLFASCYPYHRFPLYIQQTHQGYDVCIVLGSPSNTDGSLSRIQKQRMDHAI 60

Query: 55  ELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L +    +KI ISG  V +   +  +++   I Q++ E  I +   A NT  N + A+ 
Sbjct: 61  TLYQKGSIQKILISGAAVANCFIEAEVMKDYAIAQNVPEKDILLEKYAKNTYENLKYAAD 120

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
              K++F   +IVT  +H+ R     Q+  +   F  YP+   + +       +++   L
Sbjct: 121 LCNKHHFSKTIIVTSGFHIRRAGFFAQKFLTDFTF--YPVSEKENQRYFITEYLRMWNTL 178

Query: 173 LIEY 176
             E+
Sbjct: 179 YYEW 182


>gi|116329099|ref|YP_798819.1| hypothetical protein LBL_2520 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330291|ref|YP_800009.1| hypothetical protein LBJ_0560 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116121843|gb|ABJ79886.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123980|gb|ABJ75251.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 273

 Score = 81.1 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 71/195 (36%), Gaps = 30/195 (15%)

Query: 25  YVKQMHIPDHPSVSAIVVLTG----------------EPIRIERAFELLENQIGEKIFIS 68
           Y   + +   P    I+VL G                   R+     L   +   KI  S
Sbjct: 68  YYPPLPLEQVPRADVILVLGGMVSTLSIHNKPVDLSNSAERLTETVRLYRAKKAPKILFS 127

Query: 69  GV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           G      + +V +     +   +  + +  + +  K+ NT  N   A    +K+ +  V+
Sbjct: 128 GGSGNLLYQTVPESEPAGRFLKQMGIPDSSLILESKSRNTVENKNFAVELLKKHGWSSVI 187

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPII----SHDLEENSSIFKIKILR---VLLIEY 176
           +VT  +HM R+    Q     +  IP+P         L  ++       L    + + E+
Sbjct: 188 LVTSSFHMKRSVEIFQE--KGITIIPFPTDFRTQKSVLTLDNFFPSTGCLENSTISIKEW 245

Query: 177 LKILLLSIQLSLSTQ 191
           + IL+  I+ ++S Q
Sbjct: 246 IGILVHKIRTTISIQ 260


>gi|291532233|emb|CBL05346.1| Uncharacterized conserved protein [Megamonas hypermegale ART12/1]
          Length = 194

 Score = 81.1 bits (199), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 58/143 (40%), Gaps = 24/143 (16%)

Query: 30  HIPDHPSVSAIVVLTGEP------------------IRIERAFELLENQIGEKIFISGV- 70
                P+   I+VL G                     R+  A  L + ++G  I +SG  
Sbjct: 12  PPKHLPNADVIIVLGGGATGDTPDVTGTGTLCSIPANRLLTAVRL-QKKLGIPIIVSGGQ 70

Query: 71  --HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
               S  +  + ++I     ++E  I +  ++LNT  NA+ ++   +   +   L+VT  
Sbjct: 71  IYEDSGREADIARRILKELGVSEDMILLENRSLNTTQNAEYSTNILKSRKYKQPLLVTSA 130

Query: 129 YHMPRTFLELQRINSTVQFIPYP 151
           +HM R  +   ++   V  IPYP
Sbjct: 131 FHMERAVVNFNKL--GVDVIPYP 151


>gi|304309671|ref|YP_003809269.1| hypothetical protein HDN1F_00190 [gamma proteobacterium HdN1]
 gi|301795404|emb|CBL43602.1| conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 256

 Score = 80.7 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 59/171 (34%), Gaps = 28/171 (16%)

Query: 5   WYGLFVCL-----IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------------- 46
           + GL V +     +  +  + S       +   + P    IVVL G              
Sbjct: 41  FLGLVVLVFASMPLVAVGLWKSLEGRYPILVPSEQPKADVIVVLGGGIALPEPPQVVPDL 100

Query: 47  ---PIRIERAFELLENQIGEKIFISG--VHHS---VSKDILLQKIPIRQDLAECCIDIGY 98
                R+  A EL        + +SG  V       S+    +K+  R  +    I +  
Sbjct: 101 NDAADRVWYAAELYHAGKAPWVVVSGGQVFPRSGLESEAEYHRKLLERMGVPAEAILVES 160

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            + +T GNA   +A   +  F   L+VT   HMPR  L  +     V  +P
Sbjct: 161 ASRDTAGNAMLTAALMRERKFQKALLVTSAAHMPRAVLLFEHA--GVDVVP 209


>gi|320530702|ref|ZP_08031746.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
 gi|320136989|gb|EFW28927.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
          Length = 258

 Score = 80.7 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 65/153 (42%), Gaps = 25/153 (16%)

Query: 21  SFIRYVKQMHI-PDHPSVSAIVVLTGEP------------------IRIERAFELLENQI 61
            F+  +++ +  P+HP    I++L G                     R+  A  L     
Sbjct: 66  LFMGSLERTYPVPEHPQGDVIIMLGGGAIGGVQDVDGEGMLAPSPASRLLTAVRL-HRLY 124

Query: 62  GEKIFISG--VHHSV-SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
           G  I +SG  V     ++  + +++ I   + E  I    ++L T  NA+ ++    +  
Sbjct: 125 GLPILLSGGQVFKDTGTEAEIARRVLISLGVPEEQIYTESESLTTRQNARYSAEILHREG 184

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
           F H ++VT  +H+PR  L  +++   ++  PYP
Sbjct: 185 FTHPILVTSAFHLPRAVLNFEKL--GIEVTPYP 215


>gi|37523632|ref|NP_927009.1| hypothetical protein gll4063 [Gloeobacter violaceus PCC 7421]
 gi|35214637|dbj|BAC92004.1| gll4063 [Gloeobacter violaceus PCC 7421]
          Length = 260

 Score = 80.7 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 71/216 (32%), Gaps = 37/216 (17%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------------E 46
             W G F           S      ++ + ++PS  AIVVL G                 
Sbjct: 46  VLWLGSFSAPAVADALLWSLESQYPEVPVENNPSAQAIVVLGGALHLPNARHRTYELAES 105

Query: 47  PIRIERAFELLENQIGEKIFISGVHH-----------SVSKDILLQKIPIRQDLAECCID 95
             R+  A  L +      + +SG +            +       +++ +        I 
Sbjct: 106 SDRVLHAARLFKAGKAPVVLMSGGNPPFHTRPDQPPEATQMAAFARELGVPAGA----IL 161

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
              ++ NT  NA  ++   +      +L+VT   HMPR+    +R    V      + S 
Sbjct: 162 TEERSWNTFQNAAFSAEVLKARRMTRILLVTSASHMPRSVAIFERAGFAVIAASTDVRSG 221

Query: 156 ---DLEENSSIFKIKILR---VLLIEYLKILLLSIQ 185
              D    + +     L    + L E++ +L+  ++
Sbjct: 222 TDLDDWLLAWLPSAAALESSTLALKEWVGLLVYRLR 257


>gi|300865598|ref|ZP_07110374.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300336399|emb|CBN55524.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 236

 Score = 79.9 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 71/205 (34%), Gaps = 48/205 (23%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIF 66
               + +     P   AIVVL G                   RI    +L        + 
Sbjct: 35  SLETQNLPPTPIPQTRAIVVLGGGIKPALPPRPWVEVGEAGDRILYGSQLYRQGKAPWLI 94

Query: 67  ISG--VH-------HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +SG  V         S     + Q + +        I     +LNT  NA       + N
Sbjct: 95  LSGGRVEWKGGGPPESADMAEIAQAMGVPTSA----ILQDPTSLNTYQNAVNVRKILKDN 150

Query: 118 NF-HHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENSSIFKIKILRVL 172
           N    +L+VT   HMPR+ L  QR    ++ IP P    I   D+E + S F+  +L +L
Sbjct: 151 NILGPILLVTSALHMPRSLLIFQR--QGIETIPAPTDFSITQQDMEASQSSFQAVLLNLL 208

Query: 173 ------------LIEYLKILLLSIQ 185
                       L EY+ + +  ++
Sbjct: 209 PDAYNLQQSTKALKEYIGLAVYRLR 233


>gi|296133679|ref|YP_003640926.1| protein of unknown function DUF218 [Thermincola sp. JR]
 gi|296032257|gb|ADG83025.1| protein of unknown function DUF218 [Thermincola potens JR]
          Length = 202

 Score = 79.9 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 68/196 (34%), Gaps = 15/196 (7%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IRI 50
           R     LF   +  +   +        +         AIVVL+G              R 
Sbjct: 6   RNLVITLFTGFLILLYTPLIQYAASPLIVKDPLQKADAIVVLSGGWKAKGVLGTSTLERY 65

Query: 51  ERAFELLENQIGEKIFISGVHHSVSKDILLQKIP--IRQDLAECCIDIGYKALNTEGNAQ 108
           +   +L + +    I  SG +               +        +     + +T  N  
Sbjct: 66  QYGIKLFQKKFAPVIIFSGGNLLGRPAEADAMADMALSAGFPYEAVISENASASTYENVL 125

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             +   ++     +++VT  YH  R     +  +  V+    P+ + + E+ + + ++K+
Sbjct: 126 FTTKILQEKRLKSIILVTSPYHTYRAKKMFE--DKQVKVTAAPVPNGEFEKANGLERLKL 183

Query: 169 LRVLLIEYLKILLLSI 184
            + +++EY K+L+  +
Sbjct: 184 AKNIVLEYGKLLVYEV 199


>gi|320161712|ref|YP_004174937.1| hypothetical protein ANT_23110 [Anaerolinea thermophila UNI-1]
 gi|319995566|dbj|BAJ64337.1| hypothetical protein ANT_23110 [Anaerolinea thermophila UNI-1]
          Length = 264

 Score = 79.5 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 81/235 (34%), Gaps = 54/235 (22%)

Query: 2   RYFWYGLFVCLIF-----FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           R  + GL + ++      ++   ++     + +      S  A+VVL G           
Sbjct: 36  RNLFTGLALFILLVSSNRWVATTLARSLEWQYLPNEPISSAPAMVVLGGGTEPAFPPRSQ 95

Query: 47  ------PIRIERAFELLENQIGEKIFISGVH----------HSVSKDILLQKIPIRQDLA 90
                   R+  A  L +      + +SG +           +     LL+ + +  +  
Sbjct: 96  PEVNSAGDRVLYAAALYQQGKAPLVIVSGGNVAFRGEQSSTPASDMRHLLKMLGVPPEA- 154

Query: 91  ECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP- 149
              I    ++ NT  NA   +   ++ +   V++VT   HMPR+    ++    ++ IP 
Sbjct: 155 ---ILEEDQSQNTYENALYCAKLLKERHIQRVILVTSALHMPRSVKLFEK--QGIEVIPA 209

Query: 150 ---YPIISHDLEENSSIFKIKILRVL-------------LIEYLKILLLSIQLSL 188
              + +   + E+         L  L             L EY+ IL+  ++  L
Sbjct: 210 PADFAVPFQEWEDLLHAPIPAQLVALLPSSSNLQLTTNVLHEYIGILVYWMRGWL 264


>gi|288574503|ref|ZP_06392860.1| protein of unknown function DUF218 [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570244|gb|EFC91801.1| protein of unknown function DUF218 [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 270

 Score = 79.1 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 58/146 (39%), Gaps = 10/146 (6%)

Query: 48  IRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIP--IRQDLAECCIDIGYKALNTEG 105
            R+     L   + G  I +SG       + + + +   IR+   +  I +   +  T  
Sbjct: 108 QRLIEGASL-ARRKGYPILLSGGLSYDKSESIARSMERSIRKWGYKGEIMLEENSRTTWE 166

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS--HDLEENS-- 161
           N   +++   +     +++VT+ +HM R+    ++    ++  PY I S   D++ +   
Sbjct: 167 NMTYSASILRRKGIDRIILVTNSFHMKRSLWMAKKAMPDIEVYPYAIGSLADDMDSDPLK 226

Query: 162 SIFKIKILR---VLLIEYLKILLLSI 184
            I     LR   +   E + + +  I
Sbjct: 227 WIPTAGALRDSSLAWKEIVGLTVYRI 252


>gi|218288615|ref|ZP_03492892.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241272|gb|EED08447.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 199

 Score = 79.1 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 54/163 (33%), Gaps = 17/163 (10%)

Query: 1   MRYFWYGLFVCLIFFI---MGFISFIRYVKQM-HIPDHPSVSAIVVL---TGEPI----- 48
           M + W  L  C +  +      + F   +K              VVL   T         
Sbjct: 1   MAWLWMCLLACGVAALGSLAFLLRFAERLKHEGRSHRPQKSDVGVVLGAYTDGYEPSHPL 60

Query: 49  --RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             R+  A  L        I +SG    + +VS+   +++  +   +    +     + NT
Sbjct: 61  VARLRAAIALYRQGYIRAIIVSGGQGENETVSEARSMKRFLVMNGIPADAVHEERMSTNT 120

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
             N   +SA      +   +I+T DYH+PR     + +     
Sbjct: 121 WENLYHSSAIMRDRGYRTAVIITSDYHLPRALAVARMLGMDAT 163


>gi|153004625|ref|YP_001378950.1| hypothetical protein Anae109_1763 [Anaeromyxobacter sp. Fw109-5]
 gi|152028198|gb|ABS25966.1| protein of unknown function DUF218 [Anaeromyxobacter sp. Fw109-5]
          Length = 252

 Score = 79.1 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 62/188 (32%), Gaps = 28/188 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------------PI 48
             +   L     G   F+    +          A +VL+G+                   
Sbjct: 46  VLVVFSLAPVANGLQRFVERGAERTFRPGAVYDAAIVLSGQVDEAASRASGELELDAAAD 105

Query: 49  RIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+ R  EL       ++ +SG   +      S+   L+   +R  +    I +  ++ NT
Sbjct: 106 RVVRGLELWRAGRVRRLLLSGGPPAAVPGEPSEAERLRDALVRWGVPAAAILVDPQSRNT 165

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENS 161
             NA  ++  A ++    +L+VT   H PR     + +  +  V     P+        S
Sbjct: 166 RENAIASAHLAAEHGLRSLLLVTSAAHAPRALGCFRAVGLSPDVL----PVDRRTGPSGS 221

Query: 162 SIFKIKIL 169
            + +   L
Sbjct: 222 WLPRAGAL 229


>gi|22299705|ref|NP_682952.1| hypothetical protein tlr2162 [Thermosynechococcus elongatus BP-1]
 gi|22295889|dbj|BAC09714.1| tlr2162 [Thermosynechococcus elongatus BP-1]
          Length = 263

 Score = 79.1 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/213 (18%), Positives = 68/213 (31%), Gaps = 43/213 (20%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------------EPIRIERAFELLE 58
           ++   +      + +     P  +AIVVL G                   RI     L  
Sbjct: 55  YVAATLIASLERQYLPPHPMPKAAAIVVLGGAVVPQTAPRPWVEVTEGGDRILYGAHLFR 114

Query: 59  NQIGEKIFISGV-----------HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
                 + +SG              +V    +     + +D     I +   +LNT  NA
Sbjct: 115 QGSDPYLILSGGRINWLGETFQQAEAVDMAEIATTCGVPRDK----ILLETSSLNTYQNA 170

Query: 108 QEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
               A  EK+     +L+VT  YHMPR     +R+   V   P       +  + +   +
Sbjct: 171 VNVKALLEKHQMQGKLLLVTSAYHMPRAVAIFRRLGMDVIPAPTDYRYPTIARSPTWQNL 230

Query: 167 -----------KILRVLLIEYLKILLLSIQLSL 188
                       I  + L EY  +L+  ++  L
Sbjct: 231 LLSLIPNPYNVDITTIALREYQGLLIYRLRGWL 263


>gi|317055190|ref|YP_004103657.1| hypothetical protein Rumal_0470 [Ruminococcus albus 7]
 gi|315447459|gb|ADU21023.1| protein of unknown function DUF218 [Ruminococcus albus 7]
          Length = 198

 Score = 79.1 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 59/174 (33%), Gaps = 18/174 (10%)

Query: 33  DHPSVSAIVVLTGEPI----RIERAFELLENQIGEKIFISGVH-HSVSKDIL-----LQK 82
           D  S   I+VL G       R+  A  L        I +SG      S   +     ++K
Sbjct: 27  DGSSADLIMVL-GSRKACDYRVPEAVRLYNEGKAPLILLSGGQVQDTSLGNMAEWESMKK 85

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF----HHVLIVTHDYHMPRTFLEL 138
             +   ++E  I     + NT  N   +        +      +++VT  YHM R     
Sbjct: 86  AALALGISESDILAEKLSKNTAENFMYSDELLI--GYLPLGSKIILVTTAYHMRRALCMA 143

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQT 192
            +      FIP P+      + +     K  +  L E+ K L   I+  +   T
Sbjct: 144 HKFMPGYDFIPCPVQKGSATKENWYKTDKGRQTALDEWRK-LSYYIKDGIFEDT 196


>gi|311032605|ref|ZP_07710695.1| hypothetical protein Bm3-1_19074 [Bacillus sp. m3-13]
          Length = 207

 Score = 79.1 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 58/164 (35%), Gaps = 16/164 (9%)

Query: 33  DHPSVSAIVVLTGEPI-----RIERAFELLENQIGEKIFISG--VHHSVSKDI--LLQKI 83
           D+ +   I V           R+  A +L +     KI  SG  V          LL + 
Sbjct: 29  DNRNGDCIFVP--GSSKAVQYRLPPAIQLYQEGRAGKILFSGGVVWDGNQLSEAQLLAEK 86

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEAS----AWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
            +   +    I I  ++L+T+ N   +          +    +++VT  YHM R  L+L+
Sbjct: 87  AMELGVPSEDILIENQSLHTKENVLASLLVLDRALHLHKISRLIVVTSHYHMRRMNLKLR 146

Query: 140 RINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
                 + +   P+      E++        + +  E  K++  
Sbjct: 147 TYMPDWIDYSLCPVNDRTTREDNWFLNPYGRQRVEAESAKLISY 190


>gi|331004989|ref|ZP_08328398.1| hypothetical protein IMCC1989_103 [gamma proteobacterium IMCC1989]
 gi|330421202|gb|EGG95459.1| hypothetical protein IMCC1989_103 [gamma proteobacterium IMCC1989]
          Length = 144

 Score = 78.7 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 9/104 (8%)

Query: 91  ECCIDIGY---KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
           E  +DI +   ++ NT  NA       +K + HHV +VTH YHMPR+    Q+   TV  
Sbjct: 41  ELNVDIAWPEGESRNTWENAHFTKKMLDKQSIHHVALVTHAYHMPRSVYAFQQAGLTVSP 100

Query: 148 IPYPIISHDLEENSSIFKIKIL------RVLLIEYLKILLLSIQ 185
           +P   +S     +  +  +         R+ L EYL +L  S++
Sbjct: 101 MPTGQLSQQSSTSYWLNWLPSAGALHISRLALHEYLGLLFYSLK 144


>gi|194367604|ref|YP_002030214.1| hypothetical protein Smal_3832 [Stenotrophomonas maltophilia
           R551-3]
 gi|194350408|gb|ACF53531.1| protein of unknown function DUF218 [Stenotrophomonas maltophilia
           R551-3]
          Length = 210

 Score = 78.7 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 17/149 (11%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + + W  LFV L+ +++G  ++I +V +          AI+VL               RI
Sbjct: 13  LGWLWR-LFVLLVIWLLGVTAWIVWVGERDQAA--KADAIIVLGAAAYDAKPSPVFEERI 69

Query: 51  ERAFELLENQIGEKIFISGVHHSV----SKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
               +L E +    +  +G +       S+  + ++  ++  + +  I I   + NT  N
Sbjct: 70  RHGLDLYEARYAPLLIFTGGYGGTGARFSESQVARRYALKHGIPDDAILIETASRNTVQN 129

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
             EA    E+ + H V+IV+   HM R  
Sbjct: 130 LVEAKRLMEQRDLHRVIIVSDPLHMARAL 158


>gi|190576261|ref|YP_001974106.1| hypothetical protein Smlt4469 [Stenotrophomonas maltophilia K279a]
 gi|190014183|emb|CAQ47827.1| conserved hypothetical exported protein [Stenotrophomonas
           maltophilia K279a]
          Length = 210

 Score = 78.7 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 61/149 (40%), Gaps = 17/149 (11%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + + W  LFV L+ +++G  ++I +V +          AI+VL               RI
Sbjct: 13  LGWLWR-LFVLLVIWLLGVTAWIVWVGERDQAA--KADAIIVLGAAAYDAKPSPVFEERI 69

Query: 51  ERAFELLENQIGEKIFISGVHHSV----SKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
               +L E +    +  +G +       S+  + ++  ++  + +  I I   + NT  N
Sbjct: 70  RHGLDLYEARYAPLLIFTGGYGGTGARFSESQVARRYALKHGVPDDAILIETASRNTVQN 129

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
             EA    ++   H V++V+   HM R  
Sbjct: 130 LVEAKRLMDQRGLHRVIVVSDPLHMARAL 158


>gi|37520492|ref|NP_923869.1| hypothetical protein glr0923 [Gloeobacter violaceus PCC 7421]
 gi|35211486|dbj|BAC88864.1| glr0923 [Gloeobacter violaceus PCC 7421]
          Length = 239

 Score = 78.7 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 55/162 (33%), Gaps = 21/162 (12%)

Query: 29  MHIPDHPSVSAIVVLTGEPI----RIERAFELLENQIGEKIFISGVHH-SVSKDILLQKI 83
              P +    AIVVL         R+E A  L       +IFISG +        L +  
Sbjct: 85  PEAPSNLKADAIVVLGRGERLRHTRVELAARLWRAGRAPRIFISGRNDADTMVADLRRM- 143

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
                L    +     +  T+ NA+  +          +L+VT   HM R+    +    
Sbjct: 144 ----GLPAKAVAGEECSRTTQENAEFTARILRPAGVRTLLLVTDAPHMLRSLRTFKEAGF 199

Query: 144 TVQFI--PYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
               +  P+P    +L E           +++ EYL +L   
Sbjct: 200 NSAAVTSPFPEKLSELRERL---------IVVREYLGLLTYR 232


>gi|310643123|ref|YP_003947881.1| protein of hypothetical function duf218 [Paenibacillus polymyxa
           SC2]
 gi|309248073|gb|ADO57640.1| Protein of hypothetical function DUF218 [Paenibacillus polymyxa
           SC2]
          Length = 249

 Score = 78.7 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 46/197 (23%), Positives = 71/197 (36%), Gaps = 28/197 (14%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------------IRIERAFELL 57
           + G +      KQ   P     + IVVL G                     R+  A  L 
Sbjct: 54  LAGDVLIRSLEKQYPQPLTVQGNVIVVLGGGATEGTPDINGQGNLLGSAANRLLTAARL- 112

Query: 58  ENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
               G  I  SG      S ++  + Q+  +   +    I I  ++LNT+ NA   S   
Sbjct: 113 HEATGLPILFSGGQVFGDSGNEANIAQRQLLGLGIPAKDIFIENRSLNTQQNAVYTSKIL 172

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH------DLEENSSIFKIKI 168
           +++     ++VT  +HMPR  LE QR        P   ++         + + S   I  
Sbjct: 173 KQHQLTKPILVTSAFHMPRAALEFQRAGMQTTAYPTDYLASEKLSLYAAKLSPSAGAIST 232

Query: 169 LRVLLIEYLKILLLSIQ 185
               L EYL IL L ++
Sbjct: 233 TGTALKEYLGILALKLK 249


>gi|258511943|ref|YP_003185377.1| hypothetical protein Aaci_1976 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478669|gb|ACV58988.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 199

 Score = 78.4 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 52/153 (33%), Gaps = 17/153 (11%)

Query: 1   MRYFWYGLFVCLIFFI---MGFISFIRYVKQM-HIPDHPSVSAIVVL---TGEPI----- 48
           M + W  L  C +  +      + F   +K              VVL   T         
Sbjct: 1   MAWLWMCLLACGVAALGSLAFLLRFAVRLKHEGRSHRPQKSDVGVVLGAYTDGYEPSHPL 60

Query: 49  --RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             R+  A  L        I +SG    + +VS+   +++  +   +    +     + NT
Sbjct: 61  VARLRAAIALYRQGYIRAIIVSGGQGENETVSEARSMKRFLVMNGIPSDAVHEERMSTNT 120

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             N   +SA      +   +I+T DYH+PR   
Sbjct: 121 WENLYHSSAIMRDRGYRTAVIITSDYHLPRALA 153


>gi|304404431|ref|ZP_07386092.1| protein of unknown function DUF218 [Paenibacillus curdlanolyticus
           YK9]
 gi|304346238|gb|EFM12071.1| protein of unknown function DUF218 [Paenibacillus curdlanolyticus
           YK9]
          Length = 230

 Score = 78.0 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 60/148 (40%), Gaps = 15/148 (10%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL----------TGEPIRIERAFEL 56
            + V  + +    +  I  VK+      P    I+VL           G   R++ AF L
Sbjct: 28  WMIVLGVLWCGYLLWLINDVKRPLPRSLPKADVIIVLGAALWSDKPSPGLKERLDYAFGL 87

Query: 57  LENQIGEKIFISGV----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            +    +K+ ++G       ++++   +++    + +    + I  KA +T  N   +  
Sbjct: 88  YKLGKADKLILTGGLDGNGSTITEAEGMRRYLTARGIPNDKLLIENKATSTYENLLFSKQ 147

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQR 140
             ++     VLIVTHDYH  R   E+ R
Sbjct: 148 ITDRGGMKQVLIVTHDYHSSRA-AEIAR 174


>gi|254228155|ref|ZP_04921584.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262393954|ref|YP_003285808.1| hypothetical protein VEA_003183 [Vibrio sp. Ex25]
 gi|151939228|gb|EDN58057.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262337548|gb|ACY51343.1| hypothetical protein VEA_003183 [Vibrio sp. Ex25]
          Length = 205

 Score = 78.0 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 61/143 (42%), Gaps = 8/143 (5%)

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEG 105
           ++  A +L + +   K+ +SG + ++ +      +++  +   ++E  I +   A NT  
Sbjct: 60  KMPTAVQLYKEKKVSKLLLSGGNLAIDRKPEFESMREYALTNGVSESDIILEPHAKNTVE 119

Query: 106 NAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSS 162
           NAQ ++    ++      V I+T  +H+ R     + +   ++    Y +       ++ 
Sbjct: 120 NAQFSTEIIVESEVAKKSVAILTTAFHIKRAKHLFKNVLPQSLDLYGYFVNDRSTRRDNW 179

Query: 163 I-FKIKILRVL-LIEYLKILLLS 183
              +  + RV+   E +K L + 
Sbjct: 180 WLTESAVSRVMHSHEVIKSLGVK 202


>gi|254228166|ref|ZP_04921595.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262393992|ref|YP_003285846.1| hypothetical protein VEA_003221 [Vibrio sp. Ex25]
 gi|151939239|gb|EDN58068.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262337586|gb|ACY51381.1| hypothetical protein VEA_003221 [Vibrio sp. Ex25]
          Length = 209

 Score = 78.0 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 61/143 (42%), Gaps = 8/143 (5%)

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEG 105
           ++  A +L + +   K+ +SG + ++ +      +++  +   ++E  I +   A NT  
Sbjct: 64  KMPTAVQLYKEKKVSKLLLSGGNLAIDRKPEFESMREYALTNGVSESDIILEPHAKNTVE 123

Query: 106 NAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSS 162
           NAQ ++    ++      V I+T  +H+ R     + +   ++    Y +       ++ 
Sbjct: 124 NAQFSTEIIVESEVAKKSVAILTTAFHIKRAKHLFKNVLPQSLDLYGYFVNDRSTRRDNW 183

Query: 163 I-FKIKILRVL-LIEYLKILLLS 183
              +  + RV+   E +K L + 
Sbjct: 184 WLTESAVSRVMHSHEVIKSLGVK 206


>gi|332968539|gb|EGK07600.1| protein of hypothetical function DUF218 [Kingella kingae ATCC
           23330]
          Length = 207

 Score = 78.0 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 56/145 (38%), Gaps = 15/145 (10%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IRIERAF 54
            GL + LI  +  +  +  Y      P      A VVL G              RI  A 
Sbjct: 15  LGLSIALISSLQLWCVWQVYAYSRPQPLPDEADAAVVL-GAAAWGNKPSPVFRERINHAL 73

Query: 55  ELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +    +KI  +G        ++  + ++  I+Q +A+  I    ++ +T  N     
Sbjct: 74  TLYQTGRVKKIIFTGGTPKAGFATEAEVARQYAIKQGIADQDIVFETRSKDTFQNLANTR 133

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFL 136
              +K++ + V+IV+  YHM R   
Sbjct: 134 FLMKKHHLNSVIIVSDPYHMARAMN 158


>gi|254523274|ref|ZP_05135329.1| periplasmic protein [Stenotrophomonas sp. SKA14]
 gi|219720865|gb|EED39390.1| periplasmic protein [Stenotrophomonas sp. SKA14]
          Length = 210

 Score = 77.6 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 62/149 (41%), Gaps = 17/149 (11%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + + W  LFV L+ +++G  ++I +V +          AI+VL               RI
Sbjct: 13  LGWLWR-LFVVLVIWLLGVTAWIVWVGERDQAA--KADAIIVLGAAAYDAKPSPVFEERI 69

Query: 51  ERAFELLENQIGEKIFISGVHHSV----SKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
               +L E Q    +  +G +       S+  + ++  ++  + +  I I   + NT  N
Sbjct: 70  RHGLDLYEAQYAPLLIFTGGYGGSGARFSESQVARRYALKHGVPDDAILIETASRNTVQN 129

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
             EA    ++ N H V+IV+   HM R  
Sbjct: 130 LIEAKRLMDQRNLHRVIIVSDPLHMARAL 158


>gi|110597117|ref|ZP_01385406.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
 gi|110341308|gb|EAT59773.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
          Length = 599

 Score = 77.6 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 35/198 (17%), Positives = 66/198 (33%), Gaps = 15/198 (7%)

Query: 4   FWYGLFVCLIFFIMGFISFI-RYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
               L + L+ F      FI   +   H P      AIVV +G             R   
Sbjct: 401 LTVLLMLYLVIFHSPLFWFIGDQLVVRHAPL--KTDAIVVFSGNGESAYRNDSYQRRALD 458

Query: 53  AFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECCI-DIGYKALNTEGNAQEA 110
           A           IF+S G    +S+  +++     + +A   I  +     +T  N +  
Sbjct: 459 AVRFYRQGYAPHIFLSSGKEQDLSEVDVIKLYLEDKGVAASAIHILDKYPKSTSENVEMV 518

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR 170
                +   H +L +T  YH  R     ++    +  +   ++     +      +  + 
Sbjct: 519 MQQLRRQGVHSILFLTSPYHGRRALWTWRKQAPDITVLTPAVVDTPPADPQWGATVDQIS 578

Query: 171 VLLIEYLKILLLSIQLSL 188
           V++ EY+ I+    Q  L
Sbjct: 579 VIVYEYVAIVYNWFQGRL 596


>gi|309775431|ref|ZP_07670434.1| putative periplasmic protein [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916820|gb|EFP62557.1| putative periplasmic protein [Erysipelotrichaceae bacterium 3_1_53]
          Length = 193

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 58/141 (41%), Gaps = 16/141 (11%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSV-SAIVVLTGEPI------------RIERAFE 55
            + ++F I   +    Y  +   P    V  A +VL G P             R++ A  
Sbjct: 6   AILIVFLIAANLILYHYFPKPKKPKAGRVYDAAIVL-GSPAKEDGSLSRLQKTRMDAAIR 64

Query: 56  LLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
           L      ++I ISG  V +  ++  ++    I   +A+  + +  KA NT  N + A   
Sbjct: 65  LYRQHTVQRIIISGGSVRNDYAEAEIMAAYAITCGIAKEVLLLERKARNTYENLKYAKEI 124

Query: 114 AEKNNFHHVLIVTHDYHMPRT 134
              + +H V++VT  +H+ R 
Sbjct: 125 CIAHEWHSVVVVTSSFHVRRA 145


>gi|313896016|ref|ZP_07829570.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975441|gb|EFR40902.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 258

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 65/153 (42%), Gaps = 25/153 (16%)

Query: 21  SFIRYVKQMHI-PDHPSVSAIVVLTGEP------------------IRIERAFELLENQI 61
            F+  +++ +  P+HP    I++L G                     R+  A  L     
Sbjct: 66  LFMGSLERTYPVPEHPQGDVIIMLGGGAIGGVQDVDGEGMLAPSPASRLLTAVRL-HRLY 124

Query: 62  GEKIFISG--VHHSV-SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
           G  I +SG  V     ++  + +++ I   + E  I    ++L T  NA+ ++    +  
Sbjct: 125 GLPILLSGGQVFKDTGTEAEIARRVLISLGVPEEQIYTESESLTTGQNARYSAEILHREG 184

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
           F H ++VT  +H+PR  L  +++   ++  PYP
Sbjct: 185 FMHPILVTSAFHLPRAVLNFEKL--GIEVTPYP 215


>gi|332715738|ref|YP_004443204.1| hypothetical protein AGROH133_10165 [Agrobacterium sp. H13-3]
 gi|325062423|gb|ADY66113.1| hypothetical protein AGROH133_10165 [Agrobacterium sp. H13-3]
          Length = 232

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 61/185 (32%), Gaps = 9/185 (4%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEK 64
            GL +     + G          +          IVVL G  P R  +A +L        
Sbjct: 42  LGLMMLTAIGLYGLALVSAGSLLVVEDPPAQADVIVVLGGDGPPRAAQAAKLWHEGRAPL 101

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ++G          ++ + +R  +    +     +L+T  NA  A            ++
Sbjct: 102 VLVTGYGDC----DFIRDMLVRLGVDSAVVSTECLSLSTWENATFAQPILTGMGAKSAIL 157

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYP-IISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           VT  +H  R     + +   +++I  P   +  L   +       +     EY K LL  
Sbjct: 158 VTSWFHSRRAVKRFRFVMPQIEWISLPAQRTVSLWRLAIDGDGVQV---FKEYAKALLYD 214

Query: 184 IQLSL 188
           I+ S 
Sbjct: 215 IRSSF 219


>gi|297567344|ref|YP_003686316.1| hypothetical protein Mesil_2970 [Meiothermus silvanus DSM 9946]
 gi|296851793|gb|ADH64808.1| protein of unknown function DUF218 [Meiothermus silvanus DSM 9946]
          Length = 211

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 61/200 (30%), Gaps = 21/200 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISF---------IRYVKQMHIPDHPSVSAIVVLTGEPIRIE 51
           +R    GL +  +  +   +              +  +        +AIV L G   R+ 
Sbjct: 8   LRIPLVGLALVAVLGLAHGLWLPGIAAWLVVTEPLTSLEGLRSDPQAAIVPLAGGRERVL 67

Query: 52  RAFELLENQIGEKIFIS-------GVHHSVSKDILLQKIPIRQDLAECCIDI-GYKALNT 103
            A  L     G     +       G+        L+ +  + Q +    + +       T
Sbjct: 68  YAAALFRQGYGRWFLATDMPLDAPGI--RERYAELVAREAVWQGVPRSAVVLSDLTVRTT 125

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENS 161
              A+E    A    +  +L+VT  YH  R    L  +   S +               +
Sbjct: 126 YEEAREILKVAHFRGWRSLLVVTSPYHTRRARWVLSEVFGTSGIAVHVVAAPEEGYTPQN 185

Query: 162 SIFKIKILRVLLIEYLKILL 181
               +  LR    EYLK++L
Sbjct: 186 WWQSVDGLRNTWTEYLKLVL 205


>gi|145219718|ref|YP_001130427.1| hypothetical protein Cvib_0911 [Prosthecochloris vibrioformis DSM
           265]
 gi|145205882|gb|ABP36925.1| protein of unknown function DUF218 [Chlorobium phaeovibrioides DSM
           265]
          Length = 196

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 64/185 (34%), Gaps = 7/185 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEK 64
             L V      +GF+  + Y+   H         I+VL G+   R++    L +   G +
Sbjct: 10  RFLLVLSAIGALGFLG-LGYIVSFHAAPPVQSDVIIVLGGDSGRRVKHGAALYKEGYGAR 68

Query: 65  IFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           + ++G+     +       ++      +    + +  ++  T   A  +SA  ++  +  
Sbjct: 69  VVLTGIDRRFYRKGHLNWRERRMKALGVPLNAVLVDTRSETTWDEAVNSSALMKQRGWRT 128

Query: 122 VLIVTHDYHMPR--TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            L+V+   HM R     E     +   F+         +           R ++ E  K 
Sbjct: 129 ALVVSDPPHMLRLKKTWEAAFEGTDQTFVLTATKPGWWDPLLWWRNPISYRFVISEVKKN 188

Query: 180 LLLSI 184
           L  ++
Sbjct: 189 LFYAV 193


>gi|311747747|ref|ZP_07721532.1| membrane protein [Algoriphagus sp. PR1]
 gi|126575735|gb|EAZ80045.1| membrane protein [Algoriphagus sp. PR1]
          Length = 256

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 67/175 (38%), Gaps = 32/175 (18%)

Query: 41  VVLTG----------------EPIRIERAFELLENQIGEKIFISG------VHHSVSKDI 78
           +VLTG                   RI  A +L      +KI I+G      V+   S+  
Sbjct: 79  IVLTGVTNLSKTAYDRTFFNKGADRITHALQLYRMGKIKKILITGGQGLNPVNPQ-SEAE 137

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF---HHVLIVTHDYHMPRTF 135
           LLQ+  I   +    + I  KA NT  NAQ    + E+         L++T  +HM R+ 
Sbjct: 138 LLQRFLIMTGVPPEDVMIEDKAKNTAQNAQFTKTFLEEKGINIDQEFLLITSAFHMYRSK 197

Query: 136 LELQRINSTVQFIPYPIISHDLEEN------SSIFKIKILRVLLIEYLKILLLSI 184
               ++    +  P    S+D + +       S   I+    L+ E++ I +  +
Sbjct: 198 GCFDKVGLKTETFPTDYYSYDTKYDFPTFMYPSPSSIENWHKLVKEWIGITVYKL 252


>gi|332969923|gb|EGK08925.1| protein of hypothetical function DUF218 [Desmospora sp. 8437]
          Length = 189

 Score = 76.8 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/114 (17%), Positives = 50/114 (43%), Gaps = 4/114 (3%)

Query: 47  PIRIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
             R+++A +L +  +   + +SG     +  +  ++++  + + + +  + +  ++ NT 
Sbjct: 59  QERMDQALKLYQRGLAPILILSGGSPRGTTPEARVMKEYLVERGVRKRDLILEDRSTNTA 118

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            N   +      +    V +VTHD+HM R     +R    +   P P+ +  L 
Sbjct: 119 ENLVRSGELLLSHGIRDVYLVTHDFHMYRALRCARRA--QLSVTPAPVATRSLW 170


>gi|148558293|ref|YP_001257412.1| Bme2 protein [Brucella ovis ATCC 25840]
 gi|148369578|gb|ABQ62450.1| Bme2 protein [Brucella ovis ATCC 25840]
          Length = 205

 Score = 76.8 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 72/191 (37%), Gaps = 13/191 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFI 67
           F C I   +  + F + +  +   D      I+V  G    R  +A +L ++     I  
Sbjct: 6   FPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILA 64

Query: 68  SGVHHSVSKDILLQKIPIRQD--LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           +G    +    ++    +     L EC      ++ +T  NA+ ++    + +    LIV
Sbjct: 65  TGDGDCLLNKHIMMAKGVPPSAILVEC------RSGSTWQNARFSAPLLRRLHAKSALIV 118

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLS 183
           T+ +H  R     +     + F   P+   D+          +++ ++ EY K    L+S
Sbjct: 119 TNWFHSRRAVASFRTACPQMHFTSSPVADADMP-GGFPGIPPVIKHVVKEYAKLGWYLIS 177

Query: 184 IQLSLSTQTAS 194
            ++     T S
Sbjct: 178 GRIRPQNLTDS 188


>gi|326803127|ref|YP_004320945.1| hypothetical protein HMPREF9243_0621 [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651604|gb|AEA01787.1| conserved hypothetical protein [Aerococcus urinae ACS-120-V-Col10a]
          Length = 190

 Score = 76.8 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/185 (22%), Positives = 68/185 (36%), Gaps = 10/185 (5%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-IRIERAFELLENQI--GEKIFI 67
                 +G     +++ Q   P       I+V  G    R E+A +LL+      EK  +
Sbjct: 11  AFAALAIGLRYIYKHLDQGQAPQVS--DLIIVAEGPAVERAEKAVQLLKAAYSRAEKNIV 68

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           S  +  V  + L           E  I+   +A +T  NA  +    +   +H  ++VT 
Sbjct: 69  SPRYTDVG-EDLFAGYQQLGAERENLIE-ENQATSTWTNATTSLDLMDDLGYHSAIVVTS 126

Query: 128 DYHMPRTFLELQRINSTVQF-IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           DYHM RT L  QR N    F + Y  +S   +           ++ L E  K +   + L
Sbjct: 127 DYHMRRTRLAFQRANRDYGFQLTY--VSAYYQGQPYPKHPYTQKMALQELYKYIGYCLHL 184

Query: 187 SLSTQ 191
                
Sbjct: 185 YHWID 189


>gi|119485358|ref|ZP_01619686.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
 gi|119457114|gb|EAW38240.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
          Length = 263

 Score = 76.8 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 47/206 (22%), Positives = 80/206 (38%), Gaps = 45/206 (21%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIF 66
               + +   + P  +AIVVL G                   RI     L +      + 
Sbjct: 63  SLEWQNIPNGELPKATAIVVLGGGTKAPTPPRPWVDVGEAGDRILYGALLYKQDKAPWLI 122

Query: 67  ISGV-------HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           +SG            S D  +++I +   + E  I     +LNT  NA        +NN 
Sbjct: 123 LSGGRIQWDGKEPPESAD--MKEIAVEMGVRESAILQDPDSLNTYQNAVNVRQILAENNL 180

Query: 120 H-HVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENSSIFKIKILRVL-- 172
              VL+VT   HMPR+ L  QR    ++ IP P    +   DL+ +++I + +IL ++  
Sbjct: 181 TGKVLLVTSALHMPRSLLVFQR--QGIEVIPAPTDFLVSQQDLQPSTTI-QGRILNLIPD 237

Query: 173 ----------LIEYLKILLLSIQLSL 188
                     L EY+ +++  ++  L
Sbjct: 238 TQSLQQFTQALKEYIGMIVYRLRGWL 263


>gi|94266695|ref|ZP_01290369.1| Protein of unknown function DUF218 [delta proteobacterium MLMS-1]
 gi|93452658|gb|EAT03218.1| Protein of unknown function DUF218 [delta proteobacterium MLMS-1]
          Length = 254

 Score = 76.8 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 69/211 (32%), Gaps = 31/211 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-------------- 46
           + + W+     +   +   +S           + P+   IV+L G               
Sbjct: 46  VAWLWFWSLPVVADALR--LSLEGRFAPQRAEELPAADFIVLLGGGVRGVPADWPYPDLN 103

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCIDIGYK 99
               R+  A  L        I +SG          S+   ++++ +   + +  I +  +
Sbjct: 104 AAADRVWHAPRLYHADKAPLIIVSGGGKEWHGERGSEAEAMRELLLAFGVPDGAIRLEDR 163

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY-----PIIS 154
           + +T  NA   +    +     VL+VT   HMPR+    + +       P      P   
Sbjct: 164 SRSTRENALYTAPLVGE---RPVLLVTSAQHMPRSLATFRAVGINAVPAPTDFEVIPQPL 220

Query: 155 HDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           H L        +      L EYL +L+  ++
Sbjct: 221 HSLRLLPDAHSLHQSTSALKEYLGLLVYRLR 251


>gi|108758987|ref|YP_633512.1| hypothetical protein MXAN_5362 [Myxococcus xanthus DK 1622]
 gi|15076969|gb|AAK83000.1|AF285783_5 unknown [Myxococcus xanthus]
 gi|108462867|gb|ABF88052.1| conserved hypothetical protein [Myxococcus xanthus DK 1622]
          Length = 258

 Score = 76.8 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/182 (19%), Positives = 64/182 (35%), Gaps = 26/182 (14%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------------PIRIERAFELL 57
             MG +               +  A++VL G                    R+ R FELL
Sbjct: 56  VAMGLMRAAEAGAVRSFQPGATYDAVIVLGGALDPAATERTGVPEYNAAAERVLRGFELL 115

Query: 58  ENQIGEKIFISGV--HHS----VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
                 ++ +SG          V  D+LL+++       E  +  G  + NT  NA E++
Sbjct: 116 HEGRARRVLLSGGSLDPRPEAVVEADVLLRQLQQWGIPRERIVTEGR-SRNTRENAVESA 174

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD--LEENSSIFKIKIL 169
              ++  +  +L+VT   HMPR       +      +P    + +  L   S + +   L
Sbjct: 175 RIIQERGWKSLLLVTSAAHMPRAAGCFAAVGLRPDLLPVDSRASNTPLRRMSWLPRSGAL 234

Query: 170 RV 171
            +
Sbjct: 235 NL 236


>gi|254282506|ref|ZP_04957474.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
 gi|219678709|gb|EED35058.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
          Length = 253

 Score = 76.4 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 64/213 (30%), Gaps = 30/213 (14%)

Query: 2   RYFWYGLFVCLIFFIMGFISF-------IRYVKQMHIPDHPSVSAIVVLTGE-------- 46
            + W  L   L++F                        + P    IVVL G         
Sbjct: 37  AFLWSFLAFALVYFCSTEFGANTLMEPLEARYPAFAPEELPKAEVIVVLGGAIDGESRFG 96

Query: 47  --------PIRIERAFELLENQIGEKIFISGVHHSVSK--DILLQKIPIRQDLAECCIDI 96
                     R+  A EL   ++   + +SG   S  +    L+ +      +    + +
Sbjct: 97  RGGDATHAADRLLTAAELYARKMAPYMLLSGGAPSGQRPEADLMAEKLEFMGVPRSAMLL 156

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP--YPIIS 154
              +  T  NA  ++      N+ H+L+VT   HM R     +     V  +   + I  
Sbjct: 157 EPASRTTFDNAVNSADMLNARNYRHILLVTSGAHMRRAVALFEAFGLQVTAVATDHQIPR 216

Query: 155 HDLEENSSIFKIKILR---VLLIEYLKILLLSI 184
           +       +     L      + E++   +  +
Sbjct: 217 YAPTVPGWLPTADRLARSTRAVHEWVGYWVYDL 249


>gi|161620495|ref|YP_001594381.1| hypothetical protein BCAN_B0429 [Brucella canis ATCC 23365]
 gi|163844593|ref|YP_001622248.1| hypothetical protein BSUIS_B0427 [Brucella suis ATCC 23445]
 gi|225686235|ref|YP_002734207.1| hypothetical protein BMEA_B0404 [Brucella melitensis ATCC 23457]
 gi|254699682|ref|ZP_05161510.1| hypothetical protein Bsuib55_02296 [Brucella suis bv. 5 str. 513]
 gi|254702819|ref|ZP_05164647.1| hypothetical protein Bsuib36_02539 [Brucella suis bv. 3 str. 686]
 gi|256015209|ref|YP_003105218.1| Bme2 protein [Brucella microti CCM 4915]
 gi|256043322|ref|ZP_05446257.1| hypothetical protein Bmelb1R_02479 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256111677|ref|ZP_05452661.1| hypothetical protein Bmelb3E_03418 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256262633|ref|ZP_05465165.1| Bme2 [Brucella melitensis bv. 2 str. 63/9]
 gi|260564530|ref|ZP_05835015.1| Bme2 protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568269|ref|ZP_05838738.1| Bme2 protein [Brucella suis bv. 4 str. 40]
 gi|261750147|ref|ZP_05993856.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753420|ref|ZP_05997129.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265989745|ref|ZP_06102302.1| Bme2 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993148|ref|ZP_06105705.1| Bme2 [Brucella melitensis bv. 3 str. Ether]
 gi|294853761|ref|ZP_06794433.1| hypothetical protein BAZG_02742 [Brucella sp. NVSL 07-0026]
 gi|297250207|ref|ZP_06933894.1| hypothetical protein BAYG_03205 [Brucella abortus bv. 5 str. B3196]
 gi|5478233|gb|AAD43833.1|AF076290_2 Bme2 [Brucella melitensis]
 gi|161337306|gb|ABX63610.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|163675316|gb|ABY39426.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|225642340|gb|ACO02253.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|255997869|gb|ACU49556.1| Bme2 protein [Brucella microti CCM 4915]
 gi|260152173|gb|EEW87266.1| Bme2 protein [Brucella melitensis bv. 1 str. 16M]
 gi|260154934|gb|EEW90015.1| Bme2 protein [Brucella suis bv. 4 str. 40]
 gi|261739900|gb|EEY27826.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743173|gb|EEY31099.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262764018|gb|EEZ10050.1| Bme2 [Brucella melitensis bv. 3 str. Ether]
 gi|263000414|gb|EEZ13104.1| Bme2 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092418|gb|EEZ16671.1| Bme2 [Brucella melitensis bv. 2 str. 63/9]
 gi|294819416|gb|EFG36416.1| hypothetical protein BAZG_02742 [Brucella sp. NVSL 07-0026]
 gi|297172960|gb|EFH32338.1| hypothetical protein BAYG_03205 [Brucella abortus bv. 5 str. B3196]
 gi|326410585|gb|ADZ67649.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326553876|gb|ADZ88515.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 205

 Score = 76.4 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 71/191 (37%), Gaps = 13/191 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFI 67
           F C I   +  + F + +  +   D      I+V  G    R  +A +L ++     I  
Sbjct: 6   FPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILA 64

Query: 68  SGVHHSVSKDILLQKIPIRQD--LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           +G    +    ++    +     L EC      ++ +T  NA+ ++    + +    LIV
Sbjct: 65  TGDGDCLLNKHIMMAKGVPPSAILVEC------RSGSTWQNARFSAPLLRRLHAKSALIV 118

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLS 183
           T+ +H  R     +     + F   P+   D+          ++  ++ EY K    L+S
Sbjct: 119 TNWFHSRRAVASFRTACPQMHFTSSPVADADMP-GGFPGTPPVIEHVVKEYAKLGWYLIS 177

Query: 184 IQLSLSTQTAS 194
            ++     T S
Sbjct: 178 GRIRPQNLTDS 188


>gi|291614927|ref|YP_003525084.1| hypothetical protein Slit_2472 [Sideroxydans lithotrophicus ES-1]
 gi|291585039|gb|ADE12697.1| protein of unknown function DUF218 [Sideroxydans lithotrophicus
           ES-1]
          Length = 251

 Score = 76.4 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 65/207 (31%), Gaps = 31/207 (14%)

Query: 9   FVCLIFFIMGFISFIRYVKQ-------MHIPDHPSVSAIVVLTGEPI------------- 48
               + +++    F   + Q       ++    P   AIVVL G                
Sbjct: 45  VSVALLWLLSTPFFAEAMLQGLEGQPFVNDTSKPQADAIVVLGGGTNFRAPEYGGDTVSK 104

Query: 49  ----RIERAFELLENQIGEKIFISGVHH-SVSKDILLQKIPIRQDLAECCID-IGYKALN 102
               R+  A  L     G+ I ++G            Q     +      +      + N
Sbjct: 105 ETLERLRYAARLYRQ-TGKPILVTGGTPLGNDLSEAAQMKKTLEQEFNVPVRWAEGASNN 163

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS----HDLE 158
           T  NA+ +    +K     + +VTH +HMPR     Q     V   P    +      L 
Sbjct: 164 TLENARLSREVLKKEGISRIYLVTHAWHMPRAVQVFQAAGFQVYPAPTAYTTRYQLDLLV 223

Query: 159 ENSSIFKIKILRVLLIEYLKILLLSIQ 185
              S   ++  R+ + E + +L   ++
Sbjct: 224 FIPSASALRDSRIFMHEMIGLLWYRLK 250


>gi|78188131|ref|YP_378469.1| hypothetical protein Cag_0148 [Chlorobium chlorochromatii CaD3]
 gi|78170330|gb|ABB27426.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 251

 Score = 76.4 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 73/219 (33%), Gaps = 35/219 (15%)

Query: 3   YFWYGLFVCLIF----FIMGFISFIRYVKQMHIPDHP-SVSAIVVLTG------------ 45
             WY   V   F       G + F+   + + +P       AIVVL G            
Sbjct: 33  LLWYAALVLWAFSIPTVADGLMHFVEGNRTVALPQTLHQADAIVVLGGMIRRVEGAAEGE 92

Query: 46  ---EPIRIERAFELLENQIGEKIFIS-GVHH----SVSKDILLQKIPIRQDLAECCIDIG 97
                 R E    L        +  + G       +V +  LL +  +++ + E  + + 
Sbjct: 93  WNDAADRFEAGVTLYRAGKAPLLLFTRGRMPWSPDAVPEGELLVERALQRGVPEAALGLT 152

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---- 153
               NTE  A + +    +     +++VT  YHM R+ L  +    +V+  PYP+     
Sbjct: 153 APVANTEDEAADVARLLRERGAERIILVTSAYHMRRSQLLFEHTGLSVE--PYPVDFRVD 210

Query: 154 ----SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                  L    S   +      L E +  L   ++L  
Sbjct: 211 SYPEPAVLRFAPSAEALYRSETALRELIGWLYYRVKLFF 249


>gi|306845690|ref|ZP_07478259.1| Bme2 protein [Brucella sp. BO1]
 gi|306274011|gb|EFM55838.1| Bme2 protein [Brucella sp. BO1]
          Length = 205

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 73/191 (38%), Gaps = 13/191 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFI 67
           F C I   +  + F + +  +   D      I+V  G    R  +A +L ++     I  
Sbjct: 6   FPCAILLGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILA 64

Query: 68  SGVHH--SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           +G          ++ + +P    L EC      ++ +T  NA+ ++    + +    LIV
Sbjct: 65  TGDGDCLLNKHIMIAKGVPPSAILVEC------RSGSTWQNARFSAPLLRRLHAKSALIV 118

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLS 183
           T+ +H  R     +     + F   P+   D+    S     ++  ++ EY K    L+S
Sbjct: 119 TNWFHSRRAVASFRTACPQMHFASSPVADADMPGGLS-GTPPVIEHVVKEYAKLGWYLIS 177

Query: 184 IQLSLSTQTAS 194
            ++     T S
Sbjct: 178 GRIRPQNLTDS 188


>gi|23500175|ref|NP_699615.1| Bme2 protein [Brucella suis 1330]
 gi|23463775|gb|AAN33620.1| Bme2 protein [Brucella suis 1330]
          Length = 205

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 71/191 (37%), Gaps = 13/191 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFI 67
           F C I   +  + F + +  +   D      I+V  G    R  +A +L ++     I  
Sbjct: 6   FPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILA 64

Query: 68  SGVHHSVSKDILLQKIPIRQD--LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           +G    +    ++    +     L EC      ++ +T  NA+ ++    + +    LIV
Sbjct: 65  TGDGDCLLNKHIMMAKGVPPSAILVEC------RSGSTWQNARFSAPLLRRLHAKSALIV 118

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLS 183
           T+ +H  R     +     + F   P+   D+          ++  ++ EY K    L+S
Sbjct: 119 TNWFHSRRAVASFRTACPQMHFTSSPVADADMP-GGFPGTPPVIEHVVKEYAKLGWYLIS 177

Query: 184 IQLSLSTQTAS 194
            ++     T S
Sbjct: 178 GRIRPQNLTDS 188


>gi|153873460|ref|ZP_02002036.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
 gi|152070073|gb|EDN67963.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
          Length = 195

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/195 (18%), Positives = 67/195 (34%), Gaps = 35/195 (17%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTG----------------EPIRIERAFELLENQIGEKIFI 67
           RY     I D+P V AIVV+ G                   R+  A  L        I +
Sbjct: 6   RYHPSQDITDYPMVQAIVVIGGCLESAKPPRRTFNVGDAGDRVIHAARLYHAGKAPLILV 65

Query: 68  SG-------VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           SG       V         ++       +    +     ++ T  NA  +    +    H
Sbjct: 66  SGGTLPWRKVPPE---ADAMRAFLEELGVPTKAVMSEPDSITTYENALFSKKLLDNKGIH 122

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK-------IKILRVLL 173
            +L+VT  +HM R+    +++    + IP P     ++   S+F        +    + +
Sbjct: 123 KILLVTSAFHMRRSAAVFRKV--GFEVIPAPTDFRVVKNPPSLFDYLPDVRYLHQTTIAI 180

Query: 174 IEYLKILLLSIQLSL 188
            EY+ +   +++  L
Sbjct: 181 KEYIGLEYYALKQRL 195


>gi|83814701|ref|YP_445779.1| hypothetical protein SRU_1660 [Salinibacter ruber DSM 13855]
 gi|83756095|gb|ABC44208.1| Uncharacterized ACR, COG1434 family [Salinibacter ruber DSM 13855]
          Length = 281

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 68/230 (29%), Gaps = 38/230 (16%)

Query: 2   RYFWYGLFV--CLIFFIMGFI----SFIRYVKQMHIPDH----PSVSAIVVLTGE----- 46
           R     L V   L+ ++             ++  H P      PS  A VVL G      
Sbjct: 34  RRSGMALLVGGVLVLWVASAPLVSDWLRGRLEGQHPPTRVDSLPSAEAAVVLGGGVSPPR 93

Query: 47  -----------PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC--- 92
                        R+  A  L        +  SG      +    ++ P    L +    
Sbjct: 94  PPRIHPDLNDAADRVWHAARLYHAGKVPLVIASGGTQPWKRPD-AREAPATNVLLQDWGV 152

Query: 93  ---CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
               I +  K+ NT  NA   +   ++   + VL+VT   HMPR     +         P
Sbjct: 153 PGDAILLESKSANTYENATRTAELLDRRGLNCVLLVTSALHMPRALAVFRSAGIKAVPAP 212

Query: 150 YPIISHD-----LEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTAS 194
             +   D     L+       +      + EY+  L+   +  +     S
Sbjct: 213 TDVQVGDRNYTVLDVLPDAGALAGSTAAIREYVGYLVYDWRGWIDGPAGS 262


>gi|56965774|ref|YP_177508.1| hypothetical protein ABC4016 [Bacillus clausii KSM-K16]
 gi|56912020|dbj|BAD66547.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 201

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 62/164 (37%), Gaps = 16/164 (9%)

Query: 33  DHPSVSAIVVLTGEPI-----RIERAFELLENQIGEKIFISGV----HHSVSKDILLQKI 83
           D  S   I V           R+ +A +L +     K+  SG          + +L++  
Sbjct: 27  DGKSGDCIFVP--GSSKAVEYRVPKAVDLYKQGRARKLLFSGGVSWDETKTPEAVLMKAK 84

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEAS----AWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
            +   +A   I +  ++L+T+ N   +        + +    +L+VT  YHMPR +L ++
Sbjct: 85  ALSLGIAAKDILVEDRSLHTKENVLASLLVLDRAIDLHRIKRLLLVTASYHMPRVYLMMR 144

Query: 140 RINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
               + +++   P+        +        + +  E  K++  
Sbjct: 145 TYMPSWIEYSLCPVDDKTTTAENWHLSPFGRKRVETEARKLISY 188


>gi|163852963|ref|YP_001641006.1| hypothetical protein Mext_3555 [Methylobacterium extorquens PA1]
 gi|163664568|gb|ABY31935.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 275

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 69/216 (31%), Gaps = 36/216 (16%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIP---DHPSVSAIVVLTGE------------- 46
             W G+              +  ++Q       D   V  I+VL+G              
Sbjct: 29  LAWAGVLATFSGLTPLANWALLPLEQRFPAQVDDVRPVDGIIVLSGGIDLTTSRTRGRLE 88

Query: 47  ----PIRIERAFELLENQIGEKIFISGVHH-------SVSKDILLQKIPIRQDLAECCID 95
                 RI    +L       ++  +G            ++ +L         +A   I 
Sbjct: 89  LNDAGDRITALIDLAHRYPQARLVYTGGDPYPTGGRARPTEAVLAAAYLEGIGIAPARIT 148

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI--- 152
           +  ++  T  NA E     E +     L++T  +HMPR     +R+   ++  PYP+   
Sbjct: 149 VEARSRTTAENASEVRKLLEPHPGERWLLITSAWHMPRAMGAFRRV--GLELEPYPVDFR 206

Query: 153 ----ISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
                +       +   + +L V   E+  +++  +
Sbjct: 207 TAGPFATRFTFRHAADGLHLLDVAAKEWAGLVVYRL 242


>gi|156741328|ref|YP_001431457.1| hypothetical protein Rcas_1343 [Roseiflexus castenholzii DSM 13941]
 gi|156232656|gb|ABU57439.1| protein of unknown function DUF218 [Roseiflexus castenholzii DSM
           13941]
          Length = 213

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 49/157 (31%), Gaps = 8/157 (5%)

Query: 36  SVSAIVVLTGE---PIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQ 87
           +  AI+VL GE   P R   A  L        +  +G          S   + +++ + +
Sbjct: 50  TADAIIVLGGEAYPPNRTIHALALYHQHRAPVVVFTGGAPPGRPPETSSAQVARRLALAR 109

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            L      +   A +T   A         + +  ++IVT  YH  R     + +      
Sbjct: 110 GLPPDVALLADGAQSTYDEAVLVRELVAAHGWRSLMIVTDPYHTRRAVRTFRTLIPNAHV 169

Query: 148 IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
                       +      +I R    E +K+    +
Sbjct: 170 TASAAPFLSPCADPWRCGARIWRYAASELVKMGFYRL 206


>gi|20808561|ref|NP_623732.1| hypothetical protein TTE2177 [Thermoanaerobacter tengcongensis MB4]
 gi|20517188|gb|AAM25336.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 192

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 64/159 (40%), Gaps = 13/159 (8%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----GEP------IRIE 51
           R+    + +    F +  I   + +            AI+VL     G+        R+E
Sbjct: 3   RFLKLVVVLIFALFSIIAILAYQIISFGFTEKPKKSDAIIVLGCAVYGDAPSPFFKERLE 62

Query: 52  RAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A +L +   G  I ISG      S+S+    ++  + + +A   I +  K+ +T  N  
Sbjct: 63  EALKLYKEGYGRYIIISGGKGPGESISEAEAGKRYFLEKGVASKNILLDNKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            +    EKN+    +IV++ +H+ R  +  +RI     F
Sbjct: 123 FSKEIMEKNSLKTAIIVSNKFHLKRASVIAKRIGIDASF 161


>gi|167465736|ref|ZP_02330825.1| hypothetical protein Plarl_24758 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381937|ref|ZP_08055887.1| hypothetical protein PL1_0708 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154077|gb|EFX46405.1| hypothetical protein PL1_0708 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 233

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 71/192 (36%), Gaps = 29/192 (15%)

Query: 9   FVCLIFFIMGFIS-FIRYV---KQMHIPDHPSVSAIVVL-----T-----GEPIRIERAF 54
            V L   + G +  F       +Q +      V   +VL     T     G   R+++A 
Sbjct: 4   AVFLGILLAGLLWTFYVQWLLSRQDYPALPEGVDTGIVLGAKLETNQASPGLAERLDQAI 63

Query: 55  ELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
            L   +  + + +SG         +++   ++   +++ + E  I +  +A NT  N   
Sbjct: 64  SLYNQRKFKHLIVSGGLDKEGDSQITEAEGMRNYLVQKGIPEQAITMEKQAKNTYENLVF 123

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTF----------LELQRINSTVQFIPYPIISHDLEE 159
           +    E+  +   +I+TH+YH  R              L   +ST  F+PY  I   L  
Sbjct: 124 SKRIMEQKGWTSCIIITHEYHGARAMDIADFIALSPAYLSTTDSTHLFMPYHKIREILAF 183

Query: 160 NSSIFKIKILRV 171
               F    +R+
Sbjct: 184 TKWEFNKWRMRL 195


>gi|148241215|ref|YP_001226372.1| hypothetical protein SynRCC307_0116 [Synechococcus sp. RCC307]
 gi|147849525|emb|CAK27019.1| Uncharacterised conserved membrane protein [Synechococcus sp.
           RCC307]
          Length = 265

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 65/200 (32%), Gaps = 39/200 (19%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIFI 67
                +     P   A++VL G                   R+     L        +  
Sbjct: 64  DQAASLTPKSLPEADAVLVLGGGIRPAPAKGQGVEVNEAGDRLLCGVRLWRQGKAPVLIT 123

Query: 68  SGV-------HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           SG             + +L Q++     +    + +  KA  T   AQ  +  A +  + 
Sbjct: 124 SGARVSFTLNDPIAPEAVLSQQLAQELGVPASALLLNEKARTTAEEAQRINQLAAEQGWK 183

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIP----YPIISHDLEENSSIFK----------- 165
            +++VT  +HMPR     +R  S +Q IP    Y +      +  S  +           
Sbjct: 184 QLILVTSAFHMPRALASFKR-QSELQIIPVACDYQLDPQHQNQAFSWGELLIDLIPSSDA 242

Query: 166 IKILRVLLIEYLKILLLSIQ 185
           +     +L E+L +L+  ++
Sbjct: 243 LDQTTQVLKEHLGLLVYQLR 262


>gi|289522163|ref|ZP_06439017.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503999|gb|EFD25163.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 254

 Score = 75.3 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 37/187 (19%), Positives = 68/187 (36%), Gaps = 24/187 (12%)

Query: 24  RYVKQMHIPDHPSV-SAIVVLTGEPIRIER----------------AFELLENQIGEKIF 66
             ++ M  P  P+  +AIVVL G   R                     EL        + 
Sbjct: 64  GKLENMVAPSLPADKAAIVVLGGGQRRTSDPDKAEVSPHTLMRLFGGIELALKFNWPILL 123

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
             G +     + +     +++   +  I    ++  T  N + AS+        H ++VT
Sbjct: 124 CGGSYSQEVPEAMTMAKKVKELFPDLPIYEESQSRTTWENIKNASSILRSLELKHAVLVT 183

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPI-------ISHDLEENSSIFKIKILRVLLIEYLKI 179
           H YHMPR  L  Q +   + + P+P+           ++       + I  + L E++ I
Sbjct: 184 HGYHMPRAHLIAQGLAPEINWHPFPVGKMADNAPLSIIDFLPGASSLHINSLALKEHVGI 243

Query: 180 LLLSIQL 186
           +   I+L
Sbjct: 244 IAYRIKL 250


>gi|149925438|ref|ZP_01913702.1| Uncharacterized ACR, COG1434 family protein [Limnobacter sp.
           MED105]
 gi|149825555|gb|EDM84763.1| Uncharacterized ACR, COG1434 family protein [Limnobacter sp.
           MED105]
          Length = 274

 Score = 75.3 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 67/200 (33%), Gaps = 36/200 (18%)

Query: 26  VKQMHIPDHPSVSAIVVLTGE-----------------PIRIERAFELLENQIGEKIFIS 68
           V + + P    V AIVVL G                    R+ +   L +  +  +I +S
Sbjct: 80  VLEANRPLPAQVDAIVVLGGGLEGRFDGVRALPDLNDAGDRVWQGARLYKQGVATRIVLS 139

Query: 69  GVHHSVSKDI-----LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           G               ++   +   + E  + I   +  T  NA        +     + 
Sbjct: 140 GGQFQTDPRKEAEAPGMKMFMLDMGVPEDALVIEDNSRTTFENAVRTRELLGERA-RSIA 198

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN------SSIFKIKIL---RVLLI 174
           +VT  +HM R+ L  ++      F  YP+ +     N        + K + L    V + 
Sbjct: 199 LVTSAFHMGRSVLWFEKAG----FTVYPVRTDIRVLNESRAFWEWLPKPQALDESTVAIK 254

Query: 175 EYLKILLLSIQLSLSTQTAS 194
           EYL  L L +  +  T  + 
Sbjct: 255 EYLGRLQLKVSGAYETGGSQ 274


>gi|322382281|ref|ZP_08056191.1| hypothetical protein PL1_3077 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153783|gb|EFX46154.1| hypothetical protein PL1_3077 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 195

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 59/155 (38%), Gaps = 12/155 (7%)

Query: 33  DHPSVSAIVVLTGEPI---RIERAFELLENQIGEKIFISGVHHSVSKDIL----LQKIPI 85
           D      I V   +     R+ +A EL +     KI  SG +    ++ +    +++  I
Sbjct: 22  DGRQGDCIFVFGSQRSLAYRVPKAIELYKQGRAGKILFSGGNQWEGQEDVEALVMKQGAI 81

Query: 86  RQDLAECCIDIGYKALNTEGNAQ----EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
            + + E  I    ++ +T  N      E       +    +LIVT  +HM R +L ++  
Sbjct: 82  NEGIPETDIITEIRSTSTRENVLSSLLELDRAMGLHRLKRILIVTTAFHMRRCYLNMRTY 141

Query: 142 NST-VQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
               +++   P+      E++       ++ +  E
Sbjct: 142 MPEWIEYSLCPVDDRKTREDNWFLHETGIQRVTDE 176


>gi|254479072|ref|ZP_05092426.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214034988|gb|EEB75708.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 192

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 64/159 (40%), Gaps = 13/159 (8%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL-------TGEP---IRIE 51
           R+    + +    F +  I   + V            AI+VL       T  P    R+E
Sbjct: 3   RFLKLVVVLIFALFSIIAILAYQIVSFGFTEKPKKSDAIIVLGCAVYGDTPSPFFKERLE 62

Query: 52  RAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A +L +   G  I ISG      S+S+    ++  + + +A   I +  K+ +T  N  
Sbjct: 63  EALKLYKEGYGHYIIISGGKGPGESISEAEAGKRYLLEKGVASKNILLDNKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            +    EKN+    +IV++ +H+ R  +  +RI     F
Sbjct: 123 FSKEIMEKNSLKTAIIVSNKFHLKRASVIAKRIGIDASF 161


>gi|45656706|ref|YP_000792.1| hypothetical protein LIC10815 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|294828296|ref|NP_713526.2| hypothetical protein LA_3345 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599942|gb|AAS69429.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|293386147|gb|AAN50544.2| conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 258

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 55/148 (37%), Gaps = 23/148 (15%)

Query: 25  YVKQMHIPDHPSVSAIVVLTG----------------EPIRIERAFELLENQIGEKIFIS 68
           Y   + +   P    I+VL G                   R+     L   +   KI  S
Sbjct: 70  YYPPVSLEQLPKADVILVLGGMVSTLSIHDEPVDLFNSAERLTETVRLYRAKKAPKILFS 129

Query: 69  GV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           G      + +V +     +   +  + +  + +  K+ NT  N   A    +++ ++ V+
Sbjct: 130 GGSGNLFYQTVPESEPAGRFLKQMGIPDSSLILESKSRNTAENKSFAVGLLKEHGWNSVI 189

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYP 151
           +VT  +HM R+    Q   + +  IP+P
Sbjct: 190 LVTSSFHMKRSVEIFQE--NGITIIPFP 215


>gi|251796623|ref|YP_003011354.1| hypothetical protein Pjdr2_2614 [Paenibacillus sp. JDR-2]
 gi|247544249|gb|ACT01268.1| protein of unknown function DUF218 [Paenibacillus sp. JDR-2]
          Length = 219

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 67/192 (34%), Gaps = 25/192 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IRIE 51
             + GL +  +      +  I         +     A +VL G              R++
Sbjct: 21  RLFVGLCLLGVLCCGYLLWLINSYDDSKPIE--QADAAIVL-GASLWSDKPSPALKERLD 77

Query: 52  RAFELLENQIGEKIFISGV----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
            A +L ++       +SG        +++   ++   + + +    + +   A +T  N 
Sbjct: 78  FADKLYKDGKVNMFILSGGLDRNGSKLTEAQGMKAYLLAKGIPADKMLLDNAARSTYENL 137

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +   A ++  + +L+VTHDYH PR   E+ R             S  L    S FK +
Sbjct: 138 LNSKVIAAEHGLNKLLVVTHDYHAPRAM-EMARYLDYENVTAAAFHSEVL----SPFKNQ 192

Query: 168 ILRVLLIEYLKI 179
              VL   Y K 
Sbjct: 193 SREVLA--YAKW 202


>gi|254711639|ref|ZP_05173450.1| hypothetical protein BpinB_15584 [Brucella pinnipedialis B2/94]
 gi|261319263|ref|ZP_05958460.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298486|gb|EEY01983.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 205

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 71/191 (37%), Gaps = 13/191 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFI 67
           F C I   +  + F + +  +   D      I+V  G    R  +A +L ++     I  
Sbjct: 6   FPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILA 64

Query: 68  SGVHHSVSKDILLQKIPIRQD--LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           +G    +    ++    +     L EC      +A +T  NA+ ++    + +    LIV
Sbjct: 65  TGDGDCLLNKHIMMAKGVPPSAILVEC------RAGSTWQNARFSAPLLRRLHAKSALIV 118

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLS 183
           T+ +H  R     +     + F   P+   D+          ++  ++ EY K    L+S
Sbjct: 119 TNWFHSRRAVASFRTACPQMHFTSSPMADADMP-GGFPGTPPVIEHVVKEYAKLGWYLIS 177

Query: 184 IQLSLSTQTAS 194
            ++     T S
Sbjct: 178 GRIRPQNLTDS 188


>gi|310642426|ref|YP_003947184.1| protein [Paenibacillus polymyxa SC2]
 gi|309247376|gb|ADO56943.1| Putative uncharacterized protein [Paenibacillus polymyxa SC2]
          Length = 231

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/197 (14%), Positives = 66/197 (33%), Gaps = 33/197 (16%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV-----SAIVVLT---------GEPIRIE 51
             +   +IF ++GF+     V  M+     +        IV+           G   R+E
Sbjct: 33  RFILGLMIFILVGFVWAGIRVWNMNTAASTNPLQHAQIGIVLGASMWGAEPSPGLKERLE 92

Query: 52  RAFELLENQIGEKIFISGV----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
            A  L  N   +++ +SG         ++   +Q+  + + +    I +  +A +T  N 
Sbjct: 93  EALWLYRNGTVQRLIVSGGLDQPDFPYTEAEGMQRYLVDRGVPVQHILLENQATSTYENL 152

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF---LELQRINSTVQFIPYPIIS---------- 154
             +    ++ +++  +I+TH YH PR       L   +  +      +++          
Sbjct: 153 LYSQRIMKEYDWNSTVIITHSYHGPRAMEIAQFLNFDHPQMALTESKVLNMPIHQSREVL 212

Query: 155 --HDLEENSSIFKIKIL 169
                         +  
Sbjct: 213 AYAKWTLQRWWISAQTW 229


>gi|256059361|ref|ZP_05449563.1| hypothetical protein Bneo5_03263 [Brucella neotomae 5K33]
 gi|261323321|ref|ZP_05962518.1| Bme2 [Brucella neotomae 5K33]
 gi|261299301|gb|EEY02798.1| Bme2 [Brucella neotomae 5K33]
          Length = 205

 Score = 74.5 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 71/191 (37%), Gaps = 13/191 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFI 67
           F C I   +  + F + +  +   D      I+V  G    R  +A +L ++     I  
Sbjct: 6   FPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGCSPYILA 64

Query: 68  SGVHHSVSKDILLQKIPIRQD--LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           +G    +    ++    +     L EC      ++ +T  NA+ ++    + +    LIV
Sbjct: 65  TGDGDCLLNKHIMMAKGVPPSAILVEC------RSGSTWQNARFSAPLLRRLHAKSALIV 118

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLS 183
           T+ +H  R     +     + F   P+   D+          ++  ++ EY K    L+S
Sbjct: 119 TNWFHSRRAVASFRTACPQMHFTSSPVADADMP-GGFPGTPPVIEHVVKEYAKLGWYLIS 177

Query: 184 IQLSLSTQTAS 194
            ++     T S
Sbjct: 178 GRIRPQNLTDS 188


>gi|186681117|ref|YP_001864313.1| hypothetical protein Npun_F0616 [Nostoc punctiforme PCC 73102]
 gi|186463569|gb|ACC79370.1| protein of unknown function DUF218 [Nostoc punctiforme PCC 73102]
          Length = 263

 Score = 74.5 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 74/219 (33%), Gaps = 39/219 (17%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------------EPIRI 50
            L  C   +I   +      + + +   P   AIVVL G                   R+
Sbjct: 47  LLLFCSNAWIAKSLVRSLEWQNLPLAQIPVAEAIVVLGGATKSAFPPRPTVDLSESGDRV 106

Query: 51  ERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
             A +L   +    I +SG           +   +  I     +    I    ++LNT  
Sbjct: 107 IYAAQLYRQKRAPIIILSGGRIDWRGGGSPESADMATILTSIGIPSEAIVQEPESLNTYQ 166

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENS 161
           NA       E    + VL+VT   HMPR+    QR    +  IP P    +   +L+E  
Sbjct: 167 NAVNVRKILESRGINQVLLVTSAMHMPRSLNIFQR--QGINVIPAPTDFLVSQGELQELG 224

Query: 162 SIFKIKILRVL------------LIEYLKILLLSIQLSL 188
              K  IL +L            L EY+  L+  ++  L
Sbjct: 225 GTPKAAILNLLPDTDNLHQFTSALKEYIGSLIYRLRGWL 263


>gi|115380347|ref|ZP_01467350.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115362646|gb|EAU61878.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 233

 Score = 74.5 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 63/184 (34%), Gaps = 26/184 (14%)

Query: 6   YGLFVCLIF----FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE--------------- 46
            GL V   F       G + ++    +          A++VL G                
Sbjct: 19  LGLAVLYTFSIEPVAGGLMRWVESGAKETYRPEVVYDAVIVLGGGLDPDATERSGRPEYN 78

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC-----CIDIGYK 99
               RI R +ELL       + +SG       + +++   +++ L         I +   
Sbjct: 79  AAVERILRGYELLREGRARHVLLSGGSLDTRPEAVIEATVLQRQLLAWGIAPERIVVEGH 138

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           + NT  NA ++    E+  +  +L++T   H+PR +     +      +   + + D + 
Sbjct: 139 SRNTRENALDSKKLIEERGWKTLLLITSAAHLPRAYGCFAAVGLRPDTLAADVRASDGKR 198

Query: 160 NSSI 163
             S 
Sbjct: 199 PPSW 202


>gi|254430947|ref|ZP_05044650.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
 gi|197625400|gb|EDY37959.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
          Length = 265

 Score = 74.5 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 67/201 (33%), Gaps = 41/201 (20%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIFI 67
                +     P+  A+VVL G                   R+     LL       +  
Sbjct: 64  ERSTALEPASLPAADAVVVLGGGLRPAQPPRRGVEVGEAGDRLLTGVRLLRQGKAPTLVT 123

Query: 68  SG--VHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           SG  VH +  K         + + +   +A   I +  +A  T   A++  A      + 
Sbjct: 124 SGGRVHFTAGKPPPPEAEWARDLAVELGIAPERILLAREARTTAEEARDLGAMGRTRGWS 183

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK------------- 167
            VL+VT   HMPR     QR +  ++ +  P     L + +S                  
Sbjct: 184 RVLLVTSASHMPRALATFQRRS-GLEVVAVPTDFQ-LPQRASYGAPTLGSALLSVAPDAE 241

Query: 168 ---ILRVLLIEYLKILLLSIQ 185
              +  V+L E+L +L+  ++
Sbjct: 242 ALYLSTVMLKEHLGLLVYRLR 262


>gi|78357887|ref|YP_389336.1| hypothetical protein Dde_2846 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78220292|gb|ABB39641.1| hypothetical protein Dde_2846 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 280

 Score = 74.5 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 63/194 (32%), Gaps = 27/194 (13%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            + +C++    G +         + P       +VVL G   R   A +L        ++
Sbjct: 84  AILLCVLG-AGGLLWIAGNATTEYPP--RKADVMVVLGGGLHRAMFAADLYNRGYAPVVY 140

Query: 67  IS--------GV-----HHSVSKDILLQKIPIRQDLAECCIDI-GYKALNTEGNAQEASA 112
           +S        GV     +    +  +  +I   + +    I + GY  ++T G A+  + 
Sbjct: 141 VSRTRPRREAGVMKQHGYRMPDEPEMYVRILTDKGVPMRDIRMYGYDLISTVGEAEALAG 200

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFI----PYPIISHDLEENSSIFKIKI 168
                    VL+VT   H PR  +  +        +    PY                  
Sbjct: 201 ILGDRKL-TVLVVTAPVHAPRAGMVFRHALPRCSILTAGSPYDPFPQ-----RWWNDQDA 254

Query: 169 LRVLLIEYLKILLL 182
            R LL+E +K L  
Sbjct: 255 ARNLLLEGIKTLFY 268


>gi|293400746|ref|ZP_06644891.1| putative periplasmic protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305772|gb|EFE47016.1| putative periplasmic protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 189

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 57/148 (38%), Gaps = 13/148 (8%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL-----------TGEPIRIERAF 54
             +F+ L   +     +  + K  H     S    +VL           T +  R+E A 
Sbjct: 3   LLIFIILFVLLANLYLYHHFPKPKHPLQDISYDVAIVLGYPCNADGSLSTVQKKRMETAI 62

Query: 55  ELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L        + ISG  V ++  +   +    + Q + +  I +  KA NT  N + A  
Sbjct: 63  NLYHKHCVHHLLISGSCVQNTYIEAEKMAAYALTQKIPKQAIVLETKARNTYENLKYAKC 122

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQR 140
             ++N + +++++T   HM R    + +
Sbjct: 123 ICDENQWENIIVITSPSHMRRAAFFVHK 150


>gi|225024219|ref|ZP_03713411.1| hypothetical protein EIKCOROL_01091 [Eikenella corrodens ATCC
           23834]
 gi|224943244|gb|EEG24453.1| hypothetical protein EIKCOROL_01091 [Eikenella corrodens ATCC
           23834]
          Length = 221

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 73/213 (34%), Gaps = 19/213 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQ-MHIPDHPSVSAIVVLTGEP-----------I 48
           +R  W G+ +CL+  ++        V             A VVL G              
Sbjct: 10  LRQVWRGIKLCLLVLLVQAAWCTWLVYSYSTRTASRRADAAVVL-GAAAWGKNPSPVFRE 68

Query: 49  RIERAFELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI     L  N    K+  +G        ++  + ++      +    I +   + +T+ 
Sbjct: 69  RINHGITLYRNNRVGKLIFTGGTPKAGYMTEAEVARRYARGHGVPNKDILLETTSRDTQQ 128

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N +   A    N    V+I++  YH+ R       +    Q  P P   +  +  +    
Sbjct: 129 NLENTKALMYNNGLESVVIISDPYHLARAAAVADYVGLDYQTEPTPTSRYSGQSRAKFMA 188

Query: 166 IKILRVLLIEYLKI---LLLSIQLSLSTQTASQ 195
            ++L ++  ++ ++   +    +  L ++ A Q
Sbjct: 189 SEVLSLMAFQWWRLSETVAAYGRDYLLSRQAGQ 221


>gi|310823295|ref|YP_003955653.1| hypothetical protein STAUR_6067 [Stigmatella aurantiaca DW4/3-1]
 gi|309396367|gb|ADO73826.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 256

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 63/184 (34%), Gaps = 26/184 (14%)

Query: 6   YGLFVCLIF----FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE--------------- 46
            GL V   F       G + ++    +          A++VL G                
Sbjct: 42  LGLAVLYTFSIEPVAGGLMRWVESGAKETYRPEVVYDAVIVLGGGLDPDATERSGRPEYN 101

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC-----CIDIGYK 99
               RI R +ELL       + +SG       + +++   +++ L         I +   
Sbjct: 102 AAVERILRGYELLREGRARHVLLSGGSLDTRPEAVIEATVLQRQLLAWGIAPERIVVEGH 161

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           + NT  NA ++    E+  +  +L++T   H+PR +     +      +   + + D + 
Sbjct: 162 SRNTRENALDSKKLIEERGWKTLLLITSAAHLPRAYGCFAAVGLRPDTLAADVRASDGKR 221

Query: 160 NSSI 163
             S 
Sbjct: 222 PPSW 225


>gi|309781486|ref|ZP_07676222.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308919899|gb|EFP65560.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 168

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/160 (19%), Positives = 58/160 (36%), Gaps = 11/160 (6%)

Query: 29  MHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPI 85
              P       IVVL GE   R+  A EL       ++F+SG      + + +++  +P 
Sbjct: 16  REEPRLAHADVIVVLGGESGQRVIGAAELYHAGAAPRVFVSGQGDCLLIERRLVMAGVPA 75

Query: 86  RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV 145
            +   EC       + +T  NA+              ++VT  YH  R     ++    +
Sbjct: 76  ERIGHECV------SGSTMENARMTRETLAGQQVQSAILVTSWYHTGRALAVFRKAWPEI 129

Query: 146 QFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
            +    +   D    S          +L EY+K +  +++
Sbjct: 130 TWGAQGVFPGDTLAKSVPVYEAGS--ILAEYVKRVWYAVR 167


>gi|281418736|ref|ZP_06249755.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|281407820|gb|EFB38079.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
          Length = 251

 Score = 73.7 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 56/143 (39%), Gaps = 24/143 (16%)

Query: 30  HIPDHPSVSAIVVLTGEP------------------IRIERAFELLENQIGEKIFISGV- 70
             P   +   I++L G                     R+    +L        I ISG  
Sbjct: 70  QPPSELNGDVIIMLGGGAFADTPNVNGKGHLSSIAANRLLTCVQLYYKLDVP-IIISGGQ 128

Query: 71  --HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
              H+ S+  + + I +   + E  I +  ++LNT  NA       +K+ F+  ++VT  
Sbjct: 129 IPGHTTSEGEIARNILLSLGVPEEKIIVENRSLNTTQNAFYTKELLDKHGFNKPILVTSA 188

Query: 129 YHMPRTFLELQRINSTVQFIPYP 151
           +HM R   + ++  + V  IPYP
Sbjct: 189 FHMKRAVKQFEK--NEVNVIPYP 209


>gi|217976941|ref|YP_002361088.1| protein of unknown function DUF218 [Methylocella silvestris BL2]
 gi|217502317|gb|ACK49726.1| protein of unknown function DUF218 [Methylocella silvestris BL2]
          Length = 264

 Score = 73.7 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 55/150 (36%), Gaps = 10/150 (6%)

Query: 45  GEPIRIERAFELLENQIGEKIFISG-----VHHSVSKDILLQKIPIRQDLAECCIDIGYK 99
           G+  R+    EL +     ++  +G     V  ++ +   ++K  +   +    ++   +
Sbjct: 104 GDGERLIAGIELSKRYPSARLVFTGGSGNLVEQTIVESTGVKKFWLDMGVPPDRMEFESR 163

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           + NT  NA               L+VT  +HMPR+    +R+   V   P    +     
Sbjct: 164 SRNTWENALFTRDLLRPKPGETWLLVTSAWHMPRSMGIFRRLGFDVIAYPVAYRTSGDSS 223

Query: 160 NSSIFKIKILR-----VLLIEYLKILLLSI 184
           + S  +    R     +   E++ +L   +
Sbjct: 224 DWSFLRPAFERVPLVVLAFREWIGLLAYRL 253


>gi|225628868|ref|ZP_03786902.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|254706062|ref|ZP_05167890.1| hypothetical protein BpinM_03433 [Brucella pinnipedialis
           M163/99/10]
 gi|254712252|ref|ZP_05174063.1| hypothetical protein BcetM6_02514 [Brucella ceti M644/93/1]
 gi|254715323|ref|ZP_05177134.1| hypothetical protein BcetM_02529 [Brucella ceti M13/05/1]
 gi|256029727|ref|ZP_05443341.1| hypothetical protein BpinM2_03558 [Brucella pinnipedialis
           M292/94/1]
 gi|256157879|ref|ZP_05455797.1| hypothetical protein BcetM4_03368 [Brucella ceti M490/95/1]
 gi|256253159|ref|ZP_05458695.1| hypothetical protein BcetB_02424 [Brucella ceti B1/94]
 gi|260167184|ref|ZP_05753995.1| Bme2 protein [Brucella sp. F5/99]
 gi|261217053|ref|ZP_05931334.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220265|ref|ZP_05934546.1| Bme2 [Brucella ceti B1/94]
 gi|261313499|ref|ZP_05952696.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261319923|ref|ZP_05959120.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261756588|ref|ZP_06000297.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265986738|ref|ZP_06099295.1| Bme2 [Brucella pinnipedialis M292/94/1]
 gi|265996388|ref|ZP_06108945.1| Bme2 [Brucella ceti M490/95/1]
 gi|225616714|gb|EEH13762.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260918849|gb|EEX85502.1| Bme2 [Brucella ceti B1/94]
 gi|260922142|gb|EEX88710.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292613|gb|EEX96109.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261302525|gb|EEY06022.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261736572|gb|EEY24568.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|262550685|gb|EEZ06846.1| Bme2 [Brucella ceti M490/95/1]
 gi|264658935|gb|EEZ29196.1| Bme2 [Brucella pinnipedialis M292/94/1]
          Length = 205

 Score = 73.7 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 71/191 (37%), Gaps = 13/191 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFI 67
           F C I   +  + F + +  +   D      I+V  G    R  +A +L ++     I  
Sbjct: 6   FPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILA 64

Query: 68  SGVHHSVSKDILLQKIPIRQD--LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           +G    +    ++    +     L EC      ++ +T  NA+ ++    + +    LIV
Sbjct: 65  TGDGDCLLNKHIMMAKGVPPSAILVEC------RSGSTWQNARFSAPLLRRLHAKSALIV 118

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLS 183
           T+ +H  R     +     + F   P+   D+          ++  ++ EY K    L+S
Sbjct: 119 TNWFHSRRAVASFRTACPQMHFTSSPMADADMP-GGFPGTPPVIEHVVKEYAKLGWYLIS 177

Query: 184 IQLSLSTQTAS 194
            ++     T S
Sbjct: 178 GRIRPQNLTDS 188


>gi|116622945|ref|YP_825101.1| hypothetical protein Acid_3847 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226107|gb|ABJ84816.1| protein of unknown function DUF218 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 204

 Score = 73.7 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 59/156 (37%), Gaps = 13/156 (8%)

Query: 36  SVSAIVVLTGE--PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQD-LA 90
                VVL G+    R++ A EL++     +I +SG    +  ++        ++Q    
Sbjct: 45  KADVAVVLAGDYWGYRLQHAAELVKQGYVPRILVSGPPGFYGTNESDAAIHWALQQGYPP 104

Query: 91  ECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI------NST 144
           E  + + ++A +T   A+    +  ++N H  L+VT +YH  R                 
Sbjct: 105 EWFVAVPHQATSTLAEAKVMLTYMRQHNIHSFLLVTSNYHTARARRIFLGAERDSGGGPE 164

Query: 145 VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           ++ +  P         +     +  +   +E+ K +
Sbjct: 165 MRVVAAP--DKYFTPEAWWQSREGRKTAFMEWTKTV 198


>gi|146341164|ref|YP_001206212.1| hypothetical protein BRADO4236 [Bradyrhizobium sp. ORS278]
 gi|146193970|emb|CAL77987.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 262

 Score = 73.7 bits (180), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 69/180 (38%), Gaps = 28/180 (15%)

Query: 32  PDHPSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISG----- 69
           P   +   I+VL G                    R+ +A  L       ++  +G     
Sbjct: 74  PAKGAPDGIIVLGGPVDSDLSAIYGMPVTVAGADRVIQAAVLARRYPNARVLFTGGSANL 133

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           +     +  +  +I     +A+  + +  ++ NT  NA  + A          L+VT  Y
Sbjct: 134 IATDAKEADVGAEILESLGVAKQRLLLERQSRNTYENAIFSKAMIAPKPGERWLLVTSAY 193

Query: 130 HMPRTFLELQRINSTVQFIPYPI---ISHDLEENS-SIFKIKILRVLLIEYLKILLLSIQ 185
           HMPR+    ++    V+  PYP+   +   L+ +  S+  ++   + + E++ ++   ++
Sbjct: 194 HMPRSVGLFRKAGFPVE--PYPVDWRVGRVLDFDGVSLQGLRRADIAVREWVGLVAYRLR 251


>gi|75906624|ref|YP_320920.1| hypothetical protein Ava_0399 [Anabaena variabilis ATCC 29413]
 gi|75700349|gb|ABA20025.1| Protein of unknown function DUF218 [Anabaena variabilis ATCC 29413]
          Length = 263

 Score = 73.7 bits (180), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 41/210 (19%), Positives = 71/210 (33%), Gaps = 35/210 (16%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------------EPIRIERAF 54
           C   ++  ++      + +     P+  AI+VL G                +  R+  A 
Sbjct: 51  CSNAWVAKYLVRSLEWQNLPPAQLPNAEAIIVLGGATKSVFPPRITPDLSEQGDRVIYAA 110

Query: 55  ELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           +L        I +SG          S+   +  I     +    +     +LNT  NA  
Sbjct: 111 QLYRQNKAPLIILSGGRIDWRGSGSSESTDMANILTSLGIPASVLIEEPDSLNTYQNAVN 170

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP--YPIISHDLEENSSIFKIK 167
                       VL+VT   HMPR+    QR    V   P  + + + +L+E  +  K  
Sbjct: 171 VKKILASRGIDKVLLVTSALHMPRSLKIFQRQGMNVIPAPTDFLVSAGELQELGNTPKAA 230

Query: 168 ILRVL------------LIEYLKILLLSIQ 185
           IL +L            L EY+   +  ++
Sbjct: 231 ILNLLPDTYNLHLFTNALKEYVGSFIYWLR 260


>gi|260887636|ref|ZP_05898899.1| putative membrane protein [Selenomonas sputigena ATCC 35185]
 gi|330837998|ref|YP_004412578.1| protein of unknown function DUF218 [Selenomonas sputigena ATCC
           35185]
 gi|260862652|gb|EEX77152.1| putative membrane protein [Selenomonas sputigena ATCC 35185]
 gi|329745762|gb|AEB99118.1| protein of unknown function DUF218 [Selenomonas sputigena ATCC
           35185]
          Length = 252

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 61/143 (42%), Gaps = 16/143 (11%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVH 71
           +  ++G  +F          D P V     LT  P  R+  A  L   ++   I +SG  
Sbjct: 78  VVIMLGGGAFS---------DAPDVDGEGALTASPSTRLLTAVRL-AQKLDLPILVSGGQ 127

Query: 72  ---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
               S  + +L ++  +   + E  I +   + NT  NA   +   +++     ++VT  
Sbjct: 128 VFQESGKEALLAKRTLVSLGIPESRILVEGASQNTVQNAAYTAKILKEHGLVRPILVTSA 187

Query: 129 YHMPRTFLELQRINSTVQFIPYP 151
           +HM R+ L  +++   ++ +PYP
Sbjct: 188 FHMKRSVLNYEKL--GIEVVPYP 208


>gi|308069364|ref|YP_003870969.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
 gi|305858643|gb|ADM70431.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
          Length = 228

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 60/197 (30%), Gaps = 33/197 (16%)

Query: 6   YGLFVCLIFFIMGFISFIRYV-----KQMHIPDHPSVSAIVVLT---------GEPIRIE 51
             +   +IF ++G +     V          P       IV+           G   R+E
Sbjct: 30  RLVLCLMIFILVGLVWAGIRVWDMNTAASTTPLQQVQIGIVLGASMWGAEPSPGLKERLE 89

Query: 52  RAFELLENQIGEKIFISGV----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
            A  L  N   +++ +SG         ++   +Q+  + + +    I +   A +T  N 
Sbjct: 90  EALRLYRNGTVQRLIVSGGLDKPDFPYTEAEGMQRYLVDRGVPVQHIVLENHATSTYENL 149

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF---LELQRINSTVQFIPYPIIS---------- 154
             +     +  +   +I+TH YH PR       L+  +  +      +++          
Sbjct: 150 LYSQRIMSEYGWISTVIITHSYHGPRAMEIAQFLKFDHPQMALTESKVLNMPIHQSREVL 209

Query: 155 --HDLEENSSIFKIKIL 169
                         +  
Sbjct: 210 AYAKWTLQRWWISAQTW 226


>gi|238021623|ref|ZP_04602049.1| hypothetical protein GCWU000324_01525 [Kingella oralis ATCC 51147]
 gi|237866237|gb|EEP67279.1| hypothetical protein GCWU000324_01525 [Kingella oralis ATCC 51147]
          Length = 213

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 61/168 (36%), Gaps = 18/168 (10%)

Query: 1   MRYFWYGLFV--CLIFFIMGF-ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +RY  YG  +    IF +  +    +               A VVL G            
Sbjct: 7   LRYLRYGFLLSILSIFALQAWCAWQVYQYAHAPAALPKHADAAVVL-GAAAWGDKPSPVF 65

Query: 48  -IRIERAFELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++  EK+  +G        S+  + +K  ++Q +    I    ++ +T
Sbjct: 66  RERINHAIALYQSERVEKLIFTGGTRKEGYPSEGEVARKFALKQGIPSHDIIYETRSKDT 125

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             N        +K+  HHV+IV+  YHM R     + +       P P
Sbjct: 126 YQNLVNTRLLMQKHKLHHVIIVSDPYHMARAIAIARDLGIPATPSPTP 173


>gi|17989186|ref|NP_541819.1| hypothetical protein BMEII0841 [Brucella melitensis bv. 1 str. 16M]
 gi|17985041|gb|AAL54083.1| hypothetical protein BMEII0841 [Brucella melitensis bv. 1 str. 16M]
          Length = 180

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 62/167 (37%), Gaps = 12/167 (7%)

Query: 33  DHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQD--L 89
           D      I+V  G    R  +A +L ++     I  +G    +    ++    +     L
Sbjct: 4   DGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILATGDGDCLLNKHIMMAKGVPPSAIL 63

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            EC      ++ +T  NA+ ++    + +    LIVT+ +H  R     +     + F  
Sbjct: 64  VEC------RSGSTWQNARFSAPLLRRLHAKSALIVTNWFHSRRAVASFRTACPQMHFTS 117

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLSIQLSLSTQTAS 194
            P+   D+          ++  ++ EY K    L+S ++     T S
Sbjct: 118 SPVADADMP-GGFPGTPPVIEHVVKEYAKLGWYLISGRIRPQNLTDS 163


>gi|85715468|ref|ZP_01046449.1| hypothetical protein NB311A_17224 [Nitrobacter sp. Nb-311A]
 gi|85697663|gb|EAQ35539.1| hypothetical protein NB311A_17224 [Nitrobacter sp. Nb-311A]
          Length = 266

 Score = 73.0 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 74/225 (32%), Gaps = 48/225 (21%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIP---DHPSVSAIVVL--------- 43
           R    GL    I  ++ F         +  + +   P   D  +   I++L         
Sbjct: 35  RRTGLGLLTAGIAALLIFGYSPLSNVLLLTLSERFPPWHFDGRAPDGIIILGGSIQPPLS 94

Query: 44  --------TGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC--- 92
                    G   R+    EL +     ++  SG    +++    ++ PI   L E    
Sbjct: 95  VARQTVEIDGAAERVIGGLELAQRFPEARVVYSGGSGQLTEGS-AREAPIAGSLFERFGI 153

Query: 93  ---CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
               I +  ++  T  NA+ +            L+VT  YHMPR+    ++    V+  P
Sbjct: 154 TPERIVLENESRTTYENARFSRELVAPKPGERWLLVTSAYHMPRSIGVFRKAGFEVE--P 211

Query: 150 YPIISHDLEENSSIFKIKILRVL----------LIEYLKILLLSI 184
           YP+   D      I   +    L          + E++ +L   +
Sbjct: 212 YPV---DWRTRGWIDAWRPFNRLTTGLACADIAVHEWVGLLAHWM 253


>gi|312796171|ref|YP_004029093.1| integral membrane protein [Burkholderia rhizoxinica HKI 454]
 gi|312167946|emb|CBW74949.1| Integral membrane protein [Burkholderia rhizoxinica HKI 454]
          Length = 239

 Score = 73.0 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 55/164 (33%), Gaps = 25/164 (15%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEPI---------------RIERAFE---LLENQIGE-KIF 66
           V     P +    AIV+L                    RI+ A     L   Q  +  + 
Sbjct: 52  VPAASPPRYGGNVAIVLLGSGTEYDDAHRLVPKFDAWRRIDAAAAQFILCRAQRAQCTLV 111

Query: 67  ISGVHHSVSKDILLQKIP---IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           +SG +    +           +   +    I +   +LNT  NA+   A   ++++  ++
Sbjct: 112 VSGGNPQKHEHSEAANYQPHLVSHGVPAANIVLEPDSLNTYENARNTGAILRRHHYDQIV 171

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           ++T  YH+PR  L+       +  +P    ++     S      
Sbjct: 172 LITSAYHLPRALLDFHHF--GIDVVPLA-SNYRWRRPSWRPHPA 212


>gi|220908126|ref|YP_002483437.1| hypothetical protein Cyan7425_2730 [Cyanothece sp. PCC 7425]
 gi|219864737|gb|ACL45076.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 279

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 40/193 (20%), Positives = 74/193 (38%), Gaps = 23/193 (11%)

Query: 8   LFVCLIFFIMGF---ISFIRYVKQMHIPDHPSV--SAIVVLTGEP---IRIERAFELLEN 59
           + + ++  I  F   ++   Y+    +P        AIVVL   P    R   A EL + 
Sbjct: 76  IALVVLALIATFPPVVTLANYLLVSPLPQDTGARVDAIVVLGRGPISGDRAAVAAELWQA 135

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLA--ECCIDIGYKALNTEGNAQEASAWAEKN 117
               K+F+SG   +      L+K  +       E C      +  TE NAQ  +   +  
Sbjct: 136 GRAPKVFVSGRGDAPYLVKELRKYGVSASALASEDC------SQTTEENAQFTARLLQPQ 189

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
              H+L++T   HM R+++  +R+        + +I H       +   K    +  EY 
Sbjct: 190 GVQHILLITDSPHMLRSWMTFERVG-------FQVIPHGNALPHWLSHRKHALTVYREYA 242

Query: 178 KILLLSIQLSLST 190
            ++  ++Q  +  
Sbjct: 243 GLISYTLQGRIQP 255


>gi|294675706|ref|YP_003576321.1| hypothetical protein RCAP_rcc00149 [Rhodobacter capsulatus SB 1003]
 gi|294474526|gb|ADE83914.1| protein of unknown function DUF218 [Rhodobacter capsulatus SB 1003]
          Length = 187

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 9/135 (6%)

Query: 53  AFELLENQIGEKIFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A  L  + +   + ISG   +V         +   +R  +AE  + +   A NT  NA  
Sbjct: 40  AIALYRSGLTRTLLISGAGTAVDGSAEWSFYRDHALRAGVAESALLLEKNARNTAENAAF 99

Query: 110 ASAWAEKN----NFHHVLIVTHDYHMPRTFLELQR-INSTVQFIPYPI-ISHDLEENSSI 163
            +A             + +    +HM R  + L+R +   V+ +  P     DL   +  
Sbjct: 100 GAALIGTELGWAKIRSLAVCAKPFHMRRALMTLRRHVPPEVRLVAQPPDDPGDLSAETWW 159

Query: 164 FKIKILRVLLIEYLK 178
              +  + +  E  K
Sbjct: 160 QTAQGRKRIFTELGK 174


>gi|255068057|ref|ZP_05319912.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
 gi|255047655|gb|EET43119.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
          Length = 214

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 59/165 (35%), Gaps = 22/165 (13%)

Query: 3   YFWYGLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------I 48
           Y + G+ + ++  +  F      + +     +P H    A +VL G              
Sbjct: 14  YLFRGIGLSILLVLGIFGEGAWQVYHTGSQPLPGHVRADAALVL-GAAAWDKRPSPIFRE 72

Query: 49  RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A  L ++   EKI  +G       +++  + ++  ++Q +    I     + NT  
Sbjct: 73  RINHAITLYQSHRVEKIVFTGGTPKKGYMTEAEVGRRYALKQGIPAHNILFENTSRNTYE 132

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
           N +             ++IV+  YH+ R       I S +    Y
Sbjct: 133 NIRNIRPILRAEGIGSIIIVSDPYHLARAL----EIASDLDIEAY 173


>gi|255527086|ref|ZP_05393975.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296188150|ref|ZP_06856542.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
 gi|255509238|gb|EET85589.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296047276|gb|EFG86718.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
          Length = 197

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 59/149 (39%), Gaps = 18/149 (12%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----EPI-------RI 50
           +   YG+ + +   I+     I + +            I+VL G              R 
Sbjct: 6   KLVLYGIGILVFLVIIFAFQVIYFGESSKPE---KSDCIIVL-GCKVYGSTPSPFLIWRT 61

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +    L +   G+ I +SG      S+S+   +++  + + +    I +  K+ +T  N 
Sbjct: 62  DEGLRLFKEGYGKYIIVSGGKGQGESISEAEAMKRYLVSKGVDSSKIILEDKSASTMANL 121

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             + +  EK NF   +IV++ YH+ R  L
Sbjct: 122 INSKSIMEKKNFKTAIIVSNKYHLKRASL 150


>gi|114566272|ref|YP_753426.1| hypothetical protein Swol_0732 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114337207|gb|ABI68055.1| hypothetical protein Swol_0732 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 211

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 70/196 (35%), Gaps = 23/196 (11%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTG-EPIRIERAFELLENQIGEK 64
            LF+C+I   +  + F      +   D P     I+VL G  P RI  A EL E      
Sbjct: 8   ALFICIILLALLAVFFRYAGVGIVSSDSPEKADFIIVLMGSGPDRILGAVELYEKGYAPY 67

Query: 65  ------------IFIS-GVHHSVSKDILLQKIPIRQDLAE-CCIDIGYKALNTEGNAQEA 110
                       +  S GV        L   + ++  + E   I +   A +T+  A   
Sbjct: 68  IMMVENWQPGYELLESRGVE-LPRDAELAASVGVQLGIPEEAFIILPGDARSTQDEALIV 126

Query: 111 SAWAEKN--NFHHVLIVTHDYHMPRTFL----ELQRINSTVQFIPYPIISHDLEENSSIF 164
           + + ++       VL+V+  +H  R        L      V+ +  P    D    +   
Sbjct: 127 TQYLKEQQAGVDMVLLVSSKFHSKRAAKIFCWALADSGQDVKVLSCPTPYDDFNAAAWWQ 186

Query: 165 KIKILRVLLIEYLKIL 180
             +  + ++ EY+K++
Sbjct: 187 SREDAKRVVSEYVKLV 202


>gi|159186332|ref|NP_355852.2| hypothetical protein Atu4812 [Agrobacterium tumefaciens str. C58]
 gi|159141466|gb|AAK88637.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 232

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 62/194 (31%), Gaps = 15/194 (7%)

Query: 3   YFW------YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-EPIRIERAFE 55
           + W       G+ +     + G          +          IVVL G  P R  +A +
Sbjct: 33  WLWKRNSIVLGVIILGAIGLYGLALVSAGSLLVVEDPPAQADVIVVLGGDGPPRAAQAAK 92

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           L        + ++G          ++ + +R  +    +     +L+T  NA  A     
Sbjct: 93  LWHEGKAPLVLVTGYGDC----DFIRDMLVRSGVDFAAVSTECLSLSTWENATFAQPILT 148

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP-IISHDLEENSSIFKIKILRVLLI 174
                  ++VT  +H  R     + +   +Q+I  P   +  L   +       +     
Sbjct: 149 GMGAKRAILVTSWFHSRRAVKRFRFVMPQIQWISLPAQRTVSLWRLAINGDGVQV---FK 205

Query: 175 EYLKILLLSIQLSL 188
           EY K L   ++ S 
Sbjct: 206 EYAKALFYDVRSSF 219


>gi|15606980|ref|NP_214362.1| hypothetical protein aq_1986 [Aquifex aeolicus VF5]
 gi|2984233|gb|AAC07762.1| hypothetical protein aq_1986 [Aquifex aeolicus VF5]
          Length = 241

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 67/180 (37%), Gaps = 31/180 (17%)

Query: 30  HIPDHPSVSAIVVLTGE-----------PIRIERAFELLENQIGEKIFISG-----VHHS 73
             P+     AIVVL G              R+   F LL  ++ + I +SG     V   
Sbjct: 66  KKPEVLKGDAIVVLGGGVYNNGRLKASSFKRLITGF-LLYKELKKPIILSGGASINVIPE 124

Query: 74  VSK-DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN-NFHHVLIVTHDYHM 131
                 LL+   + ++     I    ++ +T  NA+      EK      V++VT  +HM
Sbjct: 125 AKVMKELLRSFGVPEE----DIYTDVRSRDTFENAKFVKEMCEKLLKCKEVILVTSGFHM 180

Query: 132 PRTFLELQRINSTVQFIPYPI---ISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
           PR     ++    ++ IPYP            S   K  +     + + EY+ +L   ++
Sbjct: 181 PRAVGVFKKA--GLEVIPYPTDLKFEGKYNVYSLFPKYSVFYDSSIAIREYIGLLFYKLK 238


>gi|78186865|ref|YP_374908.1| hypothetical protein Plut_1003 [Chlorobium luteolum DSM 273]
 gi|78166767|gb|ABB23865.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 196

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 62/185 (33%), Gaps = 11/185 (5%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIF 66
           L V  I    GF+S + ++             IV+L G+   R+ +  EL  N    ++ 
Sbjct: 12  LLVAAILAGAGFLS-LGFLLSCQAGTPEKTDVIVILGGDSGRRVRKGAELYRNGYAPRVI 70

Query: 67  ISGVHHS-VSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++G+         L   QK  +   +    I +  ++  T   A   +   ++N +   L
Sbjct: 71  LTGIDERYYRPGKLNWRQKRMVALGVPLSAISVDSRSETTWEEAFNTAETMKRNGWKKAL 130

Query: 124 IVTHDYHMPRT----FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
           +V+   HM R         ++   +   I                     R +  E  K 
Sbjct: 131 VVSDPPHMFRLKSTWMQAFRKTPRSFILIAT--SPEWWNPVLWWKNSISSRFVYSELKKN 188

Query: 180 LLLSI 184
           L  ++
Sbjct: 189 LFYAL 193


>gi|21241154|ref|NP_640736.1| hypothetical protein XAC0380 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21106459|gb|AAM35272.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 201

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 53/148 (35%), Gaps = 20/148 (13%)

Query: 3   YFWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + W    + LI+ +   G+I +I    Q           I+VL               RI
Sbjct: 13  WGWRLCMLALIWLVAVAGWIVWIGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERI 67

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A +L       ++  +G        ++  + ++  +R  +    I I   +  T  N 
Sbjct: 68  RHALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPDAIVIETTSRTTRQNL 127

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           ++A    E++  H  +IV+   HM R  
Sbjct: 128 EQARTLMERHGLHRAIIVSDPLHMARAL 155


>gi|189500318|ref|YP_001959788.1| hypothetical protein Cphamn1_1378 [Chlorobium phaeobacteroides BS1]
 gi|189495759|gb|ACE04307.1| protein of unknown function DUF218 [Chlorobium phaeobacteroides
           BS1]
          Length = 196

 Score = 72.2 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 65/177 (36%), Gaps = 8/177 (4%)

Query: 16  IMGFISFIR--YVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHH 72
           ++G + F    Y+   +         I+VL G+   R+++   L        + ++G+  
Sbjct: 17  VIGVLVFAGLGYLVSSYQSKPEKADVIIVLGGDDGPRVDKGGSLFNAGYAPNVVLTGIDS 76

Query: 73  SV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
                S+    ++      + +  I++   +  T   A  + A  ++  +++ ++V+   
Sbjct: 77  RYYRPSRPNWRERRLAEAGVPQTAINVDTTSETTWEEALNSVAMMQEKGWNNAIVVSDPP 136

Query: 130 HMPR--TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           HM R  +  +     S+  FI         + +         R ++ E  K +   +
Sbjct: 137 HMLRLHSTWKRAFKGSSKSFILVATSPEWWKPHLWWQNETSYRFVISEIKKNIYYRV 193


>gi|110633719|ref|YP_673927.1| hypothetical protein Meso_1366 [Mesorhizobium sp. BNC1]
 gi|110284703|gb|ABG62762.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 266

 Score = 72.2 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 75/215 (34%), Gaps = 38/215 (17%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQM-------HIPDHPSVSAIVVLTGE------------ 46
           +G+F  L+  + G+ +F   +            P    V  I+VL G             
Sbjct: 41  FGVFAFLVVALAGWTTFGAMLLHPLESRFARPDPAPQHVDGIIVLGGGFEGAVNLARGGY 100

Query: 47  -----PIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDI 96
                  R   A  L       ++ +SG                 ++     +A   I++
Sbjct: 101 ELNDSGDRFVEAAILARRYPEARLIVSGGSGSVFLPGEGDADTAPRLLTALGVAPERIEL 160

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--- 153
             ++ +T  NA+ + + AE       L+VT  +HMPR     ++       +P+P     
Sbjct: 161 DNRSRDTFENARFSMSMAEPGPDETWLLVTSAFHMPRAVGAFRQA--GFPILPWPADYKT 218

Query: 154 ----SHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
                  L +++ +  ++   + + E++ +L   +
Sbjct: 219 TGREKPGLTDDNVLDSLRNTSIGIREWVGLLAYRM 253


>gi|114704894|ref|ZP_01437802.1| hypothetical protein FP2506_08156 [Fulvimarina pelagi HTCC2506]
 gi|114539679|gb|EAU42799.1| hypothetical protein FP2506_08156 [Fulvimarina pelagi HTCC2506]
          Length = 270

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 62/186 (33%), Gaps = 31/186 (16%)

Query: 28  QMHIPDHPSVSAIVVLTGE-----------------PIRIERAFELLENQIGEKIFISGV 70
           +  +P    V  I+VL G                    R   +  L     G  +  SG 
Sbjct: 70  ERPVPMPAEVDGIIVLGGAFDTRVARTRGVIELNEAADRASVSVALARTYPGADVLFSGG 129

Query: 71  HHSVSKDIL-----LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
             +  ++ +      ++  +   L    + +  KA +T  NA  A A A+       L+V
Sbjct: 130 VAAAFREDIPETQSAEQFYLGLGLDPNRLKLDGKARDTFENAVYAKALADPQPGETWLLV 189

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLE-ENSSIFKIKILRVL------LIEYLK 178
           T  YHMPR     + +   V  +PYP+     E  +         R L      + EY+ 
Sbjct: 190 TSAYHMPRAMGCFRTVGFDV--VPYPVDYRTPEGADVWRPSTATTRNLEKVHFAIREYIG 247

Query: 179 ILLLSI 184
           +     
Sbjct: 248 LAAYWA 253


>gi|205374987|ref|ZP_03227778.1| hypothetical protein Bcoam_18347 [Bacillus coahuilensis m4-4]
          Length = 200

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 68/192 (35%), Gaps = 8/192 (4%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPI--RIERAFELLE 58
           +  W+     ++  +   + F R    +   + P     I+VL+G     R   A +L  
Sbjct: 10  KMVWFLFIFVMVLVLAMILLFKRSHTLLVEKNPPVPADVILVLSGGAQGEREAEAAKLYH 69

Query: 59  NQIGEKIFIS--GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
               + I +S   V  +     ++++  I   + +  I       +T   A++A    E+
Sbjct: 70  EGYTDTIVVSMAKVGWNTYTGDIMREHLIHLGVPDNAILTYGDVTSTREEAEQAVPLLEE 129

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
                +++ T  +H  R     +R      ++ I  P+   +   +      +  +    
Sbjct: 130 LAVRKMILTTSSFHSGRAKWIFERTLKEKGIEVISVPVREEEFGSD-WWQTHETRKQGAS 188

Query: 175 EYLKILLLSIQL 186
           E LK +    +L
Sbjct: 189 ELLKYVWEWFRL 200


>gi|319788557|ref|YP_004148032.1| hypothetical protein Psesu_2977 [Pseudoxanthomonas suwonensis 11-1]
 gi|317467069|gb|ADV28801.1| protein of unknown function DUF218 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 202

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 53/155 (34%), Gaps = 15/155 (9%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRIERAFELLEN 59
           V  I ++ G  ++I +V             I+VL               RI     L   
Sbjct: 20  VLAILWLGGVAAWINWVGHRDQAQ--RADVIIVLGAAAYDARPSPVFEERIRHGLNLYRA 77

Query: 60  QIGEKIFISGVHHSVSK---DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
                +  +G + + ++     + Q+  +RQ + E  I I   +  T  N  +A     +
Sbjct: 78  GYAPVLLFTGGYGTGARFAESQVAQRYAVRQGIPEEAILIETASRTTLQNLLQARELMRE 137

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
              H  +IV+   HM R     +++       P P
Sbjct: 138 RQLHSAIIVSDPLHMSRALRLCRQLGIEATGSPTP 172


>gi|325922970|ref|ZP_08184680.1| hypothetical protein XGA_3712 [Xanthomonas gardneri ATCC 19865]
 gi|325546551|gb|EGD17695.1| hypothetical protein XGA_3712 [Xanthomonas gardneri ATCC 19865]
          Length = 205

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 54/148 (36%), Gaps = 20/148 (13%)

Query: 3   YFWYGLFVCLIFFI--MGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + W    +  I+ +   G+I +I    Q           I+VL               RI
Sbjct: 17  WGWRLCMLAAIWLVGVAGWIVWIGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERI 71

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A +L       ++  +G        ++  + ++  +R  +    I I  ++  T  N 
Sbjct: 72  RHALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETESRTTRQNL 131

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           Q+A A  E++  H  +IV+   HM R  
Sbjct: 132 QQARALMERHGMHRAIIVSDPLHMARAL 159


>gi|238027594|ref|YP_002911825.1| hypothetical protein bglu_1g20120 [Burkholderia glumae BGR1]
 gi|237876788|gb|ACR29121.1| Hypothetical protein bglu_1g20120 [Burkholderia glumae BGR1]
          Length = 238

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 61/198 (30%), Gaps = 30/198 (15%)

Query: 4   FWYGLFVCLIFFIMGFISFIRY-VKQMHIPDHPSVSAIVVL-TG-------------EPI 48
                 +   +     ++     V     P     +AI+VL  G                
Sbjct: 29  LALLAGIATGWLTAPLVALAESGVAPAEPPVFAGRTAIIVLGAGIKRHDGLLVPPENGLA 88

Query: 49  RIERAFEL--LENQIGEK--IFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           RI RA EL     + G +  + ++G        ++  L   + + + +    + +  ++ 
Sbjct: 89  RIARAAELHSACQRSGARCTVIVTGGDPHRHGTTEADLYAPLLLERGVPPRDLTLERRSR 148

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE--- 158
            T  NAQ  +      ++   ++VT  Y M R  L+  R        P P+ ++      
Sbjct: 149 TTYENAQYTAPILLAKHYDETILVTSSYQMRRALLDFARFG----VTPQPVFANRDRAIC 204

Query: 159 -ENSSIFKIKILRVLLIE 175
                          L E
Sbjct: 205 GWRPRWTNFVTASRALHE 222


>gi|262195869|ref|YP_003267078.1| hypothetical protein Hoch_2653 [Haliangium ochraceum DSM 14365]
 gi|262079216|gb|ACY15185.1| protein of unknown function DUF218 [Haliangium ochraceum DSM 14365]
          Length = 199

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 47/122 (38%), Gaps = 12/122 (9%)

Query: 31  IPDHPSVSAIVVLTG-----------EPIRIERAFELLENQIGEKIFISGVHHSVSKDIL 79
                   AIVVL                R++ A  L +   G ++ ++G   +   +  
Sbjct: 31  PDAIEPADAIVVLGAPVLAPGRLSEVGRERVDAAVSLYQRGAGPRLCVTGGGPAGRVEAD 90

Query: 80  LQKIPIR-QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
                 R + L E  + I  +A NTE NA+ A+A         V +V+  +H+ R  +  
Sbjct: 91  AMAAHARARGLPEEALRIERQARNTEENARFAAAMLRAEGCRSVWLVSQPFHLARACVWF 150

Query: 139 QR 140
           +R
Sbjct: 151 RR 152


>gi|81300267|ref|YP_400475.1| hypothetical protein Synpcc7942_1458 [Synechococcus elongatus PCC
           7942]
 gi|81169148|gb|ABB57488.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 188

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 65/161 (40%), Gaps = 14/161 (8%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L    +   +G +  +  V         S  AI VL G+P R + A EL +      I++
Sbjct: 4   LIPITLLLSLGVVWGLNRVA----VAQRSPQAIFVLGGDPQREQFAAELAQTHPDLPIWV 59

Query: 68  S-GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           S G +   ++ +  Q    R  L      + Y+A +T  N    +   ++    HV +VT
Sbjct: 60  SSGSNPEYAEWVFSQAGVPRSRLH-----LDYQATDTLSNFTSLADRFQQQGIQHVYLVT 114

Query: 127 HDYHMPRTFL--ELQRINSTVQFIPYPIISHDLEENSSIFK 165
            DYHM R  +   +   +  + F P P+ S     + S  K
Sbjct: 115 SDYHMRRALVIANIVFASRGITFEPVPVPSD--RASESWRK 153


>gi|241663925|ref|YP_002982285.1| hypothetical protein Rpic12D_2339 [Ralstonia pickettii 12D]
 gi|240865952|gb|ACS63613.1| protein of unknown function DUF218 [Ralstonia pickettii 12D]
          Length = 190

 Score = 71.8 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 62/186 (33%), Gaps = 11/186 (5%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQI 61
             W G    +       +           P       IVVL GE   R+  A EL     
Sbjct: 12  LAWIGGCAIVAMAFSAVLVCGAKSWLREEPRLAHADVIVVLGGESGQRVIGAAELYHAGA 71

Query: 62  GEKIFISGVHH--SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             ++F+SG      + + +++  +P  +   EC       + +T  NA+           
Sbjct: 72  APRVFVSGQGDCLLIERRLVMAGVPAGRIGHECV------SGSTMENARMTRQTLAGQQV 125

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
              ++VT  YH  R     +++   + +    +   D    S          +L EY+K 
Sbjct: 126 QSAILVTSWYHTGRALAVFRKVWPEITWGAQGVFPGDTLAKSVPVYEAGS--ILAEYVKR 183

Query: 180 LLLSIQ 185
              +++
Sbjct: 184 AWYAVR 189


>gi|323142298|ref|ZP_08077130.1| hypothetical protein HMPREF9443_01929 [Phascolarctobacterium sp.
           YIT 12067]
 gi|322413182|gb|EFY04069.1| hypothetical protein HMPREF9443_01929 [Phascolarctobacterium sp.
           YIT 12067]
          Length = 258

 Score = 71.8 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 40/213 (18%), Positives = 79/213 (37%), Gaps = 33/213 (15%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVS-AIVVLTGEP---------------- 47
           +  L +     ++G     + ++  +I   P  +  IVVL G                  
Sbjct: 46  FLTLLLYFSSTLLGAKLLGQPLENRYIQQQPDAAQVIVVLGGGSVGSAPDGTERGGLMSA 105

Query: 48  --IRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
              R+  A  L +      + ISG       VS+ ++ ++I ++  L +  I +  +A  
Sbjct: 106 GAARLLTAARLAKQHSLP-VLISGGQVFRDGVSEALVAERILLQLGLPQEQIIVETQART 164

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYP---IISHDL 157
           T+ NA   +    +  +  VL++T   HMPR+    +R      V+   YP    ++   
Sbjct: 165 TKENAAYTAMHCRERGYQSVLLLTSALHMPRSMQFFERYLGEQGVKVAAYPCDYTLNPQG 224

Query: 158 EENSSIFKI-----KILRVLLIEYLKILLLSIQ 185
           + N            +  + L EY+ +    +Q
Sbjct: 225 KFNPRWLVPQLQAFDVTCMALHEYVGMAGAFLQ 257


>gi|158335605|ref|YP_001516777.1| hypothetical protein AM1_2455 [Acaryochloris marina MBIC11017]
 gi|158305846|gb|ABW27463.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 261

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 84/223 (37%), Gaps = 48/223 (21%)

Query: 6   YGLFVCLIFFIM-GFIS--FIRYVKQMHIP--DHPSVSAIVVLTG--------------- 45
            GL + ++FF   G++    +  ++  + P     +  AIVVL G               
Sbjct: 41  VGLALGILFFSANGWVGDGLLYSLEHQYPPLKQDATADAIVVLGGCTRSAHPPRPWVEVS 100

Query: 46  -EPIRIERAFELLENQIGEKIFISGV---------HHSVSKDILLQKIPIRQDLAECCID 95
               R+  A +L       K+ ++G            ++    LL+ + + +      + 
Sbjct: 101 EAGDRVLYAAKLYREGKAPKVVLAGGRIYWKGGGQAEALDMAELLKIMGVPESA----LL 156

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHH-VLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
           +   +LNT  NA       ++NN    +L+VT  +HMPR+    +    +V   P     
Sbjct: 157 LEPDSLNTFENATNVKRVLKQNNIDGPLLLVTSAFHMPRSMAIFETQGLSVIAAPTDYQV 216

Query: 155 HDLEENSSIFKIKILRVL------------LIEYLKILLLSIQ 185
            ++ EN+      +LR+L              E++  L+  ++
Sbjct: 217 TEVNENAGFL-GFVLRLLPDIEALVNTTIAFKEWIGFLMYRLR 258


>gi|75675900|ref|YP_318321.1| hypothetical protein Nwi_1708 [Nitrobacter winogradskyi Nb-255]
 gi|74420770|gb|ABA04969.1| Protein of unknown function DUF218 [Nitrobacter winogradskyi
           Nb-255]
          Length = 280

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 61/185 (32%), Gaps = 39/185 (21%)

Query: 33  DHPSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISGVHHSVS 75
           D      I+VL G                    R+  A EL       +I  SG      
Sbjct: 90  DGRDPDGIIVLGGAVDADISVSRGAVETNASAERVIAALELARRFPKARIVYSG-GAGNL 148

Query: 76  KDILLQKIPIRQDLAEC------CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
              L  + P+   L E        I +  ++  T+ NA+      +  +    L+VT  Y
Sbjct: 149 IAGLRAEAPVMGRLFEQFGIPRERIVLETRSRTTDENARFTRELVKPESGERWLLVTSAY 208

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSI--------FKIKILR--VLLIEYLKI 179
           HMPR+    ++    V+  PYP+   D      I            + R      E++ +
Sbjct: 209 HMPRSVGVFRKAGFDVE--PYPV---DWRTRGWIDAWMPFDKLSAGLARADTAAHEWVGL 263

Query: 180 LLLSI 184
           L+  +
Sbjct: 264 LVYRM 268


>gi|34499583|ref|NP_903798.1| hypothetical protein CV_4128 [Chromobacterium violaceum ATCC 12472]
 gi|34105434|gb|AAQ61789.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 190

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 64/157 (40%), Gaps = 13/157 (8%)

Query: 33  DHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAE 91
             P    IVVL GE   R+  A EL        +F+SG    +     LQ   + +    
Sbjct: 38  PQPRADWIVVLGGESGERVIGAAELYHQGRAPFVFVSGEGDCLLIVRRLQMAGVPRG--- 94

Query: 92  CCIDIGYK--ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
               IGY+  + +T  NA              + +VT  +H  R     ++    V++  
Sbjct: 95  ---KIGYECLSKSTWQNAVLTRQALASRQPRRITLVTSWFHSRRALETFRQAWPEVEWGM 151

Query: 150 YPIIS-HDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           + +   +DL  + + ++   +   L EYLKIL+ S++
Sbjct: 152 HIVYPGNDLYHSLAWYEAGAV---LTEYLKILVYSVR 185


>gi|311697190|gb|ADQ00062.1| protein containing DUF218 [marine bacterium HP15]
          Length = 159

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 46/120 (38%), Gaps = 4/120 (3%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGV-HHSVSKD-ILLQKIPIRQDLAECCIDIGYKA 100
           L     R+  A  L        + ++G    S S     +++      +    + +  ++
Sbjct: 13  LESGADRVWHAARLFNASKAPLVLLTGGSDPSHSAASEAMRQFMRDLRVPGQALVLESRS 72

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP--YPIISHDLE 158
            NT  NA+ ++    +   + +L+VT  YHMPR     +     V  +   + ++S  L 
Sbjct: 73  RNTSQNAEYSAEILTEQGVNRILLVTFAYHMPRAKALFEAQGLEVILVATDHEVLSRPLW 132


>gi|116623760|ref|YP_825916.1| hypothetical protein Acid_4672 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226922|gb|ABJ85631.1| protein of unknown function DUF218 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 207

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 64/190 (33%), Gaps = 32/190 (16%)

Query: 3   YFWYGLFVCLIFFIM----GFISFIRYVKQMHIPDH----PSVSAIVVLTG-EP------ 47
           + W  + + L  +I+         +  +   +        P+  AI VL G  P      
Sbjct: 4   WLWTAVALVLGGYILSAPLAGRWMLERLANQYPEMPVSSCPTADAIAVLAGTGPPRAGEM 63

Query: 48  ------IRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
                  R+E    LL      ++ ++       +   L++IP  + L          A 
Sbjct: 64  RRGEPLNRMEAGITLLRAGRAPRLVMA---TDGEEAKGLREIPDDRVLQL------RPAR 114

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEE 159
           +T   A+     A + ++H +++VT  +HM R   E +R    + V+    P  +     
Sbjct: 115 DTADEARRIVGEARQQSWHRLILVTSGFHMGRALREFRRAAERAGVELTVIPFAADPQVY 174

Query: 160 NSSIFKIKIL 169
                  K  
Sbjct: 175 ERWPPAAKSW 184


>gi|153832463|ref|ZP_01985130.1| integral membrane protein [Vibrio harveyi HY01]
 gi|148871258|gb|EDL70130.1| integral membrane protein [Vibrio harveyi HY01]
          Length = 268

 Score = 71.4 bits (174), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 61/154 (39%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE--ENSSIF 164
           A++A+A+ ++ +   +++VT   HM R   E       ++ IP P     ++  E     
Sbjct: 168 ARQAAAFVKQKD---IVLVTSASHMKRALYEFNAA--GIKPIPAPTNFMAIDDIEQPWQK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  L   ++ ++    
Sbjct: 223 YAPKARYLEQTELYWHEYLGGLWQKLRDNVGQTP 256


>gi|261379601|ref|ZP_05984174.1| putative periplasmic protein [Neisseria subflava NJ9703]
 gi|284798080|gb|EFC53427.1| putative periplasmic protein [Neisseria subflava NJ9703]
          Length = 218

 Score = 71.4 bits (174), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 53/149 (35%), Gaps = 18/149 (12%)

Query: 3   YFWYGLFVCLIFFIMGFI---SFIRYVKQMHIPDHPSVSAIVVLTGEP-----------I 48
           Y + GL + ++     F+     I       +P      A VVL G              
Sbjct: 14  YLFRGLALSVLLVCGIFLSGTWQIYRTGSHTLPKDAHADAAVVL-GAAAWDKRPSPVFRE 72

Query: 49  RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT  
Sbjct: 73  RINHAITLYQSHRVGKIIFTGGTPKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNTYE 132

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           N +        N    +++V+  YH+ R 
Sbjct: 133 NLRNIVPIMHANGVGSIIVVSDPYHLARA 161


>gi|306840763|ref|ZP_07473510.1| Bme2 protein [Brucella sp. BO2]
 gi|306289158|gb|EFM60407.1| Bme2 protein [Brucella sp. BO2]
          Length = 189

 Score = 71.0 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 62/167 (37%), Gaps = 12/167 (7%)

Query: 33  DHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQD--L 89
           D      I+V  G    R  +A +L ++     I  +G    +    ++    +     L
Sbjct: 13  DGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILATGDGDCLLNKHIMMAKGVPPSAIL 72

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            EC      ++ +T  NA+ ++    + +    LIVT+ +H  R     +     + F  
Sbjct: 73  VEC------RSGSTWQNARFSAPLLRRLHAKSALIVTNWFHSRRAVASFRTACPQMHFAS 126

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLK--ILLLSIQLSLSTQTAS 194
            P+   D+          ++  ++ EY K    L+S ++     T S
Sbjct: 127 SPVADADMP-GGFPGTPPVIEHVVKEYAKLGWYLISDRIRPQNLTDS 172


>gi|207723593|ref|YP_002253992.1| hypothetical protein RSMK00882 [Ralstonia solanacearum MolK2]
 gi|206588795|emb|CAQ35758.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 190

 Score = 71.0 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 61/153 (39%), Gaps = 11/153 (7%)

Query: 36  SVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAEC 92
               IVVL GE   R+  A EL    +  ++F+SG      + + +++  +P  +   EC
Sbjct: 45  HADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCLLIVRRLVMAGVPAERIGHEC 104

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
                 ++ NT  NA+      +  +    ++VT  YH  R     +R+   V +    +
Sbjct: 105 ------ESGNTMENARMTRRMLDGQSVRSAVLVTSWYHTGRALRAFRRVWPEVAWGARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
              D    S          +L EYLK    +++
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYLKRAWYAVR 189


>gi|206889829|ref|YP_002248307.1| hypothetical protein THEYE_A0462 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741767|gb|ACI20824.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 235

 Score = 71.0 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 50/128 (39%), Gaps = 16/128 (12%)

Query: 37  VSAIVVLTGE-----------PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKI 83
             AIV+L G              R+   + +        I +SG  V   +S    +  +
Sbjct: 74  ADAIVILGGGVYSWASFPEDSSNRLFTGYLVYRKTKLP-IIVSGGAVEGKISDSAAMAAM 132

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
                + +  I    K+ +T  NA   +   ++ +F  V++VT  YHM R     ++   
Sbjct: 133 LKEFGVEDSKIIEENKSRDTAQNALYVAKICKEKSFKKVILVTSAYHMKRAVKFFKQA-- 190

Query: 144 TVQFIPYP 151
            ++ +PYP
Sbjct: 191 GLEVLPYP 198


>gi|187929799|ref|YP_001900286.1| hypothetical protein Rpic_2729 [Ralstonia pickettii 12J]
 gi|187726689|gb|ACD27854.1| protein of unknown function DUF218 [Ralstonia pickettii 12J]
          Length = 192

 Score = 71.0 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 59/162 (36%), Gaps = 11/162 (6%)

Query: 29  MHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPI 85
              P       IVVL GE   R+  A EL    +  ++F+SG      + + +++  +P 
Sbjct: 38  REEPRLAQADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGQGDCLLIERRLVMAGVPA 97

Query: 86  RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV 145
            +   EC       + +T  NA+              ++VT  YH  R     +++   V
Sbjct: 98  ERIGHECV------SGSTMENARMTRGTLAGQQVQSAILVTSWYHTGRALAVFRKVWPEV 151

Query: 146 QFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            +    +   D    S          +L EY+K    +++  
Sbjct: 152 TWGAQGVFPGDTLAKSVPIYEAGS--ILAEYVKRAWYAVRYR 191


>gi|125974798|ref|YP_001038708.1| hypothetical protein Cthe_2313 [Clostridium thermocellum ATCC
           27405]
 gi|256004933|ref|ZP_05429906.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|125715023|gb|ABN53515.1| protein of unknown function DUF218 [Clostridium thermocellum ATCC
           27405]
 gi|255991113|gb|EEU01222.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|316941930|gb|ADU75964.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           1313]
          Length = 251

 Score = 71.0 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 55/143 (38%), Gaps = 24/143 (16%)

Query: 30  HIPDHPSVSAIVVLTGEP------------------IRIERAFELLENQIGEKIFISGV- 70
             P   +   I++L G                     R+    +L        I ISG  
Sbjct: 70  QPPSELNGDVIIMLGGGAFADTPNVNGKGHLSSIAANRLLTCVQLYYKLDVP-IIISGGQ 128

Query: 71  --HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
              H+ S+  +   I +   + E  I +  ++LNT  NA       +K+ F+  ++VT  
Sbjct: 129 IPGHTTSEGEIAMNILLSLGVPEEKIIVENRSLNTTQNAFYTKELLDKHGFNKPILVTSA 188

Query: 129 YHMPRTFLELQRINSTVQFIPYP 151
           +HM R   + ++  + V  IPYP
Sbjct: 189 FHMKRAVKQFEK--NEVNVIPYP 209


>gi|87301698|ref|ZP_01084538.1| hypothetical protein WH5701_03449 [Synechococcus sp. WH 5701]
 gi|87283915|gb|EAQ75869.1| hypothetical protein WH5701_03449 [Synechococcus sp. WH 5701]
          Length = 266

 Score = 71.0 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 48/140 (34%), Gaps = 23/140 (16%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIFI 67
               ++     P   AIVVL G                   R+     LL +Q    + +
Sbjct: 65  ARSARLTPAPVPRGDAIVVLGGGLRAALPPRAGVEVNEAGDRLLSGIRLLRDQRAPLLLL 124

Query: 68  SGV-------HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           SG          + ++ I  + + +   +    + +  +A  T   A++     +   + 
Sbjct: 125 SGGRVSFSGGDPAPAEAISARSLALELGVPADRLLVSDQARTTAEEARDLRRIGQSRGWS 184

Query: 121 HVLIVTHDYHMPRTFLELQR 140
            VL+VT   HMPR     +R
Sbjct: 185 TVLLVTSALHMPRALASFRR 204


>gi|237748053|ref|ZP_04578533.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229379415|gb|EEO29506.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 203

 Score = 71.0 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 68/191 (35%), Gaps = 31/191 (16%)

Query: 2   RYFWYGLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP----------- 47
           ++    L    +F I  F     F        + +  +  A ++L G             
Sbjct: 3   KWIKVALVSFCVFLIYIFCSIAWFS------TVDEKKTADAAIIL-GAAAWYKRPSPVFE 55

Query: 48  IRIERAFELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTE 104
            RI     L +N   +K+  +G        S+  + ++  ++  + E  I I  ++L T 
Sbjct: 56  ERINHGIWLYKNGYVKKLIATGGKSKNAPFSEAFVARRYAMKNQIPEEDILIEEESLTTR 115

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            N Q A    E+N+    +IV+   HM R      +I + +    +   +   +  S   
Sbjct: 116 ENLQNAKKLMEENHLSSAIIVSDPMHMRRAM----QIANDLGIKAWSSPTPSTKYASWQA 171

Query: 165 KIKILRVLLIE 175
           K   ++ L  E
Sbjct: 172 K---IQFLFQE 179


>gi|289664371|ref|ZP_06485952.1| hypothetical protein XcampvN_15203 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668148|ref|ZP_06489223.1| hypothetical protein XcampmN_06538 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 205

 Score = 71.0 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 53/148 (35%), Gaps = 20/148 (13%)

Query: 3   YFWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + W    + LI+ +   G+I +I    Q           I+VL               RI
Sbjct: 17  WGWRLCMLALIWLVAVAGWIVWIGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERI 71

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A +L       ++  +G        ++  + ++  +R  +    I I   +  T  N 
Sbjct: 72  RHALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQNL 131

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           ++A    E++  H  +IV+   HM R  
Sbjct: 132 EQARTLMERHGMHRAIIVSDPLHMARAL 159


>gi|307730038|ref|YP_003907262.1| hypothetical protein BC1003_2008 [Burkholderia sp. CCGE1003]
 gi|307584573|gb|ADN57971.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1003]
          Length = 225

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 72/205 (35%), Gaps = 40/205 (19%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH--PSVSAIVVLTGEP----------- 47
           + +FW    +   +     +S  + V Q   P    P   AI++L G             
Sbjct: 15  IAFFW---LLSAGWLTAPLLSLAQPVAQTSPPASFAPRT-AIILLGGGTVYNRDKVLVPP 70

Query: 48  ----IRIERAFELLENQIGEK------IFISGVHHS---VSKDILLQKIPIRQDLAECCI 94
                RI+ +         ++      + +SG +      S+        +R+ +    I
Sbjct: 71  REVLARIDVSARNYAA--CKRTATVCTVIVSGGNPQRHPASEADTYLPYLLREQVPRSDI 128

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  ++L T  NA+  SA   ++ +  +++VT  YHMPR  L+ +         P P+IS
Sbjct: 129 VLENQSLTTYENARNVSAIVGQSRYDSLILVTSAYHMPRALLDFRHFGLD----PQPLIS 184

Query: 155 HDLEEN----SSIFKIKILRVLLIE 175
                          +    + L E
Sbjct: 185 SARRARLGVLPRYSNLANAEIALHE 209


>gi|269963112|ref|ZP_06177447.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832076|gb|EEZ86200.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 268

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 61/154 (39%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE--ENSSIF 164
           A++A+A+ ++ +   +++VT   HM R   E       ++ IP P     ++  E     
Sbjct: 168 ARQAAAFVKQKD---IVLVTSASHMKRALYEFNAA--GIKPIPAPTNFMAIDDIEQPWQK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  L   ++ ++    
Sbjct: 223 YAPKARYLEQTELYWHEYLGGLWQKLRDNVGQTP 256


>gi|298492074|ref|YP_003722251.1| hypothetical protein Aazo_3520 ['Nostoc azollae' 0708]
 gi|298233992|gb|ADI65128.1| protein of unknown function DUF218 ['Nostoc azollae' 0708]
          Length = 263

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 76/223 (34%), Gaps = 39/223 (17%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------------E 46
                L VC   ++   +      + + + + P   AIVVL G                 
Sbjct: 43  LSLTLLLVCGNAWVAKNLVRSLEWQNIPLAEIPQAEAIVVLGGATKSGVWPRPTVDLSES 102

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A +L   +    I +SG        +  +   +  I     +    I     +L
Sbjct: 103 GDRVIYAAQLYRQKKAPIIVLSGGRIDWRGSASQESTDMAAILTSIGIPSEAIIQEPDSL 162

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDL 157
           NT  NA       E      VL+VT   H PR     QR    +  IP P    +   +L
Sbjct: 163 NTYQNAVNVKETLENRGIKKVLLVTSAMHTPRALKIFQR--QGIDVIPAPTDFLVSQGEL 220

Query: 158 EENSSIFKIKILRVL------------LIEYLKILLLSIQLSL 188
           +E +S  K  IL +L            L EY+  ++ S++  L
Sbjct: 221 QELTSSPKGAILNLLPDTTNLYQFTNALKEYIGSVIYSLRGWL 263


>gi|117924002|ref|YP_864619.1| hypothetical protein Mmc1_0692 [Magnetococcus sp. MC-1]
 gi|117607758|gb|ABK43213.1| protein of unknown function DUF218 [Magnetococcus sp. MC-1]
          Length = 229

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 59/173 (34%), Gaps = 9/173 (5%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEKIFISGVHHSV 74
           + G+    +++     P      AIVVL G  P R +  F+LL     +++   G    V
Sbjct: 49  LGGWKQAAQWLVITQPPAV--ADAIVVLGGGIPTRPKMGFQLLHQGWAKRLIFVGDRPHV 106

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
               +        D A   + +   + +T  + Q      +      +L+VT  YH  R 
Sbjct: 107 -LTQVGHSYCPACDFARPEVTLLGLSRSTLDDLQRVLPHIQGGLNRRILLVTDPYHTRRA 165

Query: 135 FLELQRIN--STVQ---FIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
               + +     ++            +  +      +   +V+L E+ K L  
Sbjct: 166 DWIARHLLNQHGIEVRTISSNAYFKMNAPQTPWWQDLPTRQVVLSEWTKFLFY 218


>gi|207742563|ref|YP_002258955.1| hypothetical protein RSIPO_00752 [Ralstonia solanacearum IPO1609]
 gi|206593956|emb|CAQ60883.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 190

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 58/146 (39%), Gaps = 11/146 (7%)

Query: 36  SVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAEC 92
               IVVL GE   R+  A EL    +  ++F+SG      + + +++  +P  +   EC
Sbjct: 45  HADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCLLIVRRLVMAGVPAERIGHEC 104

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
                 ++ NT  NA+      +  +    ++VT  YH  R     +R+   V +    +
Sbjct: 105 ------ESGNTMENARMTRRMLDGQSVRSAVLVTSWYHTGRALRAFRRVWPEVAWGARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLK 178
              D    S          +L EYLK
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYLK 182


>gi|90419579|ref|ZP_01227489.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336516|gb|EAS50257.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 263

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 66/215 (30%), Gaps = 39/215 (18%)

Query: 7   GLFVCLIFFIM-------GFISFIRYVKQMHIPDHPSV-SAIVVLTGE------------ 46
           GLFV     +        G +       +   PD P     I+VL G             
Sbjct: 40  GLFVLATATLAVCSLTPLGLVMTAVLEDRFPRPDLPPAIDGIIVLGGAFDTRVARTRGMN 99

Query: 47  -----PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDI 96
                  R+    EL +     K+  SG         + +    + +     LA   + +
Sbjct: 100 ELNDAADRVTAGMELAQRYPKAKLLFSGGVAALLEEDIPETEAAEALYRGLGLAPDRLLL 159

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             +A +T  NA  A   A+       ++VT   HMPR     +        +PYP+    
Sbjct: 160 DGRARDTFENAVFAKELAQPKPGEVWVLVTSASHMPRAVGCFRVA--GFDIVPYPVDYRT 217

Query: 157 LEENSSIF-KIKILRVL------LIEYLKILLLSI 184
               +         R L      + EYL ++   +
Sbjct: 218 PSGPALWRPSSTTTRNLEKVHFAIREYLGLVAYRL 252


>gi|312144373|ref|YP_003995819.1| protein of unknown function DUF218 [Halanaerobium sp.
           'sapolanicus']
 gi|311905024|gb|ADQ15465.1| protein of unknown function DUF218 [Halanaerobium sp.
           'sapolanicus']
          Length = 252

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 78/217 (35%), Gaps = 31/217 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA-----IVVLTGE--------- 46
           +++      + LIF    F   +  +   +  +  SV       IVVL G          
Sbjct: 38  IKFLATATLIFLIFISTAFGVKVLLLPLENYAEEISVDLEEDHPIVVLGGGNYYKTDGSA 97

Query: 47  ------PIRIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIG 97
                   R+ +A+EL      + I+  GV   H + S+    ++      L     +  
Sbjct: 98  EPSVHSKQRLAKAYELHRTLNTKIIYSGGVGLGHDNFSEADAAKEFLSGLGLESEKYESE 157

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IIS 154
            +A +T  NA     W  +N    + +VT  YHM R+    +     + F+ +    I  
Sbjct: 158 DQARSTYENALYIKKWLNENEIERIYLVTSAYHMYRSARAFRA--QEIDFLAHHSGFIYD 215

Query: 155 HDLEENSSIFKIKILRV---LLIEYLKILLLSIQLSL 188
           H     + +     L+V    L E++ I+   ++  +
Sbjct: 216 HKFSWLNYLPNRGALQVNLSALHEWVGIVWYYLRARI 252


>gi|156973875|ref|YP_001444782.1| hypothetical protein VIBHAR_01585 [Vibrio harveyi ATCC BAA-1116]
 gi|156525469|gb|ABU70555.1| hypothetical protein VIBHAR_01585 [Vibrio harveyi ATCC BAA-1116]
          Length = 268

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 61/154 (39%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE--ENSSIF 164
           A++A+A+ ++ +   +++VT   HM R   E       ++ IP P     ++  E     
Sbjct: 168 ARQAAAFVKQKD---IVLVTSASHMKRALYEFNAA--GIKPIPAPTNFMAIDDIEQPWQK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  L   ++ ++    
Sbjct: 223 YAPKARYLEQTELYWYEYLGGLWQKLRDNVGQTP 256


>gi|298370445|ref|ZP_06981761.1| membrane protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281905|gb|EFI23394.1| membrane protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 199

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 58/148 (39%), Gaps = 17/148 (11%)

Query: 2   RYFWYGLFVCLIFFIM-GFIS---FIRY---VKQMHIPDHPSVSAIVVLTGEPI------ 48
           +  W G  + +++ ++ G++    F R    V+ +   D   +  I V            
Sbjct: 4   KILWIGTGLVILWLLLFGWVWGNNFYRSRQPVESIAPADTAVILGISVHDEGRQNPCLIS 63

Query: 49  RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+E   EL +    +K+ +SG   H        + +   +  +    I++   +  T  N
Sbjct: 64  RVEAGVELWKAGKVKKLIMSGGMNHDGYVGAQSMMQTAEKMGIPREVIELEDHSETTHQN 123

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRT 134
               +   E++    V+IV+  YH+PR 
Sbjct: 124 ILYTAPMIEQD--KSVVIVSSAYHIPRA 149


>gi|17229959|ref|NP_486507.1| hypothetical protein alr2467 [Nostoc sp. PCC 7120]
 gi|17131559|dbj|BAB74166.1| alr2467 [Nostoc sp. PCC 7120]
          Length = 263

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/210 (19%), Positives = 71/210 (33%), Gaps = 35/210 (16%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------------EPIRIERAF 54
           C   ++  ++      + + +   P+  AI+VL G                +  R+  A 
Sbjct: 51  CSNAWVAKYLVRSLEWQNLPMAQLPNAEAIIVLGGATKSVFPPRITPDLSEQGDRVIYAA 110

Query: 55  ELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           +L        I +SG          S+   +  I     +    +     +LNT  NA  
Sbjct: 111 QLYRQNKAPLIILSGGRIDWRGSGSSESTDMANILTSLGIPASVLIEEPDSLNTYQNAVN 170

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP--YPIISHDLEENSSIFKIK 167
                       VL+VT   HMPR+    QR    V   P  + +   +L+E  +  K  
Sbjct: 171 VKKILVSRGIDQVLLVTSALHMPRSLKIFQRQGMNVIPAPTDFLVSEGELQELGNTPKAA 230

Query: 168 ILRVL------------LIEYLKILLLSIQ 185
           IL +L            L EY+   +  ++
Sbjct: 231 ILNLLPDTYNLHLFTNALKEYVGSFVYWLR 260


>gi|193212745|ref|YP_001998698.1| hypothetical protein Cpar_1090 [Chlorobaculum parvum NCIB 8327]
 gi|193086222|gb|ACF11498.1| protein of unknown function DUF218 [Chlorobaculum parvum NCIB 8327]
          Length = 196

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 66/190 (34%), Gaps = 12/190 (6%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQI 61
             ++ +   L   +   + F+  +             IVVL G+   R+E+  EL +   
Sbjct: 9   LLFFLITSTLFATVYLGLGFLVSLHSTKPE---KADVIVVLGGDNGLRVEKGTELYKAGY 65

Query: 62  GEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
            + I ++G+     S S+    ++  +   + +  I +   +  T   A+  S   +K  
Sbjct: 66  AKNIVLTGIDSRYYSPSRPNWRERRMLEAGVPKKAITVDIWSETTWEEAENTSDLMDKKG 125

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS--SIFKIKILRVLLIEY 176
           ++  L+V+   HM R      +  +        + +     +           + ++ E 
Sbjct: 126 WNSALVVSDPPHMLRLHKTWTQAFAGSSKQFILVTTEPEWWHPLFWWRDPFSKQFVINEI 185

Query: 177 LK---ILLLS 183
            K    LL  
Sbjct: 186 KKNIYYLLAY 195


>gi|258591830|emb|CBE68131.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 232

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 68/204 (33%), Gaps = 18/204 (8%)

Query: 1   MRYFWYGLFVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVLTG--EPIRIERAFELL 57
           +R+      + L+ ++   F+        +         AI VL G     R   A  L 
Sbjct: 6   IRWLIVFPLLGLLLYVGHPFLLRAMGRYLITEDRLQKAEAIAVLAGDGGVGRTLEAVRLY 65

Query: 58  ENQIGEKIFI------SGVHHSVSKDILLQK--------IPIRQDLAECCIDIGYKALNT 103
           ++    +I +      +G        I + +        +   +      + +  ++ +T
Sbjct: 66  QDGYAPRIILTRQRLPTGYEALTRLGITVPEERHIQWMVLKAMRVPVTAVLQVNERSDST 125

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSS 162
                      +++    +++VT+  H  R    L R++   +  I  P      + +  
Sbjct: 126 ASEMVHLVRLLKEHRIRTIILVTNKSHSTRASKILARVSRNNLTSISRPTRYDTFDPDGW 185

Query: 163 IFKIKILRVLLIEYLKILLLSIQL 186
                  R +L EYLK+L   +Q 
Sbjct: 186 WRSRADARDVLFEYLKLLDYLVQT 209


>gi|111022413|ref|YP_705385.1| hypothetical protein RHA1_ro05447 [Rhodococcus jostii RHA1]
 gi|110821943|gb|ABG97227.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 187

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 58/166 (34%), Gaps = 9/166 (5%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP--SVSAIVVLTGEP--IRIERAFELL 57
           R  +       +      + +   +   + P+ P   V AIVVL G     R+  A  L 
Sbjct: 5   RQRFLLAAALAVMTTATALLWGGRIIYSNAPEDPLRPVDAIVVL-GGENDGRVPYAVSLA 63

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           E  +  ++ IS  H +                   C+   + A  T G AQ     A +N
Sbjct: 64  EQGLARQVVISNPHDARDPSTNEGCATTDPRFTVTCV-APHPAT-TRGEAQFTRTLAVQN 121

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-SHDLEENSS 162
            +  VL+V+  YH+PR     QR         + +  S+D      
Sbjct: 122 GWTSVLVVSWRYHLPRARYIFQRCFDG-DLTMHAVPRSYDFSLAKW 166


>gi|289450181|ref|YP_003474931.1| hypothetical protein HMPREF0868_0608 [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289184728|gb|ADC91153.1| conserved hypothetical protein [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 231

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 62/163 (38%), Gaps = 25/163 (15%)

Query: 7   GLFVCLIFFIMG-FISFIRYVKQMHIPDH-PSVSAIVVLTGEP-----------IRIERA 53
           GL +CL+F  +  ++      +Q+   D  P    I+VL G              R+E A
Sbjct: 39  GLVLCLLFLAVPLWMGLAVKGRQISNADDIPKAECIMVL-GARVYKDRPSHMLEGRLEAA 97

Query: 54  FELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEG---NAQ 108
             L   Q   +I +SG       D   ++++  I + +    I + +  +NT     NA 
Sbjct: 98  ISLYFKQKAPQILVSGGGAGTDFDEAIVMRRYLISRGVPAESIIMDHAGINTYQSCYNAT 157

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
                  K  +  +LI T +YHM R+     ++         P
Sbjct: 158 F------KFGYKKILIATTEYHMQRSLFLATKLGLDCYGYASP 194


>gi|153938260|ref|YP_001392181.1| hypothetical protein CLI_2956 [Clostridium botulinum F str.
           Langeland]
 gi|152934156|gb|ABS39654.1| conserved hypothetical protein [Clostridium botulinum F str.
           Langeland]
          Length = 197

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R   EL      ++     +       +  +  
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRA--ELLCQKEGIRASYSGVFVRSHMSHEIMGF 182

Query: 166 IKILRVLLIEYLKIL 180
           ++ +  LL+ Y+K +
Sbjct: 183 LREIPALLVYYIKTM 197


>gi|313672214|ref|YP_004050325.1| hypothetical protein Calni_0249 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312938970|gb|ADR18162.1| protein of unknown function DUF218 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 238

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 44/209 (21%), Positives = 77/209 (36%), Gaps = 29/209 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFI--SFIRYVKQMHIPDHPSVSAIVVLTGE-----------PI 48
           RY  +   V L  F +  +    I  +++ +I        IVVL G              
Sbjct: 34  RYLLFFFAVMLYLFSISPVKDILIYPIEKDYINLKCDGDIIVVLGGGVYGNGELSEDAFK 93

Query: 49  RIERAFELLENQIG--EKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+ + FE      G  + I +SG   S S   +  +++ + +   + E  I +   + +T
Sbjct: 94  RVVKGFE---KGRGGDKIIIVSGGRVSESYPYEAEVMKDLLVTLGIREGNIIMDKDSKDT 150

Query: 104 EGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINST------VQFIPYPIISHD 156
             NA+      E+      V+++T  YHM R  L  ++            F    + S  
Sbjct: 151 VENAKFTKKIVEEKGIKGDVILITSAYHMKRGILIFKKYGFDNICAAATDFKFDGVYSI- 209

Query: 157 LEENSSIFKIKILRVLLIEYLKILLLSIQ 185
            +   S   +  +   L EYL IL   I+
Sbjct: 210 YDFLPSASNLNTVSKALKEYLGILFYRIK 238


>gi|119356675|ref|YP_911319.1| hypothetical protein Cpha266_0844 [Chlorobium phaeobacteroides DSM
           266]
 gi|119354024|gb|ABL64895.1| protein of unknown function DUF218 [Chlorobium phaeobacteroides DSM
           266]
          Length = 219

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 69/186 (37%), Gaps = 7/186 (3%)

Query: 6   YGLFVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGE 63
             LFV       G F   + Y+  ++         I+VL G+   R+++  EL  +    
Sbjct: 31  ISLFVLTACTSAGIFFISLGYLVSLYAEKPKPADVIIVLGGDNGLRVKKGAELYNDGYAP 90

Query: 64  KIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           ++ ++G+       S     ++      + +  I I  ++ ++   A  +S   EK  + 
Sbjct: 91  RVILTGIDARFYRPSHPDWRERRMRALGVPKKSIRIDTRSASSWEEALNSSRLMEKKGWK 150

Query: 121 HVLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
             ++V+   H+ R     ++  S    QFI  P               K    ++ E+ K
Sbjct: 151 TAIVVSDPPHLFRLHRTWKKAFSGSAKQFILVPTKPQWWNPLLWWKNKKSYSFVISEFQK 210

Query: 179 ILLLSI 184
            L  S+
Sbjct: 211 SLYYSV 216


>gi|170755560|ref|YP_001782537.1| hypothetical protein CLD_1642 [Clostridium botulinum B1 str. Okra]
 gi|169120772|gb|ACA44608.1| conserved hypothetical protein [Clostridium botulinum B1 str. Okra]
          Length = 197

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 61/135 (45%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R+  EL      ++     +       +  +  
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRS--ELLCQKEGIKASYSGVFVRSHMSHEIMGF 182

Query: 166 IKILRVLLIEYLKIL 180
           ++ +  LL+ Y+K +
Sbjct: 183 LREIPALLVYYIKTM 197


>gi|149915963|ref|ZP_01904486.1| hypothetical protein RAZWK3B_00010 [Roseobacter sp. AzwK-3b]
 gi|149810037|gb|EDM69885.1| hypothetical protein RAZWK3B_00010 [Roseobacter sp. AzwK-3b]
          Length = 266

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 71/212 (33%), Gaps = 34/212 (16%)

Query: 4   FWYGLFVCLIFFIMGFI----SFIRYVKQMHI--PDHPSVSAIVVLTGEPI--------- 48
           FW    +  + F+ GF+      +R ++Q +   PD    + I+VL G            
Sbjct: 44  FWVNGTLLFVLFM-GFVPLGQLIMRPLEQRYPSAPDIAPPAGIIVLGGGEDGAMSAASGL 102

Query: 49  --------RIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCID 95
                   R+     L       K+  +G         VS  I+ +       +    I 
Sbjct: 103 PETNGAGDRMSAGVALALAYPDAKLIFTGGSGQFLAGGVSGAIVAKAYFESLGVDPERII 162

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +  +A NT  NA  +    +       ++VT  +HMPR+              P+P+   
Sbjct: 163 LEGRARNTAENAAFSRELVDDPRIGPWVLVTSAFHMPRSLATFCAAG-WRDITPFPVDYR 221

Query: 156 DLEENSSIFKIKI----LRVLLIEYLKILLLS 183
            + +    +        L + + E++ +L   
Sbjct: 222 SITDLEFKWDPTGNFEKLNLSIKEWIGLLAYE 253


>gi|168179334|ref|ZP_02613998.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226950331|ref|YP_002805422.1| hypothetical protein CLM_3296 [Clostridium botulinum A2 str. Kyoto]
 gi|182669557|gb|EDT81533.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226841604|gb|ACO84270.1| conserved hypothetical protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 198

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R   EL      ++     +       +  +  
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRA--ELLCQKEGIKASYSGVFVRSHMSHEIMGF 182

Query: 166 IKILRVLLIEYLKIL 180
           ++ +  LL+ Y+K +
Sbjct: 183 LREIPALLVYYIKTM 197


>gi|119512087|ref|ZP_01631180.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
 gi|119463245|gb|EAW44189.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
          Length = 263

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 73/219 (33%), Gaps = 39/219 (17%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------------PIRI 50
            L VC   ++   +      + +     P+  AIVVL G                   R+
Sbjct: 47  LLLVCSNAWVAKSLVRSLEWQYLPPNPVPNAEAIVVLGGATKSAYPPRPTVDLSETGDRV 106

Query: 51  ERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
             A +L        I +SG          S+   +  +     +    I     +LNT  
Sbjct: 107 IYAAQLYRQNKAPIIILSGGRIDWRGGGESESADMANVLTSIGIPSEVIVQEPDSLNTYQ 166

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENS 161
           NA       E      VL+VT   HMPR+    QR    +  I  P    +   +L+E S
Sbjct: 167 NAVNVKKILESRGIGKVLLVTSAMHMPRSIQIFQR--QGINAIAAPTDFLVSQGELQELS 224

Query: 162 SIFKIKILRVL------------LIEYLKILLLSIQLSL 188
           S  K  IL +L            L EY+   + S +  L
Sbjct: 225 STPKAAILNLLPDSNNLQQFTSALKEYIGSFVYSWRGWL 263


>gi|153009344|ref|YP_001370559.1| hypothetical protein Oant_2014 [Ochrobactrum anthropi ATCC 49188]
 gi|151561232|gb|ABS14730.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 235

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 68/214 (31%), Gaps = 37/214 (17%)

Query: 6   YGLFVCLIFFIM----GFISFIRYVKQMHIPD--HPSVSAIVVLTG-------------- 45
            GL + ++FF      G +       +   PD     V  IVVL G              
Sbjct: 13  LGLSIAILFFAAFTTLGSVLLAPLEDRFAKPDAMPQHVDGIVVLGGYMNGDINAGRKGFE 72

Query: 46  ---EPIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIG 97
                 RI  A  L       ++ +SG        +  +    +++ I    +       
Sbjct: 73  LNSAADRIFEAMRLARLYPDARVIVSGGDGAFFEEAAKEADSTRQMLIDLGFSGERYIYE 132

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
            K+ NT  NA  +   A+       L+VT  YHMPR+    ++       + +P+     
Sbjct: 133 NKSRNTVENAIFSKELAQPKPGETWLLVTSAYHMPRSVGCFRKA--DFDVVAWPVDYKTR 190

Query: 158 EENSSIFKIKI-------LRVLLIEYLKILLLSI 184
                   ++          V + E++ +    +
Sbjct: 191 ARERFALYLESPNEALSRFSVAMREWVGLAAYWL 224


>gi|229824827|ref|ZP_04450896.1| hypothetical protein GCWU000182_00176 [Abiotrophia defectiva ATCC
           49176]
 gi|229790830|gb|EEP26944.1| hypothetical protein GCWU000182_00176 [Abiotrophia defectiva ATCC
           49176]
          Length = 211

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 64/171 (37%), Gaps = 23/171 (13%)

Query: 31  IPDHPSVSAIVVLTGEPIRI--ERAFELLENQIGEKIFISG---------VHHSVS---- 75
           I D P  S I+ + G    +  E A  L +     KI  SG         ++  V+    
Sbjct: 23  IEDEPQDSDIIFIPGSSNWVLAETAASLYKEGKANKIMPSGMYFYKIGRFLNERVTDERY 82

Query: 76  ------KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTH 127
                 +   L  + ++  +    I I  KA NT  NA  +    ++NN      +I   
Sbjct: 83  KGNFRTEAEFLSSVLVKNGVENKDILIEEKATNTYENAIFSRDLLKENNLTVKKAIICPQ 142

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
            +H  R F+    +   V+F   P  +  +  +S     + ++V+L E  K
Sbjct: 143 AFHARRAFMTYSHLFPDVEFYVVPTDTQGITADSWYKTERGIQVVLGELQK 193


>gi|319638788|ref|ZP_07993547.1| periplasmic protein [Neisseria mucosa C102]
 gi|317400029|gb|EFV80691.1| periplasmic protein [Neisseria mucosa C102]
          Length = 218

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 53/149 (35%), Gaps = 18/149 (12%)

Query: 3   YFWYGLFVCLIFFIMGFI---SFIRYVKQMHIPDHPSVSAIVVLTGEP-----------I 48
           Y + GL + ++     F+     I       +P      A VVL G              
Sbjct: 14  YLFRGLALSVLLVCGIFLSGTWQIYRTGLQTLPKDVHADAAVVL-GAAAWDKRPSPVFRE 72

Query: 49  RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT  
Sbjct: 73  RINHAITLYQSHRVGKIIFTGGTPKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNTYE 132

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           N +        N    +++V+  YH+ R 
Sbjct: 133 NLRNIVPIMHANGVGSIIVVSDPYHLARA 161


>gi|239617397|ref|YP_002940719.1| protein of unknown function DUF218 [Kosmotoga olearia TBF 19.5.1]
 gi|239506228|gb|ACR79715.1| protein of unknown function DUF218 [Kosmotoga olearia TBF 19.5.1]
          Length = 254

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 69/171 (40%), Gaps = 25/171 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP----SVSAIVVLTGEP----------- 47
               GLF  L+   +G   +++ ++  +   +     +  AIVVL G             
Sbjct: 45  ILIIGLFSYLLMSGIGTYLYVKPLETEYSVPNASLLDTAEAIVVLGGGMIIAPYELEPGD 104

Query: 48  ---IRIERAFELLENQIGEKIFISGVHH----SVSKDILLQKIPIRQDLAECCIDIGYKA 100
               R+ +AF++     G+ I ++G       S+S+  ++    +   + E  + +   A
Sbjct: 105 HTLKRLYKAFQI-HRATGKPIIVTGGTPMGRDSLSESEVMLNTLLNWGIDENDVIVENSA 163

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
            NT  NA   +   ++  +  +++VT   HM R+    +     V  IPYP
Sbjct: 164 RNTNENAVRVAEICKEKKWKKIVLVTSAVHMKRSVESFEEQGLNV--IPYP 212


>gi|313897329|ref|ZP_07830872.1| conserved hypothetical protein [Clostridium sp. HGF2]
 gi|312957699|gb|EFR39324.1| conserved hypothetical protein [Clostridium sp. HGF2]
          Length = 192

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R++ A  L + +    I ISG  V ++ ++  ++    IR  +    + +  +A NT  N
Sbjct: 57  RMDAAITLYKEKRVRCILISGGSVRNTYTEADIMAAYAIRCSIPSTALLLERQAKNTYEN 116

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRT 134
              A    + + + HV++VT  +H+ R 
Sbjct: 117 LLYAKTLCDAHAWKHVIVVTSCFHVRRA 144


>gi|315634101|ref|ZP_07889390.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
 gi|315477351|gb|EFU68094.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
          Length = 247

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 54/144 (37%), Gaps = 34/144 (23%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRIERAFEL-------------------LENQIGEKIFI 67
             + + D+    AIV+L G    +  + EL                   L+ +    + I
Sbjct: 68  DHLTLNDYKQAQAIVLLGGG---VRDSKELYAPLASSATQLERLRYAAYLQKETQLPLLI 124

Query: 68  SGVHHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           SGV  +      VS + L     +          +  K+L T+ NA       EK   H 
Sbjct: 125 SGVSPTGASEGKVSAEELQTFFNVPTKW------LEEKSLTTKENALYTRQLLEKEGIHK 178

Query: 122 VLIVTHDYHMPRTFLELQRINSTV 145
           +++VT+++HM R  L  Q+    V
Sbjct: 179 IILVTNEWHMQRAKLLFQQQGFDV 202


>gi|300703293|ref|YP_003744895.1| hypothetical protein RCFBP_10965 [Ralstonia solanacearum CFBP2957]
 gi|299070956|emb|CBJ42264.1| conserved protein of unknown function, DUF218 [Ralstonia
           solanacearum CFBP2957]
          Length = 190

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 60/153 (39%), Gaps = 11/153 (7%)

Query: 36  SVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAEC 92
               IVVL GE   R+  A EL    +  ++F+SG      + + +++  +P  +   EC
Sbjct: 45  HADVIVVLGGESGQRVIGAAELYHAGVASRVFVSGEGDCLLIVRRLVMAGVPAGRIGHEC 104

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
                 ++ NT  NA+      +       ++VT  YH  R     +R+   V +    +
Sbjct: 105 ------ESGNTMENARMTRRMLDGQPVRSAVLVTSWYHTGRALHAFRRVWPEVAWRARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
              D    S          +L EYLK    +++
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYLKRAWYAVR 189


>gi|299135177|ref|ZP_07028368.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
 gi|298590154|gb|EFI50358.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
          Length = 264

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 60/182 (32%), Gaps = 37/182 (20%)

Query: 35  PSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISGV-----HH 72
            +   I+VL G                    R+  A  L       KI +SG      H 
Sbjct: 77  RAPDGIIVLGGAINPDLTAVRGAPEMNSSAERMTAAAVLARRFPNAKIVLSGGNANPFHP 136

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
             ++  + +K      +A+  I +  ++  T  NA+             +L+VT  YHMP
Sbjct: 137 LSTEAEVGRKFLEDLGVADDRIVMEGRSRTTYENAEFTRPLIHPVAGERLLLVTSAYHMP 196

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEENSSI--------FKIKILRV--LLIEYLKILLL 182
           R     +     V+   YP+   D      +            + R+   + E++ ++  
Sbjct: 197 RAMGVFRAAGFNVE--AYPV---DWRTRGWVDAERPFLTLSGGLGRLDTAVHEWVGLIGY 251

Query: 183 SI 184
            +
Sbjct: 252 RL 253


>gi|255513632|gb|EET89897.1| protein of unknown function DUF218 [Candidatus Micrarchaeum
           acidiphilum ARMAN-2]
          Length = 295

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 40/101 (39%), Gaps = 8/101 (7%)

Query: 50  IERAFELLENQIGEKIFISGV-------HHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           +E A  LL+    + I  SG           +++   +++  +        +    ++++
Sbjct: 97  VEHAVLLLKEGRAKAILFSGGWSFKHRRKPRLTESEGMRRYAVSLGAPASALITEKRSMD 156

Query: 103 TEGNAQEASAWAEK-NNFHHVLIVTHDYHMPRTFLELQRIN 142
           T GNA  +S    K      +L+V   YHMPR     ++  
Sbjct: 157 TIGNALYSSKIIRKMRGTKRILLVAVAYHMPRASYIFRKAL 197


>gi|294627587|ref|ZP_06706170.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667213|ref|ZP_06732434.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598218|gb|EFF42372.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602994|gb|EFF46424.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 183

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/141 (17%), Positives = 50/141 (35%), Gaps = 18/141 (12%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRIERAFELL 57
           L +  +  + G+I ++    Q           I+VL               RI  A +L 
Sbjct: 2   LALIWLVAVAGWIVWVGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERIRHALDLY 56

Query: 58  ENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
                 ++  +G        ++  + ++  +R  +    I I   +  T  N ++A    
Sbjct: 57  AQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPDAIVIETTSRTTRQNLEQARTLM 116

Query: 115 EKNNFHHVLIVTHDYHMPRTF 135
           E++  H  +IV+   HM R  
Sbjct: 117 ERHGLHRAIIVSDPLHMARAL 137


>gi|225076794|ref|ZP_03719993.1| hypothetical protein NEIFLAOT_01845 [Neisseria flavescens
           NRL30031/H210]
 gi|224951892|gb|EEG33101.1| hypothetical protein NEIFLAOT_01845 [Neisseria flavescens
           NRL30031/H210]
          Length = 218

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 52/149 (34%), Gaps = 18/149 (12%)

Query: 3   YFWYGLFVCLIFFIMGFI---SFIRYVKQMHIPDHPSVSAIVVLTGEP-----------I 48
           Y + GL + ++     F+     I       +P      A VVL G              
Sbjct: 14  YLFRGLALSVLLVCGIFLTGTWQIYRTGLQTLPKDAHADAAVVL-GAAAWDKRPSPVFRE 72

Query: 49  RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT  
Sbjct: 73  RINHAITLYQSHRVGKIIFTGGTPKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNTYE 132

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           N          N    +++V+  YH+ R 
Sbjct: 133 NMLNIVPIMHANGVGSIIVVSDPYHLARA 161


>gi|148255961|ref|YP_001240546.1| hypothetical protein BBta_4612 [Bradyrhizobium sp. BTAi1]
 gi|146408134|gb|ABQ36640.1| hypothetical protein BBta_4612 [Bradyrhizobium sp. BTAi1]
          Length = 262

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 70/184 (38%), Gaps = 28/184 (15%)

Query: 32  PDHPSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISG----- 69
           P   +   I+VL G                    R+ +A  L       +I  +G     
Sbjct: 74  PAKGAPDGIIVLGGPVDPDLSIMYGMPVTVAGADRLIQAAALARRYPNARIVFTGGSANL 133

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           +     +  +   I +   +A+  + +  ++ NT  NA  + A          L+VT  +
Sbjct: 134 ISTDAREADVAADILLSLGVAKERLTLERESRNTYENAVFSKAMVAPKPGERWLLVTSAF 193

Query: 130 HMPRTFLELQRINSTVQFIPYPI---ISHDLEENS-SIFKIKILRVLLIEYLKILLLSIQ 185
           HMPR+    ++    V+  PYP+   +   L+ +  S+  ++   + + E++ ++   ++
Sbjct: 194 HMPRSVGLFRKAGFPVE--PYPVDWRVGRVLDVDGVSLLGLRRADIAVREWVGLVAYRLR 251

Query: 186 LSLS 189
             + 
Sbjct: 252 GRID 255


>gi|209884886|ref|YP_002288743.1| hypothetical protein OCAR_5752 [Oligotropha carboxidovorans OM5]
 gi|209873082|gb|ACI92878.1| protein of unknown function [Oligotropha carboxidovorans OM5]
          Length = 264

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 67/208 (32%), Gaps = 34/208 (16%)

Query: 11  CLIFFIMGFI----SFIRYVKQMHIP---DHPSVSAIVVLTG-----------------E 46
             +  + GF       +  + +       D  +   IVVL G                  
Sbjct: 46  IALLLVCGFSPLGNWLLLPLSERFPAWHDDGRAPDGIVVLGGAISPDLTAERGTAELNAS 105

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A EL       KI +SG      H   ++  + + +     +A   I    ++ 
Sbjct: 106 AERMTAAAELARRFPNAKIVLSGGNANVFHPLSTEAEVGRVLLENLGVAADRIVREDRSR 165

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA       +       L+VT  YHMPR     +  N  V+  P    +   +E  
Sbjct: 166 NTYENAIFTRDVVKPKPGERWLLVTSAYHMPRAIGVFRAANFPVEAYPIDWRTSGWKEAG 225

Query: 162 SIF---KIKILRV--LLIEYLKILLLSI 184
             F      + R+     E++ ++   +
Sbjct: 226 RPFLKLSAGLARLDTAAREWVGLIGYRL 253


>gi|146279502|ref|YP_001169660.1| H+/gluconate symporter and related permease-like protein
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145557743|gb|ABP72355.1| H+/gluconate symporter and related permease-like protein
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 187

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 53/142 (37%), Gaps = 9/142 (6%)

Query: 53  AFELLENQIGEKIFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A  L ++ +  K+ ISG   +V         +   +   +AE  + +   A NT  NA  
Sbjct: 40  AIALYKSGLTPKLLISGAGVAVDGSTEWSFYRDHALDAGVAESALLLEKAARNTAENAAF 99

Query: 110 ASAWAEKN----NFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISH-DLEENSSI 163
            +A  EK         + +    +HM R  + L+R     V+ +  P     DL   +  
Sbjct: 100 GAAVIEKELGWAKVRSLAVCAKPFHMRRAIMTLRRHVPADVRLVAQPPDDPGDLSAETWW 159

Query: 164 FKIKILRVLLIEYLKILLLSIQ 185
                 + +  E  KI   +++
Sbjct: 160 QTAPGRQRIFAELGKISEYALK 181


>gi|254412764|ref|ZP_05026537.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196180499|gb|EDX75490.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 263

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 41/227 (18%), Positives = 72/227 (31%), Gaps = 50/227 (22%)

Query: 6   YGLFVCLIF---FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE---------------- 46
            GL + L+    ++   +      + +   + P   AIV+L G                 
Sbjct: 43  LGLIILLVASNGWVANSMVQSLEWQHIPPTELPQAEAIVILGGATRSAIPPRPAPDLNEA 102

Query: 47  PIRIERAFELLENQIGEKIFISGVH---------HSVSKDILLQKIPIRQDLAECCIDIG 97
             R+    +L +      I  SG            S     +L+ I +        I   
Sbjct: 103 GDRVFYGAQLYQQGKAPVIIASGGRIEWRGGGSPESADMAQILEMIGVPPSA----ILQD 158

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----II 153
             +LNT  NA       ++     VL+VT   H PR     QR    ++ IP P    + 
Sbjct: 159 PASLNTHQNAVNVRRILQQEGIKKVLLVTSAMHTPRALRVFQR--QGIEAIPAPTDFLVT 216

Query: 154 SHDLEENSS------------IFKIKILRVLLIEYLKILLLSIQLSL 188
             +L E +S               + +    + EY+   +  ++  L
Sbjct: 217 QQELNEPNSSLAAILLNGLPDAQNLDMTTRAIKEYIGTAVYWLRGWL 263


>gi|56750108|ref|YP_170809.1| hypothetical protein syc0099_d [Synechococcus elongatus PCC 6301]
 gi|56685067|dbj|BAD78289.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 188

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 63/161 (39%), Gaps = 14/161 (8%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L    +   +G +  +  V         S  AI VL G+P R + A EL +      I++
Sbjct: 4   LIPITLLLSLGVVWGLNRVA----VAQRSPQAIFVLGGDPQREQFAAELAQTHPDLPIWV 59

Query: 68  S-GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           S G +         + +  +  +    + + Y+A +T  N    +   ++    HV +VT
Sbjct: 60  SSGSNP-----EYAEWVFGQAGVPRSRLHLDYQATDTLSNFTSLADRFQQQGIQHVYLVT 114

Query: 127 HDYHMPRTFL--ELQRINSTVQFIPYPIISHDLEENSSIFK 165
            DYHM R  +   +   +  + F P P+       + S  K
Sbjct: 115 SDYHMRRALVIANIVFASRGITFEPVPVPFD--RASESWRK 153


>gi|192291940|ref|YP_001992545.1| hypothetical protein Rpal_3570 [Rhodopseudomonas palustris TIE-1]
 gi|192285689|gb|ACF02070.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           TIE-1]
          Length = 264

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 64/181 (35%), Gaps = 31/181 (17%)

Query: 33  DHPSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISG-----V 70
              +   I+VL G                    R+  A +L       +I  SG     +
Sbjct: 75  AGRAPDGIIVLGGAIDSELSVARNTLEVDASAERVLAALDLARRYPKARIVYSGGSGNLI 134

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
             SV++  L  ++  R  LA   + +  K+  T  NA    A          L+VT  +H
Sbjct: 135 QRSVAEAPLAGELLERFGLASDRLVLEDKSRTTAENAAYTRALVVPKPGELWLLVTSAFH 194

Query: 131 MPRTFLELQRINSTVQFIPYPII-----SHDLEENSSIFKIKILR--VLLIEYLKILLLS 183
           MPR+ +  +     V  +PYP+      S D     S     + R  V + E+  +L   
Sbjct: 195 MPRSIIAFRAAGFDV--VPYPVDWRTRGSEDAARTFSTLAAGLARTDVAVHEWAGLLAYR 252

Query: 184 I 184
           +
Sbjct: 253 L 253


>gi|167629577|ref|YP_001680076.1| hypothetical protein HM1_1492 [Heliobacterium modesticaldum Ice1]
 gi|167592317|gb|ABZ84065.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 252

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 65/184 (35%), Gaps = 32/184 (17%)

Query: 31  IPDHPSVSAIVVLTGEPIRIER----AFELLENQIGEKIF-------ISGVHHSVSKDIL 79
            PD PS   I++L G    ++         +      ++        ++G    VS   +
Sbjct: 72  PPDKPSGDVIIMLGGGAT-MDTPDIDGLGQMTGGSANRLLTAARLHQLTGAPIIVSAGQV 130

Query: 80  LQKIPIRQDL----------AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
            +       +           E  I +   + NTE NA+      +   FH  ++VT  +
Sbjct: 131 FENSGNESRIAFRQLTGLGVPESMIIVEEMSRNTEENARYTKEILDARGFHKPILVTSAF 190

Query: 130 HMPRTFLELQRINSTVQFIPYP----IISHDL----EENSSIFKIKILRVLLIEYLKILL 181
           HM R+     ++   V  +P+P    +         +   S   +    + + EYL ++ 
Sbjct: 191 HMERSVGHFSKL--GVSTLPFPTDYRVNRQARYSLNDWAPSAVAMSNASLAMKEYLGLIP 248

Query: 182 LSIQ 185
           L ++
Sbjct: 249 LWLK 252


>gi|39936223|ref|NP_948499.1| hypothetical protein RPA3160 [Rhodopseudomonas palustris CGA009]
 gi|39650078|emb|CAE28601.1| DUF218 [Rhodopseudomonas palustris CGA009]
          Length = 264

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 64/181 (35%), Gaps = 31/181 (17%)

Query: 33  DHPSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISG-----V 70
              +   I+VL G                    R+  A +L       +I  SG     +
Sbjct: 75  AGRAPDGIIVLGGAIASELSAARNALEVDASAERVLAALDLARRYPKARIVYSGGSGNLI 134

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
             SV++  L  ++  R  LA   + +  K+  T  NA    A          L+VT  +H
Sbjct: 135 QRSVAEAPLAGELLERFGLASDRLVLEDKSRTTAENAAYTRALVAPKPGELWLLVTSAFH 194

Query: 131 MPRTFLELQRINSTVQFIPYPII-----SHDLEENSSIFKIKILR--VLLIEYLKILLLS 183
           MPR+ +  +     V  +PYP+      S D     S     + R  V + E+  +L   
Sbjct: 195 MPRSIIAFRAAGFDV--VPYPVDWRTRGSEDAARTFSTLAAGLARTDVAVHEWAGLLAYR 252

Query: 184 I 184
           +
Sbjct: 253 L 253


>gi|299065943|emb|CBJ37124.1| conserved protein of unknown function, DUF218 [Ralstonia
           solanacearum CMR15]
          Length = 180

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 57/154 (37%), Gaps = 13/154 (8%)

Query: 36  SVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAE 91
               IVVL GE   R+  A EL    +  ++F+SG       V +   +  +P  +   E
Sbjct: 35  RADVIVVLGGESGQRVIGAAELYHAGVAPRMFVSGGGDCLLIVRRLE-MAGVPAERIGHE 93

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
           C      ++ +T  NA+              ++VT  YH  R     +R+   V +    
Sbjct: 94  C------ESGSTMENARMTRRTLAGQPVRSAVLVTSWYHTGRALNVFRRVWPEVAWGARG 147

Query: 152 IISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           +   D    S          +L EY+K    +++
Sbjct: 148 VFPGDTFAKSFPIYESGS--ILAEYIKRTWYAVR 179


>gi|170758739|ref|YP_001788223.1| hypothetical protein CLK_2294 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169405728|gb|ACA54139.1| conserved hypothetical protein [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 197

 Score = 69.5 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 60/135 (44%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   ++K  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMEKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R   EL      ++     +       +  +  
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRA--ELLCQKEGIKASYSGVFVRSHMSHEIMGF 182

Query: 166 IKILRVLLIEYLKIL 180
           ++ +  LL+ Y+K +
Sbjct: 183 LREIPALLVYYIKTM 197


>gi|74316470|ref|YP_314210.1| transmembrane protein [Thiobacillus denitrificans ATCC 25259]
 gi|74055965|gb|AAZ96405.1| probable transmembrane protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 251

 Score = 69.5 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 75/208 (36%), Gaps = 30/208 (14%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------------IR 49
            L+     ++ G +     +     P      AIVVL+G                    R
Sbjct: 48  ALYALSTPWVGGLLLKSLEISVPVDPARLQADAIVVLSGGRRMASREYGGDTLNGISLER 107

Query: 50  IERAFELLENQIGEKIFISGVHHS----VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           +  A  L     G  + ++G +          IL Q +     +    +     AL T  
Sbjct: 108 LRYAVRL-HRATGLPLLVTGGNPGGGTLAEGQILAQVLRDDYGIEPRWV--EDAALTTWD 164

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTF-----LELQRINSTVQFIPYPIISHDLEEN 160
           NA+ ++   +K+  H + +VTH +H+ R        EL+ I + +QF    +    L+  
Sbjct: 165 NARLSAPLLKKSGVHRIALVTHAWHLRRAVPLFEAQELEVIPAGIQFASTDLDRI-LDLL 223

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQLSL 188
            +   ++     L E+L IL   ++ + 
Sbjct: 224 PTPAGLRDSSFALHEWLGILWYKLRSNF 251


>gi|325267121|ref|ZP_08133790.1| protein of hypothetical function DUF218 [Kingella denitrificans
           ATCC 33394]
 gi|324981474|gb|EGC17117.1| protein of hypothetical function DUF218 [Kingella denitrificans
           ATCC 33394]
          Length = 213

 Score = 69.5 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 54/149 (36%), Gaps = 17/149 (11%)

Query: 33  DHPSVSAIVVLTGEP-----------IRIERAFELLENQIGEKIFISGVHHS---VSKDI 78
           D P   A VVL G              RI  A  L +     K+  +G        ++  
Sbjct: 42  DLPQADAAVVL-GAAAWGNRPSPVFRERINHALTLYQTGYVRKLIFTGGTPKSGYETEAE 100

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + +   ++Q + E  I I  ++ +T  N        +K++ H ++I++   H+ R     
Sbjct: 101 VARNFALKQGIPEQDILIEMRSKDTYQNLVNTRFLMQKHHLHDIVIISDPLHIARAMAIA 160

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + ++    + P P  +      S   +  
Sbjct: 161 EDLDIKANYSPTP--TSRYHNASWQTQAA 187


>gi|148658348|ref|YP_001278553.1| hypothetical protein RoseRS_4260 [Roseiflexus sp. RS-1]
 gi|148570458|gb|ABQ92603.1| protein of unknown function DUF218 [Roseiflexus sp. RS-1]
          Length = 193

 Score = 69.5 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 56/162 (34%), Gaps = 8/162 (4%)

Query: 36  SVSAIVVLTGE---PIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQ 87
           +  AIVVL GE   P R   A  L + Q    +  +G         +S   +  +  + +
Sbjct: 30  TADAIVVLGGEAYPPNRTIHALNLYKQQRAPVVVFTGGALPGQPPEISSARVALRYALAR 89

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            L      +   A +T   A      A  + +  ++IVT  YH  R     + I   VQ 
Sbjct: 90  GLPAEVALVVDTAQSTYDEATLVRDLAAHHGWRSLIIVTDPYHTRRAVRTFRSIIPDVQV 149

Query: 148 IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
                   D   +     +++ R    E +K+    +   + 
Sbjct: 150 TASVAPFLDTFADPLSRGVRVWRYAAAELIKMAFYRLHYGIP 191


>gi|166714094|ref|ZP_02245301.1| hypothetical protein Xoryp_22305 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 205

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 52/148 (35%), Gaps = 20/148 (13%)

Query: 3   YFWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + W      LI+ +   G+I +I    Q           I+VL               RI
Sbjct: 17  WGWRLCMPALIWLVAVTGWIVWIGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERI 71

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A +L       ++  +G        ++  + ++  +R  +    I I   +  T  N 
Sbjct: 72  RHALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQNL 131

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           ++A    E++  H  +IV+   HM R  
Sbjct: 132 EQARTLMERHGMHRAIIVSDPLHMARAL 159


>gi|84621867|ref|YP_449239.1| hypothetical protein XOO_0210 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188574494|ref|YP_001911423.1| hypothetical protein PXO_03633 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58424447|gb|AAW73484.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84365807|dbj|BAE66965.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188518946|gb|ACD56891.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 205

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 53/150 (35%), Gaps = 20/150 (13%)

Query: 1   MRYFWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------I 48
           + + W      LI+ +   G+I +I    Q           I+VL               
Sbjct: 15  LGWGWRLCMPALIWLVAVAGWIVWIGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEE 69

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A +L       ++  +G        ++  + ++  +R  +    I I   +  T  
Sbjct: 70  RIRHALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQ 129

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           N ++A    E++  H  +IV+   HM R  
Sbjct: 130 NLEQARTLMERHGMHRAIIVSDPLHMARAL 159


>gi|282900121|ref|ZP_06308078.1| protein of unknown function DUF218 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195003|gb|EFA69943.1| protein of unknown function DUF218 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 263

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 78/226 (34%), Gaps = 44/226 (19%)

Query: 5   WYGLFVCLIFFIM-GFI----SFIRYVKQMHIPDHPSVSAIVVLTG-------------- 45
           W G+ + ++     G++          + + +   P   AIVVL G              
Sbjct: 40  WIGISLAILIISGNGWVSKSLVASLEWQNIPLEKIPQAEAIVVLGGATKPAAWPRSTVDL 99

Query: 46  --EPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGY 98
                R+  A +L   +    I +SG           +   +  I I   +    I    
Sbjct: 100 NESGDRVIYAAQLYGQKKAPLIILSGGRIDWRGGGTPESADMATILISLGIPPEVIIEEP 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IIS 154
            +LNT  NA       E      VL+VT   H PR+    QR    V+ IP P    +  
Sbjct: 160 NSLNTYENAVNVKKILESRGIKKVLLVTSAMHTPRSLKIFQR--QGVEVIPAPTDFIVSR 217

Query: 155 HDLEENSSIFKIKILRV------------LLIEYLKILLLSIQLSL 188
            DLEE  +  K  IL +             L EY+  L+ +++  L
Sbjct: 218 SDLEELIATPKSTILNLFPSADNLNDFTNALKEYIGYLVYALRGWL 263


>gi|260881233|ref|ZP_05403953.2| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
 gi|260849348|gb|EEX69355.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
          Length = 266

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 61/176 (34%), Gaps = 29/176 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYV-----KQMHIPDHPSVSAIVVLTGEP--------- 47
           R       +   F+++                   P+ P+   I++L G           
Sbjct: 51  RAAAVLFALTFAFYLLCTGLVAEKTMGWLESAYQPPERPAGDVIIMLGGGAYSDTPDVDG 110

Query: 48  ---------IRIERAFELLENQIGEKIFISG--VHHSVS-KDILLQKIPIRQDLAECCID 95
                     R+  A  L        +  SG  V+     +  + +++ +   + E  I 
Sbjct: 111 TGTLCASPASRLLTAVRLQRQLDVPILL-SGGQVYEDTGAEAKIAKRVLMSLGVPEDKIL 169

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
              +++NT  NA+ ++    +N   H ++VT  +HM R+ L   +    V   P+P
Sbjct: 170 TETRSINTSQNARFSAEILRENGLSHPILVTSAFHMKRSVLNFAK--QGVAVEPFP 223


>gi|227824083|ref|YP_002828056.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227343085|gb|ACP27303.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 261

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 52/175 (29%), Gaps = 30/175 (17%)

Query: 5   WYGLFVCLIFFIMG------FISFIRYVKQMHIPDHPSVSAIVVLTGE------------ 46
           +  L + ++F  +       F+  +        P    ++ I+VL G             
Sbjct: 40  FASLGLIVLFLSLFTTTGPYFLQMLEDRFPRPSPPPAEIACIIVLGGAFENVVIASRGGM 99

Query: 47  -----PIRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQD--LAECCIDI 96
                  R   A  L +     +I +SG         +              +    +  
Sbjct: 100 EFNQAADRFVEAVRLAKAYPAARILVSGGDGSISGAYEGDARASQGFFNAFGIGADRVIR 159

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
              +  T  NA+        N      +VT  YHMPR+    +   + +  +P+P
Sbjct: 160 EEDSRTTFENARYTKDLLAANGLERCALVTSAYHMPRSVGLFRA--NGIAVVPWP 212


>gi|332975337|gb|EGK12233.1| hypothetical protein HMPREF9373_1599 [Psychrobacter sp. 1501(2011)]
          Length = 260

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 60/154 (38%), Gaps = 20/154 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYV-KQMHIPDHP--SVSAIVVLTGE----------P 47
           +R  W  L+     +++ F+ F   +   +  P+ P   V AI++L G            
Sbjct: 63  LRKIWKTLWAGFGIWLVSFLVFAFTLHSHVRQPNEPFEKVDAIIILGGGIQDGLPTPTLA 122

Query: 48  IRIERAFELLENQIGEKIFISG-VHHSVSKDI---LLQKIPIRQDLAECCIDIGYKALNT 103
            R++ A  L+  Q    +  SG V    ++     + Q +     +    I    K+ +T
Sbjct: 123 SRLDTAVPLIREQPEAIVITSGGVGIGETRSEGEAMAQYLHALYGIPLDDIYQEKKSTST 182

Query: 104 EGNAQEASAWAEKNNF---HHVLIVTHDYHMPRT 134
           E N   +       N      + IVT D+HMPR+
Sbjct: 183 EENFLFSQKILTDKNISLKDPIAIVTSDFHMPRS 216


>gi|160941542|ref|ZP_02088874.1| hypothetical protein CLOBOL_06440 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435507|gb|EDP13274.1| hypothetical protein CLOBOL_06440 [Clostridium bolteae ATCC
           BAA-613]
          Length = 238

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 37/188 (19%), Positives = 72/188 (38%), Gaps = 26/188 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV----SAIVVL------TGEPI---- 48
               GL  CL  F++      +    +   D  +       I+VL       G P     
Sbjct: 14  LLVLGLAGCLFLFLINLYMIRKEKPNIISSDDAAALGDVDCIMVLGCSVRPDGTPSGMLR 73

Query: 49  -RIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEG 105
            R+++  EL E+ + +++ +SG H   + D +  +++  I + +    I + +   +T  
Sbjct: 74  DRLDKGIELYEDGVSDRLLMSGDHGRKNYDEVNRMKQYAIDEGIPSGDIFMDHAGFSTYE 133

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           +   A    +      ++IVT  YHM R       +   +    Y + S   +      K
Sbjct: 134 SMYRARDIFQ---VKKIIIVTQRYHMYRAL----YVAQAMGMEAYGVESDPRQYGG--QK 184

Query: 166 IKILRVLL 173
           ++ LR LL
Sbjct: 185 MRDLRELL 192


>gi|209521954|ref|ZP_03270620.1| protein of unknown function DUF218 [Burkholderia sp. H160]
 gi|209497609|gb|EDZ97798.1| protein of unknown function DUF218 [Burkholderia sp. H160]
          Length = 212

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 70/196 (35%), Gaps = 35/196 (17%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSA--------IVVLTGEP-------------- 47
           +  +F+++        +  +  P   S +A        I++L G                
Sbjct: 1   MIALFWLLAAGWLTAPLLDLAQPQRQSAAAATFAPRTAIILLGGGTIYDDDNVLVPPHDV 60

Query: 48  -IRIERAFELLENQIGE----KIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYK 99
             RIE +              ++ +SG +    S ++        +RQ +A   I +   
Sbjct: 61  LSRIEVSARNYAACKRTANICQVIVSGGNPQRHSATEADTYLPYLLRQQVARSDIVLEKT 120

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           +  T  NA+  SA   ++++  +++VT  YHMPR  L+ Q         P P IS     
Sbjct: 121 SRTTYENARNVSAIVGQSHYDTLILVTSAYHMPRALLDFQCFG----VEPQPQISSARRA 176

Query: 160 NSSIFKIKILRVLLIE 175
              +   +   +L  E
Sbjct: 177 RLGVL-PRFENLLAAE 191


>gi|144900194|emb|CAM77058.1| Protein of unknown function DUF218 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 167

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 46/103 (44%), Gaps = 2/103 (1%)

Query: 47  PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
             R+  A  L+ +     + +SG  V+H   + ++++ + +   +    I +  ++ NT 
Sbjct: 30  ARRVAHAATLVHSGRVAHLLMSGGAVNHPTPEALVMRDLAMAAGIDADRIVVEDQSRNTI 89

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
           GNA+  +       +  +L+VT  +H+PR  L   R    V  
Sbjct: 90  GNARYCAPIIVAQGWTRLLLVTDSFHLPRARLIFARHGLKVAL 132


>gi|86355763|ref|YP_467655.1| hypothetical protein RHE_CH00103 [Rhizobium etli CFN 42]
 gi|86279865|gb|ABC88928.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 262

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/157 (17%), Positives = 55/157 (35%), Gaps = 24/157 (15%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHHSVSK---------DILLQKIPIRQD-LAECCI 94
           G   R   A  L +     +I ISG   S+S          +       I +D L E   
Sbjct: 103 GGADRFIEALRLAQKFPQSRILISGGDGSISGIYEGDAAASERFFPLFGIGKDRLIE--- 159

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP--- 151
               ++  T  NA     +       H L++T  +HMPR+    +++   +  +P+P   
Sbjct: 160 --ERQSRTTFENAVNTREFLASQGLSHCLLITSGFHMPRSVGIFRKL--GIDIVPWPTDY 215

Query: 152 ----IISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
                +   L+        + +   + E+  ++   +
Sbjct: 216 RTDGQVRPGLDFTQPNLNAQSMATAIREWYGLIGYYL 252


>gi|46202066|ref|ZP_00208367.1| COG1434: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 173

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 48/122 (39%), Gaps = 3/122 (2%)

Query: 47  PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
             R+E    L  +     + +SG  V H+  +  +++ + ++  L    + +   + NT 
Sbjct: 31  ARRVELGVRLARDGKVAHLLMSGGAVRHTTPEAHVMRAMALQSGLDPDRLHVEDASRNTI 90

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF-IPYPIISHDLEENSSI 163
           GNA  +    E   +  +LI+T   HM R      R+    +    +P  +   E   + 
Sbjct: 91  GNALMSRPMIEARGWTRLLIITDACHMARALYIFHRLGLKARPAAAWPETNPGPEWYMAW 150

Query: 164 FK 165
            +
Sbjct: 151 LR 152


>gi|21229858|ref|NP_635775.1| hypothetical protein XCC0380 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66766735|ref|YP_241497.1| hypothetical protein XC_0392 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188989803|ref|YP_001901813.1| hypothetical protein xccb100_0407 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21111359|gb|AAM39699.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572067|gb|AAY47477.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167731563|emb|CAP49738.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 205

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 52/148 (35%), Gaps = 20/148 (13%)

Query: 3   YFWYGLFVCLIFFI--MGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRI 50
           + W    + LI+ +   G+I ++    Q           I+VL               RI
Sbjct: 17  WGWRLCMLALIWLVGVAGWIVWVGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERI 71

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A +L        +  +G        ++  + ++  +R  +    I I   +  T  N 
Sbjct: 72  RHALDLYARGYAPHLLFTGGFGNGARFAESQVARRYALRHGVPSEAIVIETSSRTTRQNL 131

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTF 135
            +A A  E++  H  +IV+   HM R  
Sbjct: 132 LQARALMERHGMHRAIIVSDPLHMARAL 159


>gi|124007832|ref|ZP_01692534.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123986778|gb|EAY26559.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 256

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 60/159 (37%), Gaps = 17/159 (10%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISGV--HHSVSKDI----LLQKIPIRQDLAECCI 94
           V L     RI +A  L      +KI ISG         +     LL+++ ++  +    I
Sbjct: 96  VYLDKGGDRITQALMLYRVGKIKKILISGGSFDPKQRLERAEAYLLKQVLLQAKVPSHDI 155

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
            I  KA NT  NA   +    K       L++T  +H+ R     ++    ++  P+ + 
Sbjct: 156 IIETKARNTRENALNTAKILNKQFPRQSYLLITSAFHIRRAVGCFRQA--GIRVTPFSVD 213

Query: 154 SHDLEEN--------SSIFKIKILRVLLIEYLKILLLSI 184
            + +++          +   +    VL  E +  ++  +
Sbjct: 214 FYTIDKGFTFPFSLFPAEKALYKWYVLSHEVIGYIVYKV 252


>gi|217077219|ref|YP_002334937.1| hypothetical protein THA_1144 [Thermosipho africanus TCF52B]
 gi|217037074|gb|ACJ75596.1| conserved hypothetical protein [Thermosipho africanus TCF52B]
          Length = 241

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 85/208 (40%), Gaps = 32/208 (15%)

Query: 2   RYFWYGLFVCLIFFIM----GFISFIR---YVKQMHIPDHPSVSAIVVLTGE-------- 46
           R  W    +  I F +     F+ F+    Y+K+ +IPD  +   IV+L G         
Sbjct: 34  RQIWRFFLILSIVFYLISSPFFVYFLSKSFYIKEKNIPDSQNS-VIVILGGGITFFDGKY 92

Query: 47  ------PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                   R+ + FE+        I ISG  +   +S+  +++ I +   +    I +  
Sbjct: 93  EVGNHTLKRLLKGFEIYRKTNAP-IIISGGVIGKGISESAIMKDILVTFGVNINDIIVED 151

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP----YPII- 153
           KA  T+ NA   S   +  NF ++++VT   HM R+ +  ++ +     IP    YPI  
Sbjct: 152 KARTTKENAIFVSKLLKGKNFENIILVTSFLHMKRSIMLFEKYSKK-NIIPIVCDYPIDF 210

Query: 154 -SHDLEENSSIFKIKILRVLLIEYLKIL 180
            +  L+   S   +     +  E+  IL
Sbjct: 211 RNSFLDYLPSAEALYTFSQITHEFFGIL 238


>gi|302039339|ref|YP_003799661.1| hypothetical protein NIDE4067 [Candidatus Nitrospira defluvii]
 gi|300607403|emb|CBK43736.1| conserved protein of unknown function DUF218 [Candidatus Nitrospira
           defluvii]
          Length = 270

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 52/154 (33%), Gaps = 25/154 (16%)

Query: 31  IPDHPSVSAIVVLTGE-----------------PIRIERAFELLENQIGEKIFISGVHHS 73
                   A+VVL G                    R     +L +  +  K+ ++G   +
Sbjct: 83  PASASKFDAVVVLAGGVFQKGSLRPADEVSDASRQRTSCGTDLWKQNLAPKLLLTGGDAT 142

Query: 74  VSKDILL-----QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           V +  L+     ++  IR  + E  I    ++  T  NA +  +         +L+VT  
Sbjct: 143 VFRTGLMESHEMKRWAIRLGVPESAILTEEQSRTTYENAVQTKSML---GSGRILLVTAA 199

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           YH+PR     ++    V   P    S    + + 
Sbjct: 200 YHLPRAVRLFEKQGFVVTPFPCGFESQHTPQQAW 233


>gi|78045951|ref|YP_362126.1| hypothetical protein XCV0395 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325929410|ref|ZP_08190538.1| hypothetical protein XPE_4644 [Xanthomonas perforans 91-118]
 gi|78034381|emb|CAJ22026.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325540185|gb|EGD11799.1| hypothetical protein XPE_4644 [Xanthomonas perforans 91-118]
          Length = 183

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 50/141 (35%), Gaps = 18/141 (12%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRIERAFELL 57
           L +  +  + G+I +I    Q           I+VL               RI  A +L 
Sbjct: 2   LALIWLVAVAGWIVWIGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERIRHALDLY 56

Query: 58  ENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
                 ++  +G        ++  + ++  +R  +    I I   +  T  N ++A    
Sbjct: 57  AQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQNLEQARTLM 116

Query: 115 EKNNFHHVLIVTHDYHMPRTF 135
           E++  H  +IV+   HM R  
Sbjct: 117 ERHGLHRAIIVSDPLHMARAL 137


>gi|168181584|ref|ZP_02616248.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|237796355|ref|YP_002863907.1| hypothetical protein CLJ_B3154 [Clostridium botulinum Ba4 str. 657]
 gi|182675224|gb|EDT87185.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|229261607|gb|ACQ52640.1| conserved hypothetical protein [Clostridium botulinum Ba4 str. 657]
          Length = 197

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 60/135 (44%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ + +  I +  K+ NT  
Sbjct: 65  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGVDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R   EL      ++     +       +  +  
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRA--ELLCQKEGIKASYSGVFVRSHMSHEIMGF 182

Query: 166 IKILRVLLIEYLKIL 180
           ++ +  LL+ Y+K +
Sbjct: 183 LREIPALLVYYIKTM 197


>gi|251792809|ref|YP_003007535.1| molybdate ABC transporter permease [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534202|gb|ACS97448.1| molybdate ABC transporter permease protein [Aggregatibacter
           aphrophilus NJ8700]
          Length = 248

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 52/136 (38%), Gaps = 30/136 (22%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIR---------IERAFEL--------LENQIGEKIFISG 69
             + + D+    AIV+L G  +R            A +L        L+ +    + ISG
Sbjct: 69  DHLTLNDYRQAQAIVLL-GGGVRDSKELYAPLASSAVQLERLRYAAYLQKETQLPLLISG 127

Query: 70  VHHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           V  +      VS   L     +          +  K+L T+ NA       EK   + ++
Sbjct: 128 VSPTGASEAKVSMQELQDFFNVPTQW------LEEKSLTTKENALFTRQLLEKEGINKII 181

Query: 124 IVTHDYHMPRTFLELQ 139
           +VT+++HM R  L  +
Sbjct: 182 LVTNEWHMQRAKLLFE 197


>gi|322807220|emb|CBZ04794.1| hypothetical protein H04402_02990 [Clostridium botulinum H04402
           065]
          Length = 197

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   +QK  +++ L +  I +  K+ NT  
Sbjct: 65  RLDEGLGLYNEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R   EL      ++     +       +  +  
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRA--ELLCQKEGIKASYSGVFVRSHMSHEIMGF 182

Query: 166 IKILRVLLIEYLKIL 180
           ++ +  LL+ Y+K +
Sbjct: 183 LREIPALLVYYIKTM 197


>gi|16330498|ref|NP_441226.1| hypothetical protein sll1606 [Synechocystis sp. PCC 6803]
 gi|1652989|dbj|BAA17906.1| sll1606 [Synechocystis sp. PCC 6803]
          Length = 262

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 52/143 (36%), Gaps = 24/143 (16%)

Query: 29  MHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIFISGVH- 71
           + + D P    IVVL G                   R+    ++ +      I  +G   
Sbjct: 69  LPMEDFPQAPVIVVLGGGLYQATYPRQFPEVAEAGDRVIYGAQIYQEGKAPYIITTGGRI 128

Query: 72  -----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
                 + S+   +  +  R D+    I    K+LNT  NA       ++   + +++VT
Sbjct: 129 PWLGTVATSEAEDMALLLQRLDVPREAIIKEEKSLNTRQNAVFTQKILQQRGINTIILVT 188

Query: 127 HDYHMPRTFLELQRINSTVQFIP 149
             YHMPR     +++   +  IP
Sbjct: 189 SGYHMPRAKRVFEKL--GIIVIP 209


>gi|187778517|ref|ZP_02994990.1| hypothetical protein CLOSPO_02112 [Clostridium sporogenes ATCC
           15579]
 gi|187772142|gb|EDU35944.1| hypothetical protein CLOSPO_02112 [Clostridium sporogenes ATCC
           15579]
          Length = 181

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 58/135 (42%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L     G+ I +SG      ++S+   ++K  + + + +  I +  K+ NT  
Sbjct: 49  RLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEAMEKYLVEKGVDKNFIILEDKSKNTLE 108

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R   EL      ++     +       +  +  
Sbjct: 109 NIKFSKKKMEDNNLKSSIIVSNKYHLKRA--ELLCQKEGIKASYSGVFVKPHMSHEIVGF 166

Query: 166 IKILRVLLIEYLKIL 180
            + +  LL+ Y+K +
Sbjct: 167 FREIPALLVYYVKTI 181


>gi|91977540|ref|YP_570199.1| hypothetical protein RPD_3072 [Rhodopseudomonas palustris BisB5]
 gi|91683996|gb|ABE40298.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB5]
          Length = 264

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 63/179 (35%), Gaps = 27/179 (15%)

Query: 33  DHPSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISG-----V 70
           +  +   I+VL G                    R+  A EL       +I  SG     +
Sbjct: 75  NGRAPDGIIVLGGAVDSEVSAARSSLEIDSSAERVVAALELARQYPQARIIYSGGSGNLI 134

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
            +SV++  +  ++  R  +A   + +  K+  T  NA               L+VT  +H
Sbjct: 135 ANSVAEAPIAGELLARFGVAPDRVVLESKSRTTAENASFTRELVSPKPGEVWLLVTSAFH 194

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK-----IKILRVLLIEYLKILLLSI 184
           MPR+    + +   VQ  P    +    + +  F      +  + V + E+  +L   +
Sbjct: 195 MPRSIEAFRAVEFDVQAYPVDWRTRGWRDAALPFDRLSSGLARMDVAVHEWAGLLAYRL 253


>gi|261868380|ref|YP_003256302.1| molybdate ABC transporter permease [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413712|gb|ACX83083.1| molybdate ABC transporter permease protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 247

 Score = 68.3 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 52/138 (37%), Gaps = 34/138 (24%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRIERAFEL-------------------LENQIGEKIFI 67
             + + D+    AIV+L G    +  + EL                   L+ +    + I
Sbjct: 68  DHLTLEDYKQAQAIVLLGGG---VRDSKELYAPLASSATQLERLRYAAYLQKETQLPLLI 124

Query: 68  SGVHHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           SGV  +      VS   LL    +          +  K+L T+ NA       EK   + 
Sbjct: 125 SGVSPTGASEAKVSAQELLDFFHVPTKW------LEEKSLTTKENALYTRQLLEKEGINK 178

Query: 122 VLIVTHDYHMPRTFLELQ 139
           +++VT+++HM R  L  +
Sbjct: 179 IILVTNEWHMQRAKLLFE 196


>gi|332711315|ref|ZP_08431247.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
 gi|332349864|gb|EGJ29472.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
          Length = 281

 Score = 68.3 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 46/208 (22%), Positives = 75/208 (36%), Gaps = 57/208 (27%)

Query: 33  DHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIFISGVH----- 71
           + P   AIV+L G                   R+    +L        +  +G       
Sbjct: 73  ELPEADAIVILGGATKPPFPPRPTPEVDEAGDRVLYGAQLYREGKAPWVIPAGGRIVWGS 132

Query: 72  ---------HSVSKDILLQKIPIRQDLAECCIDIG---------YKALNTEGNAQEASAW 113
                     S S     +  P  +D+A+   D+G          ++LNT  NA      
Sbjct: 133 SSNNSSQRLSSESGQSSQRLAPESEDMAQILEDLGVPRAAIIQESRSLNTHQNAVNVRKI 192

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENSSIFKIKIL 169
            ++ +F  VL+VT   HMPR+ L  +R    +  IP P    +  H+L+E SS  +  +L
Sbjct: 193 LDQRDFPKVLLVTSAIHMPRSVLVFRR--QGIDVIPAPTDFLVSQHELDEPSSSSQAALL 250

Query: 170 RVL------------LIEYLKILLLSIQ 185
             L            + EY+ I+   I+
Sbjct: 251 HSLPNAEQLSRITRAIKEYIGIVAYRIR 278


>gi|326390031|ref|ZP_08211593.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993896|gb|EGD52326.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 192

 Score = 68.3 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 81/192 (42%), Gaps = 15/192 (7%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVL-------TGEP---IR 49
           M+     + + ++ F+   I+    +    + + P     I+VL       T  P    R
Sbjct: 1   MKLLLRFIGILIVIFVTVVITLEYQIISFALYEKPKKSDVIIVLGCAVYGKTPSPFFKER 60

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++ A  L +   G+ I +SG      ++S+    ++  ++  + E  I    K+ +T  N
Sbjct: 61  LDEALRLYKEGYGKYIIVSGGKGPGENISEAEAGKEYLLKNGIPEKIILTDDKSFSTYEN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
              +    +KN+    +I+++ +H+ R  +  +RI+    F    I  + L + +    +
Sbjct: 121 LLFSKEIMDKNSLKTAIIISNKFHLKRASVIAKRIDINASFSGVFIKRYMLSDEA-YGFL 179

Query: 167 KILRVLLIEYLK 178
           + +  LL  YLK
Sbjct: 180 REIPALLYTYLK 191


>gi|220908702|ref|YP_002484013.1| hypothetical protein Cyan7425_3327 [Cyanothece sp. PCC 7425]
 gi|219865313|gb|ACL45652.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 202

 Score = 68.3 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 74/189 (39%), Gaps = 10/189 (5%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  + FI+ +I F+     +    +P   AI++L G   RI  A E         I+ +G
Sbjct: 5   ILFLGFILFWIGFVPLRLAIAHQQYPQPQAILLLEGHRQRIPFAAEFWNQHPTLPIWFTG 64

Query: 70  VHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
              +       + Q+  +  ++    I    ++ +T  N         + + HHV ++T 
Sbjct: 65  -SRTDRPRNQRIFQQAGVPAEM----IHYDRRSTDTVTNFTAIVRDLVRQDIHHVFLITS 119

Query: 128 DYHMPR--TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI-LRVLLIEYLKILLLSI 184
           DYHMPR      L   +  + F P  + +   ++ +    ++  LR +L     +   S+
Sbjct: 120 DYHMPRASAIATLVLGSQGIVFTPVSVPTSPPKQENQWRTLRDCLRSVLWMVTGVTGASL 179

Query: 185 QLSLSTQTA 193
           +       A
Sbjct: 180 RSYFQPNIA 188


>gi|261365693|ref|ZP_05978576.1| putative periplasmic protein [Neisseria mucosa ATCC 25996]
 gi|288565787|gb|EFC87347.1| putative periplasmic protein [Neisseria mucosa ATCC 25996]
          Length = 224

 Score = 68.3 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 59/165 (35%), Gaps = 22/165 (13%)

Query: 3   YFWYGLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------I 48
           Y + G+ + ++  +  F      + +     +P H    A +VL G              
Sbjct: 14  YLFRGIGLSILLILGIFSVGAWQVYHTGSQPLPRHVRADAALVL-GAAAWDKRPSPVFRE 72

Query: 49  RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A  L ++   EKI  +G       +++  + ++  ++Q +    I     + NT  
Sbjct: 73  RINHAITLYQSHRVEKIVFTGGTSKKGYMTEAEVGRRYALKQGIPAHNIIFENTSRNTYE 132

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
           N +             ++IV+  YH+ R       I S +    Y
Sbjct: 133 NIRNIRPILRAEGIESIIIVSDPYHLARAL----EIASDLDIEAY 173


>gi|295676250|ref|YP_003604774.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1002]
 gi|295436093|gb|ADG15263.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1002]
          Length = 262

 Score = 68.3 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 63/165 (38%), Gaps = 32/165 (19%)

Query: 8   LFVCLI--FFIMGFISFIRYVKQMHIPDHPSVSA--------IVVLTGEP---------- 47
           L +C+I  F+++        +  +  P   S  A        I++L G            
Sbjct: 47  LVICMIALFWLLAAGWLTAPLLDLAQPQRQSAEAATFAPRTAIILLGGGTIYDHDHVLVP 106

Query: 48  -----IRIERAFELLENQI----GEKIFISGVHH---SVSKDILLQKIPIRQDLAECCID 95
                 RIE + +            ++ +SG +    S ++        +RQ +    I 
Sbjct: 107 PRDVLSRIEVSAQNYAACKRTAIVCQVIVSGGNPQRHSATEADTYLPYLLRQQVPRSDIV 166

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           +   +  T  NA+  S    ++++  +++VT  YHMPR  L+ QR
Sbjct: 167 LEKSSRTTYENARNVSVIVGQSHYDKLILVTSAYHMPRALLDFQR 211


>gi|293392078|ref|ZP_06636412.1| molybdate ABC transporter permease protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952612|gb|EFE02731.1| molybdate ABC transporter permease protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 247

 Score = 68.3 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 52/138 (37%), Gaps = 34/138 (24%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRIERAFEL-------------------LENQIGEKIFI 67
             + + D+    AIV+L G    +  + EL                   L+ +    + I
Sbjct: 68  DHLTLEDYKQAQAIVLLGGG---VRDSKELYAPLASSATQLERLRYAAYLQKETQLPLLI 124

Query: 68  SGVHHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           SGV  +      VS   LL    +          +  K+L T+ NA       EK   + 
Sbjct: 125 SGVSPTGASEAKVSAQELLDFFHVPTKW------LEEKSLTTKENALYTRQLLEKEGINK 178

Query: 122 VLIVTHDYHMPRTFLELQ 139
           +++VT+++HM R  L  +
Sbjct: 179 IILVTNEWHMQRAKLLFE 196


>gi|167039302|ref|YP_001662287.1| hypothetical protein Teth514_0643 [Thermoanaerobacter sp. X514]
 gi|256752180|ref|ZP_05493045.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913942|ref|ZP_07131259.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X561]
 gi|307725373|ref|YP_003905124.1| hypothetical protein Thet_2282 [Thermoanaerobacter sp. X513]
 gi|166853542|gb|ABY91951.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X514]
 gi|256748908|gb|EEU61947.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300890627|gb|EFK85772.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X561]
 gi|307582434|gb|ADN55833.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X513]
          Length = 192

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 63/148 (42%), Gaps = 14/148 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVL-------TGEP---IR 49
           M+     + V ++ F+   I+    +    + + P     I+VL       T  P    R
Sbjct: 1   MKLLLRFIGVLIVIFVTVVITLEYQIISFALYEKPKKSDVIIVLGCAVYGKTPSPFFKER 60

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++ A  L +   G+ I +SG      ++S+    ++  ++  + E  I    K+L+T  N
Sbjct: 61  LDEALRLYKEGYGKYIIVSGGKGPGENISEAEAGKEYLLKNGIPEKIILTDNKSLSTYEN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRT 134
              +    +KN+    +I+++ +H+ R 
Sbjct: 121 LFFSKEIMDKNSLKTAIIISNKFHLKRA 148


>gi|154249896|ref|YP_001410721.1| hypothetical protein Fnod_1217 [Fervidobacterium nodosum Rt17-B1]
 gi|154153832|gb|ABS61064.1| protein of unknown function DUF218 [Fervidobacterium nodosum
           Rt17-B1]
          Length = 219

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 64/172 (37%), Gaps = 22/172 (12%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAI--VVLTGEPI----------- 48
           +  +  L   L+F+ +    F   + +  +        I  VVL G              
Sbjct: 15  KLAFLFLSFALVFYFLTSNLFAYLISKTFVLKDTEDKGIFIVVLGGGVDEFSNNVEIGKH 74

Query: 49  ---RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
              R+ +A EL +N    KI ++G  +   V + ++++ + +   + E  I +G KA NT
Sbjct: 75  TLRRLYKALELYKN-RPRKIIVTGGIIDKGVPEALIMKNVLLNFGVPEEDIILGSKARNT 133

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
             N +             + +VT   HM R+    ++    V F+   +   
Sbjct: 134 FENGKCTFELI---GDVPITLVTSTIHMKRSLFVFRKFFKDVSFVSADVPVD 182


>gi|150398639|ref|YP_001329106.1| hypothetical protein Smed_3453 [Sinorhizobium medicae WSM419]
 gi|150030154|gb|ABR62271.1| protein of unknown function DUF218 [Sinorhizobium medicae WSM419]
          Length = 262

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 65/213 (30%), Gaps = 33/213 (15%)

Query: 3   YFWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLTGE-------------- 46
            F   +    +F   G  F+  +        P+   ++ ++VL G               
Sbjct: 42  VFGLAVLFITLFTTAGSYFLQILEDRFPRPSPEPAELACMIVLGGAFENVVMASRGGIEM 101

Query: 47  ---PIRIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGY 98
                R      L     G +I +SG   S+S                  +    +    
Sbjct: 102 NQAAERFVETLRLARAHPGARILVSGGDGSLSGIYEGDAHASAAFFGTFGIGPERLIREG 161

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---SH 155
           ++  T  NA+       +N      +VT  YHMPR+    +   + ++  P+P+    S 
Sbjct: 162 ESRTTFENARNTRHLLRENGLDRCALVTSAYHMPRSVGLFRA--NDIEVTPWPVDYRTSG 219

Query: 156 DLEENSSIFKIKILRVLLI----EYLKILLLSI 184
            +       +  +   L      E+  +L   +
Sbjct: 220 KVRLGVDFTQPSLNAQLATTAAKEWTGLLAYYL 252


>gi|28897807|ref|NP_797412.1| hypothetical protein VP1033 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838515|ref|ZP_01991182.1| integral membrane protein [Vibrio parahaemolyticus AQ3810]
 gi|260876969|ref|ZP_05889324.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260898706|ref|ZP_05907202.1| conserved inner membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|260900663|ref|ZP_05909058.1| conserved inner membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|28806020|dbj|BAC59296.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748082|gb|EDM58941.1| integral membrane protein [Vibrio parahaemolyticus AQ3810]
 gi|308089504|gb|EFO39199.1| conserved inner membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308093685|gb|EFO43380.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308106719|gb|EFO44259.1| conserved inner membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|328473218|gb|EGF44066.1| hypothetical protein VP10329_21110 [Vibrio parahaemolyticus 10329]
          Length = 261

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 60/154 (38%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYDGGSEISHARMMANVALALGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE--NSSIF 164
           A++A+A+ ++     +++VT   HM R   E       ++ IP P     ++E       
Sbjct: 168 ARQAAAFVQQKE---IVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAIDEVSQPWDK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  +   ++ ++    
Sbjct: 223 YSPKARYLEQTELFWHEYLGSVWQRLRDTVGQTP 256


>gi|282896704|ref|ZP_06304712.1| hypothetical protein CRD_01413 [Raphidiopsis brookii D9]
 gi|281198422|gb|EFA73310.1| hypothetical protein CRD_01413 [Raphidiopsis brookii D9]
          Length = 263

 Score = 68.0 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 50/221 (22%), Positives = 73/221 (33%), Gaps = 43/221 (19%)

Query: 9   FVCLIFFIMGFISFIR----YVKQMHIPDHPSVSAIVVLTG----------------EPI 48
              L+    G++S         + +     P   AIVVL G                   
Sbjct: 45  LAILMIAGNGWVSKALVGSLEWQNIPPGKIPEAEAIVVLGGATKPAAWPRSTVDLNESGD 104

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDIL--LQKIPIRQDLAECCIDIGYKALNT 103
           R+  A +L   +    I +SG               +  I I   +    I     +LNT
Sbjct: 105 RVIYAAQLYGQKKAPLIILSGGRIDWRGSGPPESADMAAILISLGIPPEVIIEEPNSLNT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEE 159
             NA       E      VL+VT   H PR+    QR    V+ IP P    +   DLEE
Sbjct: 165 YENAVNVRKILESRGIKKVLLVTSAMHTPRSLKIFQR--QGVEVIPAPTDFIVSRSDLEE 222

Query: 160 NSSIFKIKILRV------------LLIEYLKILLLSIQLSL 188
             +  K  IL +             L EY+  L+ +++  L
Sbjct: 223 LIATPKSTILNLFPSADNLNDFTNALKEYIGYLVYALRGWL 263


>gi|225025892|ref|ZP_03715084.1| hypothetical protein EUBHAL_00120 [Eubacterium hallii DSM 3353]
 gi|224956789|gb|EEG37998.1| hypothetical protein EUBHAL_00120 [Eubacterium hallii DSM 3353]
          Length = 213

 Score = 68.0 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/180 (15%), Positives = 65/180 (36%), Gaps = 30/180 (16%)

Query: 36  SVSAIVVLTGEPIR---IERAFELLENQIGEKIFISGVHHSVS----------------- 75
              AI +      R    E A  L ++     +  SG +  V                  
Sbjct: 34  KADAIFIP--GCARPEHTEEAARLYKDGYAPLLLPSGGYTKVQGSFQGVSKEGQKYGADF 91

Query: 76  --KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH--HVLIVTHDYHM 131
             +   L+ + I+  +    I    +A  T  NA++     EK + H    ++    +H 
Sbjct: 92  ACEADFLEAVLIQNGVPASAILKECEATYTLENAEKTKVLLEKKDIHLKKAILCCKAHHS 151

Query: 132 PRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK----ILLLSIQLS 187
            R++L    +   ++ + YP++   +         +  +V+L E+ +    +L++  +++
Sbjct: 152 RRSYLYYSMVFPEIEILVYPVVVDGISREDWYKTAEGRKVVLGEFSRMGQQLLMMEGRIA 211


>gi|13470862|ref|NP_102431.1| hypothetical protein mll0674 [Mesorhizobium loti MAFF303099]
 gi|14021605|dbj|BAB48217.1| mll0674 [Mesorhizobium loti MAFF303099]
          Length = 265

 Score = 68.0 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 65/195 (33%), Gaps = 37/195 (18%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRIERAFELLENQI-----GEKIF---------------IS 68
              P    V  IVVL G     E A  L          G+++                +S
Sbjct: 70  PRPPLPQKVDGIVVLGGGF---EGAINLARGGYELSSSGDRMVETAILARRFPLAKVVVS 126

Query: 69  GVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           G H      +        ++ +   ++   + +  K+ NT  NA  +    E       L
Sbjct: 127 GGHGAFFIDAEGDADSASRMLVPLGVSADRLVLEDKSRNTYENAIFSRKLVEPKPGETWL 186

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISH-------DLEENSSIFKIKILRVLLIEY 176
           +VT  +HMPR      +       +P+P+  H        L  +++I  ++   + L E+
Sbjct: 187 LVTSAFHMPRAKALFDKA--GFPTVPWPVDYHTSGKEGVGLFRDNAIDSVQNTTIALREW 244

Query: 177 LKILLLSIQLSLSTQ 191
           + +    +   +   
Sbjct: 245 IGLFAYWLSGRIDQP 259


>gi|163802067|ref|ZP_02195963.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sp. AND4]
 gi|159174208|gb|EDP59016.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sp. AND4]
          Length = 268

 Score = 68.0 bits (165), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 62/154 (40%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLEDAEDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE--ENSSIF 164
           A++A+A+ ++ +   +++VT   HM R   E       ++ IP P     ++  E S   
Sbjct: 168 ARQAAAFVKQKD---IVLVTSASHMKRALYEFHAA--GIKPIPAPTNFMAIDEIEQSWQK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        E+L  L   ++ ++    
Sbjct: 223 YAPKARYLEQTELYWYEFLGGLWQKLRDNVGQTP 256


>gi|308125795|ref|ZP_07663526.1| conserved inner membrane protein [Vibrio parahaemolyticus K5030]
 gi|308113292|gb|EFO50832.1| conserved inner membrane protein [Vibrio parahaemolyticus K5030]
          Length = 187

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 60/154 (38%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 34  RLTEGIRILRMYPGAKLILSGYDGGSEISHARMMANVALALGVAKSDIILLEDAKDTWEE 93

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE--NSSIF 164
           A++A+A+ ++     +++VT   HM R   E       ++ IP P     ++E       
Sbjct: 94  ARQAAAFVQQKE---IVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAIDEVSQPWDK 148

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  +   ++ ++    
Sbjct: 149 YSPKARYLEQTELFWHEYLGSVWQRLRDTVGQTP 182


>gi|292670312|ref|ZP_06603738.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292648043|gb|EFF66015.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 252

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 55/145 (37%), Gaps = 22/145 (15%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP---IRIERAFELLENQIGEKIF--------------ISG 69
           +   +P HP    IV+L G     +R      +L      ++               +SG
Sbjct: 67  RTYEVPVHPQGDIIVMLGGGAIADVRDVDGTGMLAQSPSSRLLAVLRLHRRYHLPILLSG 126

Query: 70  --VHHSV-SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
             V     S+  + +++     +    I +   +  T  NA+ ++    +  F H ++VT
Sbjct: 127 GQVFSDTGSEAEIARRVLRSLGVPSEMIYVETHSRTTGQNARYSAEILRREGFAHPILVT 186

Query: 127 HDYHMPRTFLELQRINSTVQFIPYP 151
             +H+PR  L  ++    V   PYP
Sbjct: 187 SAFHLPRAVLNFEK--EGVAVTPYP 209


>gi|295695151|ref|YP_003588389.1| protein of unknown function DUF218 [Bacillus tusciae DSM 2912]
 gi|295410753|gb|ADG05245.1| protein of unknown function DUF218 [Bacillus tusciae DSM 2912]
          Length = 188

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/136 (15%), Positives = 49/136 (36%), Gaps = 6/136 (4%)

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNT 103
             R+E   +L       +I +SG        S+  ++      + +    + +   + +T
Sbjct: 49  RARLEAGLDLYRRGYAPRILVSGGQRRPGAPSEADVMADYLRVRGVPPRALIVEDLSSDT 108

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             N   +S   + + +   ++VT  YH+PR     +          Y   S D+   + +
Sbjct: 109 VENLLFSSRLMKIHGWRRAVVVTSAYHLPRALWLARLAGLDAS--GYAPASADV-LGTWM 165

Query: 164 FKIKILRVLLIEYLKI 179
           + ++ +      Y K 
Sbjct: 166 YALREIPAFWRSYQKW 181


>gi|148657753|ref|YP_001277958.1| hypothetical protein RoseRS_3653 [Roseiflexus sp. RS-1]
 gi|148569863|gb|ABQ92008.1| protein of unknown function DUF218 [Roseiflexus sp. RS-1]
          Length = 191

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 64/192 (33%), Gaps = 13/192 (6%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEKI 65
            L +  +    G+                   AIVVL G  P+R + A +L       +I
Sbjct: 2   LLTIAALTVSAGWWLPALGGLLALEGRPAHADAIVVLGGGFPLRDQHAIDLYREGWAREI 61

Query: 66  FISGVHHS-----VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           + +G              L  +  + +        +     +T  + +E +  A++ +  
Sbjct: 62  WRTGDLPGGSVVLQKARRLALQQGVPETAF-----VPVATDSTWADGREIARMAQERHAQ 116

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPY--PIISHDLEENSSIFKIKILRVLLIEYLK 178
            +LIVT   H  R    + R  +    + +           ++     +  R++  E LK
Sbjct: 117 RLLIVTEWPHSRRAMCVINRHLAGTGVVAFYDGPRHPPYTPSNWWRDPEGRRIVSGEMLK 176

Query: 179 ILLLSIQLSLST 190
            +   ++  ++ 
Sbjct: 177 TIYYLLRFGVTP 188


>gi|83720198|ref|YP_443090.1| hypothetical protein BTH_I2573 [Burkholderia thailandensis E264]
 gi|83654023|gb|ABC38086.1| Uncharacterized ACR, COG1434 family [Burkholderia thailandensis
           E264]
          Length = 301

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 52/134 (38%), Gaps = 12/134 (8%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +     + 
Sbjct: 152 RIDKTAELYSACQRTAKRCTVVVSGGDPQVRGITEADTYAPYLLARGVANADLIRESSSH 211

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R       +P P+ ++  +   
Sbjct: 212 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFRRFG----IVPQPVYANRRDARL 267

Query: 162 SIFKIKILRVLLIE 175
                + + ++  E
Sbjct: 268 GWL-PRAVNLVNAE 280


>gi|91228201|ref|ZP_01262183.1| hypothetical protein V12G01_20638 [Vibrio alginolyticus 12G01]
 gi|91188190|gb|EAS74491.1| hypothetical protein V12G01_20638 [Vibrio alginolyticus 12G01]
          Length = 261

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 59/154 (38%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALALGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE--NSSIF 164
           A++A+A+ ++     +++VT   HM R   E       ++ IP P     + E       
Sbjct: 168 ARQAAAFVQQKE---IVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAIREISQPWDK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  +   ++ ++    
Sbjct: 223 YSPKARYLEQTELYWHEYLGSIWQRLRDTVGQTP 256


>gi|262197868|ref|YP_003269077.1| hypothetical protein Hoch_4693 [Haliangium ochraceum DSM 14365]
 gi|262081215|gb|ACY17184.1| protein of unknown function DUF218 [Haliangium ochraceum DSM 14365]
          Length = 247

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 62/207 (29%), Gaps = 29/207 (14%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPI-------------- 48
           W  L++     + G +              + P   AIV+L+                  
Sbjct: 42  WLFLWLASTPLVAGMLLVSLQTAPALPVVGELPPAQAIVILSAGQDLDAPEYGRAMPDND 101

Query: 49  ---RIERAFELLENQIGEKIFISGVHHSVSKDILLQKI--PIRQDLAECCIDIGYKALNT 103
              RI     L +++    I ++G   +     + Q +   +   L         +A+NT
Sbjct: 102 TLTRIAYGAHL-QHRTALPILVTGGAATPGSAAVAQVMLHTLESQLGARVRWTDERAMNT 160

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS- 162
             NA+ A+A         + +VTH +HMPR     +     V   P            S 
Sbjct: 161 HENARNAAAILSAEGIERIYLVTHAWHMPRALRSFEAEGLDVVPAPTGFRDRPWRGPRSL 220

Query: 163 ---IFKIKILRVLLIEYLK---ILLLS 183
                 I+       E++     L   
Sbjct: 221 IPRWSAIRDTYRAAHEWVGRLYYLAAY 247


>gi|304436974|ref|ZP_07396937.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369925|gb|EFM23587.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 252

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 56/147 (38%), Gaps = 26/147 (17%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRIER-----AFELLENQIGEKIF--------------I 67
           +   +P+ P    I++L G    I          +L      ++               +
Sbjct: 67  RTYPVPEAPQGDVIIMLGGGA--IADVQDVDGTGMLAQSPSSRLLAVYRLHLRTHLPILL 124

Query: 68  SG--VHHSV-SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG  V     S+  + +++     + +  I +  ++L T  NA+  +    +  F H ++
Sbjct: 125 SGGQVFSDTGSEAEIARRVLRSLGVPDDMIYVETRSLTTGQNARYTAEILRREGFVHPIL 184

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYP 151
           VT  +H+PR  L  ++    +   PYP
Sbjct: 185 VTSAFHLPRAVLNFEK--QGITVTPYP 209


>gi|285017167|ref|YP_003374878.1| hypothetical protein XALc_0349 [Xanthomonas albilineans GPE PC73]
 gi|283472385|emb|CBA14890.1| hypothetical protein XALc_0349 [Xanthomonas albilineans]
          Length = 204

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/113 (17%), Positives = 38/113 (33%), Gaps = 13/113 (11%)

Query: 36  SVSAIVVLTGEP----------IRIERAFELLENQIGEKIFISGV---HHSVSKDILLQK 82
              AI+VL               RI  A +L        +  +G        ++  + ++
Sbjct: 46  PADAIIVLGAAAYDAKPSPVFEERIRHALDLYRRGYAPTLIFTGGFGNGARFAEAQVARR 105

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
             +RQ +    + I   +  T  N  +A      +    V++V+   HM R  
Sbjct: 106 YALRQGVPADAVLIETISRTTRQNLIQARQIMRAHGLRRVIVVSDPLHMARAL 158


>gi|157364443|ref|YP_001471210.1| hypothetical protein Tlet_1592 [Thermotoga lettingae TMO]
 gi|157315047|gb|ABV34146.1| protein of unknown function DUF218 [Thermotoga lettingae TMO]
          Length = 245

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 57/168 (33%), Gaps = 20/168 (11%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTGEPIRIERA----- 53
             F   L +C  FF  G  +    +      +      + A+VVL G  ++         
Sbjct: 37  AIFMIFLALCFYFFSSGLGALTLVLPLERSYEISIPKKIDAVVVLGGGIVKTPNGYQPSQ 96

Query: 54  ---FELLENQIGEK-----IFISGVH----HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
                LLE     K     + ISG      +   + ++++ + I        I I   A 
Sbjct: 97  SSIVRLLEGVRIAKDFDSFLIISGGMLPLLNQPPEAVVMRDLAISLGFPAEAIIIEPDAK 156

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            T  NA   S    +  F +V++VT   HM R      +   TV   P
Sbjct: 157 TTFENAIFTSQICREKGFQNVVVVTSAIHMKRAIYSFSKARFTVHPCP 204


>gi|119502798|ref|ZP_01624883.1| hypothetical protein MGP2080_05817 [marine gamma proteobacterium
           HTCC2080]
 gi|119461144|gb|EAW42234.1| hypothetical protein MGP2080_05817 [marine gamma proteobacterium
           HTCC2080]
          Length = 236

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 54/177 (30%), Gaps = 24/177 (13%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPI----------------RIERAFELLENQIGEKIFISGV 70
                 + P+  AIV+L G                   R+  A EL        I ISG 
Sbjct: 51  PAFSPEELPAAQAIVLLGGASNGAARFGRGADLNDAADRVMFAAELYFAGKAPIILISGG 110

Query: 71  HHSV--SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
                  +  LL +      +    + +  ++  T  NA  A    +     H+L+VT  
Sbjct: 111 APETMQPEAELLAQQLQALQIPRKQLLLETQSRTTFDNAVMAGEMLKNAGLQHILLVTSG 170

Query: 129 YHMPRTFLELQRINSTVQFIPY----PIISHDLEENSSIFKIKILR--VLLIEYLKI 179
            HM R+    +R    V         P  S            ++ R    + E++  
Sbjct: 171 AHMRRSLALFERQGLQVTAAATDHQIPKFSDPYIPGWIPTYARLARSSRAIHEWVGY 227


>gi|51891778|ref|YP_074469.1| hypothetical protein STH640 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855467|dbj|BAD39625.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 187

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 60/156 (38%), Gaps = 11/156 (7%)

Query: 33  DHPSVSAIVVLTGEP--IRIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQ 87
           +      I+V  G     R ERA EL +  +  K+FI+G       V +   L+   +  
Sbjct: 23  EPTPGDLILVF-GGKRLERAERAAELYKAGLAPKVFITGGDKRGIGVCEAERLRDHMVEL 81

Query: 88  DLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRTFLELQ-RIN 142
            +    IDI  + LNT    Q +    E+     N  +VL+V+  +HM R    +   I 
Sbjct: 82  SVPAEAIDIECEGLNTIEQVQYSVKRIEETIGWKNIKNVLLVSAPHHMRRVKRTIANYIP 141

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
              +    P    D+  ++        +++  E  K
Sbjct: 142 RETKITCCPDRRTDITRDNWWHTDDGQKLVYRELEK 177


>gi|188587339|ref|YP_001918884.1| protein of unknown function DUF218 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179352026|gb|ACB86296.1| protein of unknown function DUF218 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 230

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 73/203 (35%), Gaps = 35/203 (17%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGE-PIRIERAFELLENQIGE 63
            + +  IF+     +  +++      +        I+VL G  P RI    EL ++   E
Sbjct: 27  AILILTIFWDNLLTAIGKFLVAEEPLER---DGSYILVLQGGIPDRIAHGVELHQDNYAE 83

Query: 64  KIFISGVHHSV---------------SKDILLQKIPIRQDLAECCIDI-GYKALNTEGNA 107
            I +  V                   S   + ++  ++  + +  I+I   K  +T+  A
Sbjct: 84  NILM--VESKSFTNYELMEQKQLDLPSSAEINKQAAMQMGIDDDQINIIPGKVDSTQQEA 141

Query: 108 QEASAWAEKNNFHH-----VLIVTHDYHMPRTFLEL-----QRINSTVQFIPYPIISHDL 157
            + + +   N +H      V++VT  YH  R  L L     +   + +  +  P      
Sbjct: 142 GKVAQYLSSN-YHSEEDLKVILVTSRYHSKRAKLILQTELKEHDLTNIDIVSSPSHYDPY 200

Query: 158 EENSSIFKIKILRVLLIEYLKIL 180
             +      +  R   +EYLK++
Sbjct: 201 YPDEWWKNRRQARNTFMEYLKLI 223


>gi|329118151|ref|ZP_08246863.1| protein of hypothetical function DUF218 [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327465811|gb|EGF12084.1| protein of hypothetical function DUF218 [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 222

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 65/190 (34%), Gaps = 16/190 (8%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV---SAIVVLTGEP----------IRI 50
            W G  + +   ++ F+     V +      P      A VVL               RI
Sbjct: 18  LWRGFAISVALVLLFFVWCAWSVYRTGRDGLPQGYTGDAAVVLGAAAWDARPSPVFRERI 77

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L  +    K+  +G       +S+  + ++  ++Q +    I +  K+  T  N 
Sbjct: 78  NHAVGLYRSGRVRKLVFTGGAVKKGYMSEGEVGRRYALKQGVPAEDILLENKSRTTYENL 137

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
               A   +     ++IV+   H+ R     + +    Q  P P   +    +   F+++
Sbjct: 138 AYLRAPLREAGLRKIVIVSDPPHLARAAAVARDLGLDAQVSPTPTTRYAEGGSRFKFQLR 197

Query: 168 ILRVLLIEYL 177
              +L   YL
Sbjct: 198 ETVLLAGYYL 207


>gi|239832066|ref|ZP_04680395.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824333|gb|EEQ95901.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 279

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 56/179 (31%), Gaps = 28/179 (15%)

Query: 1   MRYFWYGLFVCLIFFI--MGFISFIRYVKQMHIPD--HPSVSAIVVLTG----------- 45
           M      L    +     +G +       +   PD     V  IVVL G           
Sbjct: 54  MGLLALSLATLFLAAFTTLGAVLLAPLEDRFAKPDAMPQRVDGIVVLGGYMNGEINAGRK 113

Query: 46  ------EPIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCI 94
                    RI  A  L       K+ +SG        S  +    +++      +    
Sbjct: 114 GFELNSAADRIFEAMRLARLYPDAKVIVSGGEGAFFEKSAKEADSTRQMLADLGFSGERY 173

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
               K+ NT  NA  +   A+       L+VT  YHMPR+    ++    V  + +P+ 
Sbjct: 174 IFENKSRNTVENAVFSKELAQPKPGETWLLVTSAYHMPRSIGCFRKAGFDV--VAWPVD 230


>gi|159027601|emb|CAO86973.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 206

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 52/154 (33%), Gaps = 10/154 (6%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
            + +   + G       ++Q  +       AI VL G   R   A +L +      I++S
Sbjct: 22  LLAIPLILAGLGWLYLDLRQQWLKPE----AIFVLGGHADRERFAAKLAKEYPDLPIWVS 77

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
                     + +K  I  +       + Y A +T  N    +   +      V +VT D
Sbjct: 78  SGSPRRYVQKIFKKAGIPPERLH----LDYNARDTVTNFTSLADQLKAQGIDSVYLVTSD 133

Query: 129 YHMPRTFL--ELQRINSTVQFIPYPIISHDLEEN 160
            HM R  L  E+   +  +   P  + S    E 
Sbjct: 134 NHMRRARLVGEIIFGSRGIVIKPVTVPSQSPPEP 167


>gi|188582432|ref|YP_001925877.1| hypothetical protein Mpop_3190 [Methylobacterium populi BJ001]
 gi|179345930|gb|ACB81342.1| protein of unknown function DUF218 [Methylobacterium populi BJ001]
          Length = 278

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/180 (18%), Positives = 62/180 (34%), Gaps = 41/180 (22%)

Query: 5   WYGLFVC----LIFFIMG-----FISFIRYVKQMHIPDHPSVSAIVVLTG--------EP 47
           + GL       L  +++G     F +F          D   V+ IVVL G          
Sbjct: 60  FLGLLAAGLSPLSAWVLGPLENRFPAFAD--------DERPVAGIVVLGGAVEADTSIGR 111

Query: 48  IRI---ERA------FELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECC 93
            +I   +         +L       ++  SG        +VS+  ++ +      +    
Sbjct: 112 NQITVNDAGEREIALADLARRFPQARLVFSGGAGSLREDAVSEAEIVSRYADTLGVPRNR 171

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
           + +  ++ NT  NA  ++   +       L+VT  +HMPR     +R    V    YP+ 
Sbjct: 172 LILEQQSRNTHENAVFSARMVQPKPGERWLLVTSAWHMPRAVGCFRRAGFDVT--AYPVD 229


>gi|226311001|ref|YP_002770895.1| hypothetical protein BBR47_14140 [Brevibacillus brevis NBRC 100599]
 gi|226093949|dbj|BAH42391.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 213

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 51/111 (45%), Gaps = 7/111 (6%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           G   R+E+A  L +     K+ ++G      ++++  + +   + + + E  I +  K+ 
Sbjct: 68  GLRERLEQAAILYKEGYVSKLLVTGGLGEGKTITEAAVSRNYLVAKGIPEEDILLESKST 127

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
           +T  N        E+++    LI++HDYH+ R  +    +  ++  +  P+
Sbjct: 128 STYENLLYGQQVLEEHHIQDALIISHDYHLARAMV----MADSLGIVASPV 174


>gi|195953339|ref|YP_002121629.1| protein of unknown function DUF218 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932951|gb|ACG57651.1| protein of unknown function DUF218 [Hydrogenobaculum sp. Y04AAS1]
          Length = 244

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 38/176 (21%), Positives = 62/176 (35%), Gaps = 24/176 (13%)

Query: 29  MHIPDHPSVSAIVVLTGEP-----------IRIERAFELLENQIGEKIFISGVHHSVSKD 77
                  + +AIVVL G              R+     L        + +SG+       
Sbjct: 68  SQPKGFLNANAIVVLGGGYYKNGNLSGETVKRLLAGVYLSYKTKIP-LILSGIDIKYLPK 126

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN---NFHHVLIVTHDYHMPRT 134
                + +   +    I    K+ +T  NA ++     +    + + +++VT  YHMPR 
Sbjct: 127 N-TPIVKLINAIDIGNIYEDVKSKDTMQNAAQSYKVCTRYITPDCNSIILVTSAYHMPRA 185

Query: 135 FLELQRINSTVQFIPYPII-SHDLEENSSIFKIKILRV-----LLIEYLKILLLSI 184
            +   R    V  IPYP+    DL  N   F   +  +      + EYL IL   I
Sbjct: 186 KMLFDRFFKNV--IPYPVDYKEDLRYNVRSFLPNMSDLENSTKAIREYLGILYYFI 239


>gi|89092000|ref|ZP_01164955.1| hypothetical protein MED92_07531 [Oceanospirillum sp. MED92]
 gi|89083735|gb|EAR62952.1| hypothetical protein MED92_07531 [Oceanospirillum sp. MED92]
          Length = 272

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 50/149 (33%), Gaps = 28/149 (18%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKA 100
           V+ TG    I R                          + Q     Q LA   I I   +
Sbjct: 126 VIYTGGSGSIFR-------------------PGYRGADVAQNWLSEQGLAGRLI-IERDS 165

Query: 101 LNTEGNAQEASAWAEKNNFHH---VLIVTHDYHMPRTFLELQRINSTVQFIPYPI---IS 154
            NT  NA        +         L++T  +HMPR+    ++    +  +PYP+   ++
Sbjct: 166 RNTYQNALYTRELINELGADSQGSWLLITSAFHMPRSVGVFRKA--GIDVVPYPVDYRVA 223

Query: 155 HDLEENSSIFKIKILRVLLIEYLKILLLS 183
            +    S    +  L + + E++ +L   
Sbjct: 224 ENRWRPSLNRNMADLNLAVREWIGLLAYY 252


>gi|241760602|ref|ZP_04758694.1| periplasmic protein [Neisseria flavescens SK114]
 gi|241318783|gb|EER55309.1| periplasmic protein [Neisseria flavescens SK114]
          Length = 218

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 53/149 (35%), Gaps = 18/149 (12%)

Query: 3   YFWYGLFVCLIFFIMGFI---SFIRYVKQMHIPDHPSVSAIVVLTGEP-----------I 48
           Y + GL + ++     F+     I       +P      A VVL G              
Sbjct: 14  YLFRGLALSVLLVCGIFLAGTWQIYRTGLQTLPKDAHADAAVVL-GAAAWDKRPSPVFRE 72

Query: 49  RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT  
Sbjct: 73  RINHAITLYQSHRVGKIIFTGSTSKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNTYE 132

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           N +        N    +++V+  YH+ R 
Sbjct: 133 NLRNIIPIMHANGVGSIIVVSDPYHLARA 161


>gi|242279972|ref|YP_002992101.1| hypothetical protein Desal_2506 [Desulfovibrio salexigens DSM 2638]
 gi|242122866|gb|ACS80562.1| protein of unknown function DUF218 [Desulfovibrio salexigens DSM
           2638]
          Length = 214

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 65/211 (30%), Gaps = 29/211 (13%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
            G            + F   V      +     AIVVL G   R   A +L       +I
Sbjct: 11  IGALTVAGILAAAVLFFFAPVLLQQEDELEKADAIVVLGGHYYRPLYAADLYNKGYAPRI 70

Query: 66  FISGVHHSVSKD---------------ILLQKIPIRQDLAECCID-IGYKALNTEGNAQE 109
             S     ++ +                + + + +++D+    I+  G   ++T   A++
Sbjct: 71  LAS--KPVITPEIEAVRDLDIHFPYQWEVFRDVLLKKDVPAERIEFFGKANISTLDEAEK 128

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRT-FLELQRINSTVQFI----PYPIISHDLEENSSIF 164
                       +++VT   H  R   +  + +   V+ I    PY +            
Sbjct: 129 LRDKLTPQ-IKSIILVTSPMHTRRAGIIFREILPPNVKIIVVGTPYEVTP-----ERWWT 182

Query: 165 KIKILRVLLIEYLKILLLSIQLSLSTQTASQ 195
             +    +++E  K L      +  +  ++ 
Sbjct: 183 NFRAAPFVVLEVAKTLYYEFGGAFRSSESTT 213


>gi|92117952|ref|YP_577681.1| hypothetical protein Nham_2431 [Nitrobacter hamburgensis X14]
 gi|91800846|gb|ABE63221.1| protein of unknown function DUF218 [Nitrobacter hamburgensis X14]
          Length = 267

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 58/184 (31%), Gaps = 37/184 (20%)

Query: 33  DHPSVSAIVVL-----------------TGEPIRIERAFELLENQIGEKIFISG-----V 70
           D      I++L                  G   RI    EL       ++  SG     +
Sbjct: 75  DGREPDGIIILGGAIEPELSAARKAVEVNGAAERIIGGLELARRFPRARVVYSGGSANLI 134

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
              VS+  +  ++     ++   I +  ++  T+ NA+              L+VT  YH
Sbjct: 135 ADPVSEAPIAGRLLETFGISPERIVLESESRTTDENARFTRKLVSPKPGERWLLVTSAYH 194

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL----------LIEYLKIL 180
           MPR+    ++    V+   YP+   D      I        L          + E+  +L
Sbjct: 195 MPRSIGVFRKAGLDVE--AYPV---DWRTRGWIDAWTPFDRLSAGLARADTAVHEWCGLL 249

Query: 181 LLSI 184
              +
Sbjct: 250 AYRL 253


>gi|148380856|ref|YP_001255397.1| hypothetical protein CBO2900 [Clostridium botulinum A str. ATCC
           3502]
 gi|153931082|ref|YP_001385163.1| hypothetical protein CLB_2864 [Clostridium botulinum A str. ATCC
           19397]
 gi|153935289|ref|YP_001388632.1| hypothetical protein CLC_2797 [Clostridium botulinum A str. Hall]
 gi|148290340|emb|CAL84464.1| putative exported protein [Clostridium botulinum A str. ATCC 3502]
 gi|152927126|gb|ABS32626.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           19397]
 gi|152931203|gb|ABS36702.1| conserved hypothetical protein [Clostridium botulinum A str. Hall]
          Length = 197

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 5/135 (3%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++    L  +  G+ I +SG      ++S+   +QK  +++ L +  I    K+ NT  
Sbjct: 65  RLDEGLRLYNDGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIIPEDKSRNTLE 124

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +    E NN    +IV++ YH+ R   EL      ++     +       +  +  
Sbjct: 125 NIKFSKKKMEDNNLSSSIIVSNKYHLKRA--ELLCQKEGIKASYSGVFVRSHMSHEIMGF 182

Query: 166 IKILRVLLIEYLKIL 180
           ++ +  LL+ Y+K +
Sbjct: 183 LREIPALLVYYIKTM 197


>gi|254455840|ref|ZP_05069269.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082842|gb|EDZ60268.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 228

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 61/157 (38%), Gaps = 25/157 (15%)

Query: 19  FISFIRYVKQMHIPDH-PSVSAIVVLTG-----------------EPIRIERAFELLENQ 60
            ++++    Q+  P +     +IVVL+G                    RI     L + +
Sbjct: 35  LVAYLESDYQLSKPSNIEPADSIVVLSGMIRTINSKDGLDYEFGEASDRIFAGINLFKEK 94

Query: 61  IGEKIFIS-GVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
              K+ ++ G       + +   L++I I   ++E  I +     NT+  A+       +
Sbjct: 95  KAPKLILTRGKLPWSVGIPEGEYLKEIAINNGISENNILLTENVENTDQEAKAIKKLLSE 154

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
           +    VL+VT  +HMPR     +     +  +P+P+ 
Sbjct: 155 DK-SKVLLVTSAFHMPRAQKVFEAA--GINVVPFPVD 188


>gi|33865854|ref|NP_897413.1| hypothetical protein SYNW1320 [Synechococcus sp. WH 8102]
 gi|33633024|emb|CAE07835.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 250

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 58/198 (29%), Gaps = 33/198 (16%)

Query: 2   RYFWYGLFVCLIFFIMG--------FISFIRYVKQMHIPDHPSVSAIVVLTGEPI----- 48
           R  W  +    + +I          +       ++  +   P   AIVVL+G        
Sbjct: 30  RRHWPVVAAMSLLWIFSTGVVSQLLWRWVEHPYQRRSVERAPLADAIVVLSGGRHPAPGP 89

Query: 49  ----------RIERAFELLENQIGEKIFISGV----HHSVSKD-ILLQKIPIRQDLAECC 93
                     R      L ++    ++  +      H  +  +  L +   +   +    
Sbjct: 90  AQISEWHDPDRFLAGVALFQSGRASRLLFTRGQNPFHPGLPPEGELYRAEAVDLGVPATS 149

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
           I +  +  NT   A          +   VL+VT  +HM R  +  +R    +  +PYP+ 
Sbjct: 150 IGLTDRVTNTAQEANAIRRLL-PQDQPRVLLVTSAFHMRRAQVLFER--QGLTVLPYPVD 206

Query: 154 --SHDLEENSSIFKIKIL 169
             +               
Sbjct: 207 FQARAAWAGFIWRDPLQW 224


>gi|323525715|ref|YP_004227868.1| hypothetical protein BC1001_1372 [Burkholderia sp. CCGE1001]
 gi|323382717|gb|ADX54808.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1001]
          Length = 239

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 68/199 (34%), Gaps = 38/199 (19%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVS--------AIVVLTGEP--------------- 47
             +F+++        +  +  P   + +        AI++L G                 
Sbjct: 29  VALFWLLSTGWLTAPLLSLAQPQAETSAPTRFAPRTAIILLGGGTVYNRDKVLVPPREVM 88

Query: 48  IRIERAFELLENQIGEK----IFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKA 100
            RI  + E             + +SG +      ++        +R+ +    I +  ++
Sbjct: 89  ARIAVSAENYAACKRSATVCSVIVSGGNPQRHPATEADTYLPYLLREQVPRSDIVLENRS 148

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
           L T  NA+  SA   ++ +  +++VT  YHMPR  L+ +         P P+IS     +
Sbjct: 149 LTTYENARNVSAIVGQSRYDSLILVTSAYHMPRALLDFRHFG----LEPQPLISGARRAH 204

Query: 161 ----SSIFKIKILRVLLIE 175
                    +    + L E
Sbjct: 205 LGLLPRYSNLANAELALHE 223


>gi|220935848|ref|YP_002514747.1| hypothetical protein Tgr7_2685 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997158|gb|ACL73760.1| conserved protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 251

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 45/223 (20%), Positives = 77/223 (34%), Gaps = 44/223 (19%)

Query: 2   RYFWYGLFVCLIFF--IMGFISFIRYVKQ-------MHIPDHPSVSAIVVLTGEPI---- 48
           R    GL    I +  +     F  ++         +  P   +  AIVVL G       
Sbjct: 27  RRLGKGLVFAGIAWLYVAATPLFAGWLLAGLERGYPVAPPLPEAAGAIVVLAGGRHPDAP 86

Query: 49  -------------RIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID 95
                        R+     L     G  + +SG    V  D    +  +  D+ E  + 
Sbjct: 87  EYGGETVSPHSLERLRYGARL-HRDTGLPLLVSGG--RVRGDEPAAEADLLADVLEGELG 143

Query: 96  I-----GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
           +       ++ NT  NA  ++    +    H L+V+H  HMPR     QR    +   P+
Sbjct: 144 VAVRWRETESRNTCENALFSAHLLAEAGIEHALLVSHALHMPRAVWCFQRT--ELAVTPF 201

Query: 151 PIIS-HDLEENSSIF----KIKILRV---LLIEYLKILLLSIQ 185
           P +   DL  +  I     + + L +    L EYL ++   ++
Sbjct: 202 PTLPMGDLSRHRGITVVLPQPRALWLTGQALHEYLGLVWYRVK 244


>gi|269967671|ref|ZP_06181721.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269827758|gb|EEZ82042.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 261

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 59/154 (38%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALALGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE--NSSIF 164
           A++A+A+ ++     +++VT   HM R   E       ++ IP P     + E       
Sbjct: 168 ARQAAAFVQQKE---IVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAISEISQPWDK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  +   ++ ++    
Sbjct: 223 YSPKARYLEQTELYWHEYLGSIWQRLRDTVGQTP 256


>gi|156740504|ref|YP_001430633.1| hypothetical protein Rcas_0485 [Roseiflexus castenholzii DSM 13941]
 gi|156231832|gb|ABU56615.1| protein of unknown function DUF218 [Roseiflexus castenholzii DSM
           13941]
          Length = 225

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 56/182 (30%), Gaps = 13/182 (7%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEKIFISGVHHS-- 73
            G+                   AIVVL G  P+R + A +L       +I+ +G      
Sbjct: 46  AGWWLPALGSLLALPGRTARADAIVVLGGGFPLRDQHAIDLYREGWAREIWRTGEMPGGS 105

Query: 74  ---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
                   L  +  +        I       +T  + +E +  A +     V+IVT   H
Sbjct: 106 AVVQKARRLAIQQGVPAAAFVPLIT-----DSTWTDGREIARMARERKVERVIIVTDWSH 160

Query: 131 MPRTFLELQR--INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
             R    ++     S ++       +            +  R++  E LK     ++  +
Sbjct: 161 SRRALCVIKHHLAGSGIEAFYDGPRNPPYTPFDWWHHPEGRRIVAGELLKTFYYLLRFGV 220

Query: 189 ST 190
           + 
Sbjct: 221 TP 222


>gi|254228980|ref|ZP_04922401.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262394709|ref|YP_003286563.1| membrane protein [Vibrio sp. Ex25]
 gi|151938448|gb|EDN57285.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262338303|gb|ACY52098.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. Ex25]
          Length = 261

 Score = 66.4 bits (161), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 59/154 (38%), Gaps = 15/154 (9%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALALGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE--NSSIF 164
           A++A+A+ ++     +++VT   HM R   E       ++ IP P     + E       
Sbjct: 168 ARQAAAFVQQKE---IVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAISEISQPWDK 222

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLSTQT 192
                R L        EYL  +   ++ ++    
Sbjct: 223 YSPKARYLEQTELYWHEYLGSIWQRLRDTVGQTP 256


>gi|15893643|ref|NP_346992.1| hypothetical protein CA_C0352 [Clostridium acetobutylicum ATCC 824]
 gi|15023198|gb|AAK78332.1|AE007549_12 Uncharacterized conserved membrane protein, SANA family
           [Clostridium acetobutylicum ATCC 824]
 gi|325507765|gb|ADZ19401.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 225

 Score = 66.0 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 47  PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
             R+ +A +L       KI  SG  V++   +  ++        +   C+    K+ NT 
Sbjct: 69  RERVIKAVKLFNKGYANKIICSGGGVYNKYIESDVMANFAKSLGIPNGCLIKEDKSRNTY 128

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
            N Q +    E  ++   ++VT  +H+ R+   L +
Sbjct: 129 QNIQNSIKIMENKHWSSAIVVTSPWHLRRSNYFLSK 164


>gi|170696469|ref|ZP_02887595.1| protein of unknown function DUF218 [Burkholderia graminis C4D1M]
 gi|170138622|gb|EDT06824.1| protein of unknown function DUF218 [Burkholderia graminis C4D1M]
          Length = 239

 Score = 66.0 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 66/204 (32%), Gaps = 38/204 (18%)

Query: 6   YGLFVCLIFFIMGFISFIR--------YVKQMHIPDHPSVSAIVVLTGE--PIR------ 49
                  IF+++                 +          +AIV+L G     R      
Sbjct: 24  LLFCTIAIFWLLSAGWLTAPLLSLAQPQAQTSTPARFAPRTAIVLLGGGTVYNRDKVLVP 83

Query: 50  ---IERAFELLENQIG--EK------IFISGVHH---SVSKDILLQKIPIRQDLAECCID 95
              +     +        ++      + +SG +    + ++        +R+ +    I 
Sbjct: 84  PREVLARIAVSAKNYAACKRSATVCSVIVSGGNPQRHAATEADTYLPYLLREQVPRSDIV 143

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +  ++L T  NA+  SA   ++ +  +++VT  YHMPR  L+ +         P P+IS 
Sbjct: 144 LENQSLTTYENARNVSAIVGQSRYDSLILVTSAYHMPRAMLDFRHFG----LEPQPLISS 199

Query: 156 DLEEN----SSIFKIKILRVLLIE 175
                         +    + L E
Sbjct: 200 ARRARLGVLPRYSNLANAEIALHE 223


>gi|70732742|ref|YP_262505.1| hypothetical protein PFL_5437 [Pseudomonas fluorescens Pf-5]
 gi|68347041|gb|AAY94647.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 253

 Score = 66.0 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/217 (14%), Positives = 67/217 (30%), Gaps = 47/217 (21%)

Query: 11  CLIFFIMGFI---------SFIRYVKQMHIPDHPS-------VSAIVVLTGEPIRIE--- 51
           C    + GF             R ++++                 IVVL     R +   
Sbjct: 38  CFALGLGGFWLMSLPVMVEWGARGLERLPPLPQSQWASLAEQADVIVVLGSGRERGDPAW 97

Query: 52  -----RAFELLENQIGEKI--------FISGV-HHSVSKDILLQKIPIRQDLAECCIDIG 97
                    L   +   ++          SG  H+          +  +  L +  + + 
Sbjct: 98  GSDQPTGVGLERERYASRLAKASGLPVLTSGGLHYGTPPTE--AALMAQSLLDDFGVTVR 155

Query: 98  YK---ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI-- 152
           ++   +  T  NAQ ++          V++VT  +HMPR+    +      + +P P+  
Sbjct: 156 WQEGRSRTTWENAQFSAEVLLPLGIKRVVVVTQAWHMPRSVWSFEHA--GFEVVPAPVGF 213

Query: 153 --ISHDLEENSSIFKIKILR---VLLIEYLKILLLSI 184
             + +       + + K +     LL E +  L   +
Sbjct: 214 LGVDNARPLGGWMPEFKSIWQSGQLLNEAVGQLGYRL 250


>gi|313677361|ref|YP_004055357.1| hypothetical protein Ftrac_3275 [Marivirga tractuosa DSM 4126]
 gi|312944059|gb|ADR23249.1| protein of unknown function DUF218 [Marivirga tractuosa DSM 4126]
          Length = 239

 Score = 66.0 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 43/215 (20%), Positives = 79/215 (36%), Gaps = 34/215 (15%)

Query: 2   RYFWYGLFVCLIFFIMGFI--SFIR----YVKQMHIPDHPSVSAIVVLTG---------- 45
           +Y     F   I F   F+   F++        +    +   +  V+LTG          
Sbjct: 23  KYLAILGFALFIIFTNDFLANWFLKAWQTEAANLESIKNQKFTYGVLLTGMTNTLKEPKD 82

Query: 46  ------EPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAE-----CCI 94
                    RI +A  L +  I + ++ISG   +  +  L +   I   L         +
Sbjct: 83  RVYFNQNADRILQAIMLHQQGIIDTLYISGGGATALRKDLQEARVISNYLESIQFPMDKV 142

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  ++ NT  +A+ ASA+        +L++T   HMPR     ++ +  VQ  P   ++
Sbjct: 143 ILEDQSRNTVESARFASAYISSQ--TEILLITSASHMPRALGCFKKEDFRVQPYPTVFLT 200

Query: 155 HDLEENSSIFKIKI-----LRVLLIEYLKILLLSI 184
           +D   N S+F           +L  E++      I
Sbjct: 201 NDEMINPSMFLPSDDALLKWNILFKEWMGYSAYWI 235


>gi|255019747|ref|ZP_05291824.1| hypothetical protein ACA_2404 [Acidithiobacillus caldus ATCC 51756]
 gi|254970815|gb|EET28300.1| hypothetical protein ACA_2404 [Acidithiobacillus caldus ATCC 51756]
          Length = 267

 Score = 65.7 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 61/174 (35%), Gaps = 32/174 (18%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIP---DHPSVSAIVVLTGEP------------ 47
               G+ + L    +G    +  ++  + P     P V AIVVL G              
Sbjct: 44  LLAAGVGLYLSATGVGARWLVLPLENRYPPLLHPQPGVGAIVVLGGGEVARPPGDGGDMA 103

Query: 48  -----IRIERAFELLENQIGEKIFISGVHHS-------VSKDILLQKIPIRQDLAECCID 95
                +R+E A +L   Q    I  SG            +   LL++     +     I 
Sbjct: 104 NARTLMRLEAAAKL-AKQSALPIVTSGGAPRFGAPPEATTMARLLRESFAVHNP----IW 158

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           I  ++ NT  NA ++S    +   H V +VT   HMPR     +R       +P
Sbjct: 159 IEGRSFNTAANAFDSSKLLAQKGIHRVYLVTSALHMPRAMAWFRRAGLDPVPVP 212


>gi|110597465|ref|ZP_01385752.1| Protein of unknown function DUF218 [Chlorobium ferrooxidans DSM
           13031]
 gi|110341009|gb|EAT59480.1| Protein of unknown function DUF218 [Chlorobium ferrooxidans DSM
           13031]
          Length = 196

 Score = 65.7 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 70/191 (36%), Gaps = 16/191 (8%)

Query: 4   FWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLE 58
            +  L VC     IF  +GF+        ++  +      I+VL G+   R+ +  EL  
Sbjct: 9   LFALLSVCGAASAIFLTLGFLV------SLYAGNPEKTDVIIVLGGDSGLRVRKGAELYN 62

Query: 59  NQIGEKIFISGVHHSVSK---DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           +     + ++G+     +       ++  I+  + +  I +  ++  T   A  A+   E
Sbjct: 63  SGYASHVILTGIDERFYRPAHPNWRERRMIKLGVPKKAIRVDTQSTTTWEEAVNAADTME 122

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
           K  +   ++V+   HM R      +    S+ +FI                  K  + ++
Sbjct: 123 KKGWKSAIVVSDPPHMLRLHQTWSKAFKGSSKRFILVSTKPEWWRPFVWWKNKKSYQFVI 182

Query: 174 IEYLKILLLSI 184
            E  K L  ++
Sbjct: 183 NEIKKNLYYAV 193


>gi|218437457|ref|YP_002375786.1| hypothetical protein PCC7424_0452 [Cyanothece sp. PCC 7424]
 gi|218170185|gb|ACK68918.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7424]
          Length = 260

 Score = 65.7 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 46/219 (21%), Positives = 74/219 (33%), Gaps = 48/219 (21%)

Query: 9   FVCLIFFIMGFISFIRYVKQMH-----IPDHPSVSAIVVLTG----------------EP 47
              +I  +         + Q         + P   AIV+L G                + 
Sbjct: 43  LALIILLVASNGWISNQLVQSLEWQNIPSEIPQAEAIVLLGGATKPPAYPRPMVDMSEQG 102

Query: 48  IRIERAFELLENQIGEKIFISGV---------HHSVSKDILLQKIPIRQDLAECCIDIGY 98
            R+  A +L  +Q    I  SG            S     LLQ + +        I    
Sbjct: 103 DRVLYAAKLYLDQKAPLIIASGGRIDWLSNEQSESADMANLLQLMGVPP----QVIIQEP 158

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP--YPIISHD 156
            +LNT  NA       ++     VL+VT   HMPR+    +++   V   P  + +   +
Sbjct: 159 DSLNTYENATNVKKILQEKGIKQVLLVTSALHMPRSLFIFKKLGIDVIAAPTDFLVSRTE 218

Query: 157 LEENSSIFKIKILRVL------------LIEYLKILLLS 183
           LE N+   +  IL +L            L EY+ +L+ S
Sbjct: 219 LEPNNLTLEGIILNILPSSENLDRTTKALKEYIGLLVYS 257


>gi|23012908|ref|ZP_00052888.1| COG1434: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 266

 Score = 65.7 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 48/162 (29%), Gaps = 23/162 (14%)

Query: 28  QMHIPDHPSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISGV 70
           +   P    V  I+VL G                    R+     L +     ++  SG 
Sbjct: 70  RAPNPLPEKVDGIIVLGGAINPVVSEARGQVSVGGGVTRMTTLIPLAKRYPEARLVFSGG 129

Query: 71  -----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
                +  + +    +            I     + NT  NA  +    +       L++
Sbjct: 130 SGSPFNPELREADYAKIFYDDLGFDTDRIVFERDSRNTRENATLSKELMQPRPGETWLLI 189

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           T   HMPR+    + +   V  IP    +  L+      +++
Sbjct: 190 TSAGHMPRSVGCFRAVGWPVVPIPVDYYTTGLD-KPWWTELR 230


>gi|119964395|ref|YP_948857.1| hypothetical protein AAur_3158 [Arthrobacter aurescens TC1]
 gi|119951254|gb|ABM10165.1| putative uncharacterized DUF218 domain protein [Arthrobacter
           aurescens TC1]
          Length = 182

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 72/189 (38%), Gaps = 19/189 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQ 60
           R   + L  C++  ++  I+  +              AIVVL G    R+     L  +Q
Sbjct: 5   RKLAWALTACVLAGVLWLIAAFQLFHNPPRATPQKTDAIVVLGGMSNERLPVGLAL-RDQ 63

Query: 61  IGEKIFI---SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +G K  +   +G+  +   D   +       L +C   +    LNT G A      A + 
Sbjct: 64  LGIKDLVVVTTGLPANAGSDEFCEAHDGVTHL-DC---LRPDPLNTRGEALRLRDLAAER 119

Query: 118 NFHHVLIVTHDYHMPRTFLELQR-INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
            +  V +VT DYH+ R    +++ I + V  +       +L   + +         ++E 
Sbjct: 120 GWTSVTVVTSDYHVQRAGTLMKQCIAADVHMVG---TEPELSPVAWV------WRFVVET 170

Query: 177 LKILLLSIQ 185
             +L + ++
Sbjct: 171 GGLLDVWVR 179


>gi|300854922|ref|YP_003779906.1| hypothetical protein CLJU_c17410 [Clostridium ljungdahlii DSM
           13528]
 gi|300435037|gb|ADK14804.1| uncharacterized conserved membrane protein [Clostridium ljungdahlii
           DSM 13528]
          Length = 204

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 57/159 (35%), Gaps = 23/159 (14%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIP---DHPSV-------SAIVVL------TGEPI 48
           +  L   +   ++ FI  +  V  ++       P           I++L       G+P 
Sbjct: 6   FIILLKYMAISVLFFIIIVLVVINLYPLLFYKSPETKLKRDRYDVIIILGFPALQDGKPS 65

Query: 49  -----RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
                R+ +A EL        I  SG  V++   +  ++        +   C+    K+ 
Sbjct: 66  PIMRERVIKAVELFNKGYANNIICSGGGVYNKYIEADIMANFAESLGIPNSCLIREDKSR 125

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           NT  N Q +    E   +   +IVT  +H+ R+   L +
Sbjct: 126 NTYQNIQNSIKIMEDKKWSSAMIVTSPWHLRRSNYFLSK 164


>gi|163852418|ref|YP_001640461.1| hypothetical protein Mext_3001 [Methylobacterium extorquens PA1]
 gi|163664023|gb|ABY31390.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 278

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 56/143 (39%), Gaps = 24/143 (16%)

Query: 33  DHPSVSAIVVLTG--------EPIRI------ERAFEL--LENQIGE-KIFISGV----- 70
           D   V+ IVVL G           +I      ERA  L  L  +  + ++  SG      
Sbjct: 89  DGTPVTGIVVLGGTVEADTSIGRDQITVNEAGERAIALADLARRYPQARLVFSGGAGSTR 148

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
             +VS+  ++ +      +    + +  ++ NT  NA  ++   +       L+VT  +H
Sbjct: 149 EDAVSEAEIVSRYADTLGVPRNRLILEQQSRNTHENAVFSARMVQPKPGERWLLVTSAWH 208

Query: 131 MPRTFLELQRINSTVQFIPYPII 153
           MPR+    ++    V    YP+ 
Sbjct: 209 MPRSMGCFRKAGFDVT--AYPVD 229


>gi|167620257|ref|ZP_02388888.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis Bt4]
          Length = 240

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 52/134 (38%), Gaps = 12/134 (8%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +     + 
Sbjct: 91  RIDKTAELYSACQRTAKRCTVVVSGGDPQVRGITEADTYAPYLLARGVANADLIRESSSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R       +P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFRRFG----IVPQPVYANRRDARL 206

Query: 162 SIFKIKILRVLLIE 175
                + + ++  E
Sbjct: 207 GWL-PRAVNLVNAE 219


>gi|167582098|ref|ZP_02374972.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis TXDOH]
 gi|257139318|ref|ZP_05587580.1| hypothetical protein BthaA_08969 [Burkholderia thailandensis E264]
          Length = 240

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 52/134 (38%), Gaps = 12/134 (8%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +     + 
Sbjct: 91  RIDKTAELYSACQRTAKRCTVVVSGGDPQVRGITEADTYAPYLLARGVANADLIRESSSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R       +P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFRRFG----IVPQPVYANRRDARL 206

Query: 162 SIFKIKILRVLLIE 175
                + + ++  E
Sbjct: 207 GWL-PRAVNLVNAE 219


>gi|330816685|ref|YP_004360390.1| hypothetical protein bgla_1g17890 [Burkholderia gladioli BSR3]
 gi|327369078|gb|AEA60434.1| hypothetical protein bgla_1g17890 [Burkholderia gladioli BSR3]
          Length = 238

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 58/175 (33%), Gaps = 29/175 (16%)

Query: 26  VKQMHIPDHPSVSAIVVLTGE--------------PIRIERAFELLENQIGEK----IFI 67
           V+ +  P     +AIV+L G                 RI RA EL            I +
Sbjct: 52  VEPVEAPTMRGHTAIVLLGGGIERRRGELVPPHDALSRIVRAAELHSVCQAIASQCDIVV 111

Query: 68  SGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           +G       +S+  L   +     +AE  + +  ++  T  NA+  +      ++   ++
Sbjct: 112 TGGDPHHHGISEAQLYAPLLREHGVAERDLILETRSRTTYENAKYTAPILLAQHYDATIL 171

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE----ENSSIFKIKILRVLLIE 175
           VT  Y M R  L+  R        P P+ ++ L                   L E
Sbjct: 172 VTSSYQMRRALLDFARF----DIEPQPVYANQLRPILGWRPVWHNFVAASRALHE 222


>gi|226334849|ref|YP_002784521.1| hypothetical membrane protein [Rhodococcus opacus B4]
 gi|226246069|dbj|BAH56169.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 190

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 58/158 (36%), Gaps = 13/158 (8%)

Query: 1   MRYFWYGLFVCLIFFI----MGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-IRIERAFE 55
           MR     + V  I        GFI +     +  + D  SV AIVVL GE   R E AF+
Sbjct: 1   MRKIVAAMIVATILICCTAGAGFIVY----NRSAVDDIRSVDAIVVLGGERDGREEFAFD 56

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           L    +   + +S  +      +  +           CI        T G A      A 
Sbjct: 57  LARQGLSRNVVLSDPYGPYGTKLAARCETRDPRFTVRCI--PPNPSTTLGEAVFTRNLAT 114

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYP 151
            N ++ +++V+  YH+PR      R      V  +P P
Sbjct: 115 ANGWNSLMVVSWRYHLPRARYIFSRCLDGRDVLMVPVP 152


>gi|307267183|ref|ZP_07548690.1| protein of unknown function DUF218 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306917799|gb|EFN48066.1| protein of unknown function DUF218 [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 191

 Score = 65.7 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 31/160 (19%), Positives = 66/160 (41%), Gaps = 16/160 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----GE------PIRI 50
           ++  W    + ++F I+G I   + +   +         I+VL     G+        R+
Sbjct: 5   LKIVW---LLLVLFIIIGIILEWQIISFAYNEKPKKSDVIIVLGCAVYGDIPSPFFKARL 61

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           E A  L     G  I +SG      ++S+    +   +++ + E  I I  K+ +T  N 
Sbjct: 62  EEALRLYNEGYGRYIIVSGGKGPGENISEAEAGKGYLLKKGIPEKAILIDDKSFSTYENL 121

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
           Q +    +K +    +I+++ +H+ R  +  +R+     F
Sbjct: 122 QFSKEIMDKKSLKRAVIISNKFHLKRASVIAKRVGIEASF 161


>gi|327402034|ref|YP_004342872.1| hypothetical protein Fluta_0024 [Fluviicola taffensis DSM 16823]
 gi|327317542|gb|AEA42034.1| protein of unknown function DUF218 [Fluviicola taffensis DSM 16823]
          Length = 255

 Score = 65.3 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 67/220 (30%), Gaps = 53/220 (24%)

Query: 6   YGLFVCLIFFIMGFIS--FIRYVK--QMHIPDHPSVSAIVVLTG---------------E 46
           Y      +FF   FI   F R  +     I         +VLTG                
Sbjct: 40  YAAIFIALFFSNTFIYKEFCRQWEIFGTPISQVKHYDVAIVLTGMAEYNNDLQVLSARRG 99

Query: 47  PIRIERAFELLENQIGEKIFIS---------GVHHSVSKDILLQKIPIRQDLAECCIDIG 97
             RI +   L +    ++I IS         G+H +     +L K  I +      I   
Sbjct: 100 IDRIWQTISLYKAGKIDRILISGDHGYLIDKGLHEATQLKEILVKWGIPEH----VIITE 155

Query: 98  YKALNTEGNAQEASAWAEKN--NFHHVLIVTHDYHMPRTFLELQRI-------------N 142
            K+ NT  NA E+     +   N + +L+VT   HM R      ++              
Sbjct: 156 TKSKNTYENAVESQKIVNRLFPNSNAILLVTSGRHMRRARACFNKLGLKCDTYSTDLFTG 215

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
               F    +I  D+   S          LL E +  +  
Sbjct: 216 PNRSFTFDELIIPDVSTMSDWHS------LLKEMIGYIAY 249


>gi|21673972|ref|NP_662037.1| hypothetical protein CT1146 [Chlorobium tepidum TLS]
 gi|21647116|gb|AAM72379.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 196

 Score = 65.3 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 60/185 (32%), Gaps = 6/185 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEK 64
              F+            + ++  MH         IV+L G+   R+ +  +L +    + 
Sbjct: 9   LLFFLISSALCASLYLGLGFLVSMHSTKPEKADIIVILGGDDGLRVSKGGDLYKAGYAKH 68

Query: 65  IFISGVHHSVSKDIL---LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           + ++G+     +       ++  + + +    I +   +  +   A+  S   +KN +  
Sbjct: 69  VLLTGIDSRYYRPNHPNWRERKLMARGVPRKHIIVDTWSETSWEEAENTSDLMDKNGWKS 128

Query: 122 VLIVTHDYHMPR--TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            L+V+   HM R     +     +  +F                      R ++ E  K 
Sbjct: 129 ALVVSDPPHMLRLNKTWKKAFAGTNKRFRLVATEPSWWNPLLWWRNPISYRFVINELKKN 188

Query: 180 LLLSI 184
           +   +
Sbjct: 189 IYYLV 193


>gi|240139755|ref|YP_002964232.1| hypothetical protein MexAM1_META1p3209 [Methylobacterium extorquens
           AM1]
 gi|240009729|gb|ACS40955.1| conserved hypothetical protein, DUF218; putative membrane protein
           precursor [Methylobacterium extorquens AM1]
          Length = 265

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 64/179 (35%), Gaps = 29/179 (16%)

Query: 2   RYFWYGLFVCLIFFIMG--FISFIRYVKQMHI---PDHPSVSAIVVLTG--------EPI 48
           R      FV L+F  +       +  ++        D   V+ IVVL G           
Sbjct: 40  RVLTVASFVGLLFGGLSPLSAWTLAPLENRFPNFIDDGTPVTGIVVLGGTVEADTSIGRD 99

Query: 49  RI------ERAF---ELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCI 94
           +I      ERA    +L       ++  SG        +VS+  ++ +      +    +
Sbjct: 100 QITVNEAGERAIALADLARRYPQARLVFSGGAGSTREDAVSEAEIVSRYADTLGVPRNRL 159

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
            +  ++ NT  NA  ++   +       L+VT  +HMPR+    ++    V    YP+ 
Sbjct: 160 ILEQQSRNTHENAVFSARMVQPKPGERWLLVTSAWHMPRSMGCFRKAGFDVT--AYPVD 216


>gi|116249878|ref|YP_765716.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254526|emb|CAK05600.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 262

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 53/147 (36%), Gaps = 20/147 (13%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
           C+I    GF + +   +             +   G   R   A  L +     +I +SG 
Sbjct: 80  CMIVLGGGFENEVNTARHG-----------IEFNGGADRFIEALRLAQKFPQSRILVSGG 128

Query: 71  HHSVS------KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
             S+S           +  P+     +  I+   ++  T  NA     +       + L+
Sbjct: 129 DGSISGIYEGDAAASERFFPLFGVGRDRLIE-ERQSRTTFENAVNTKEFLASQGLSNCLL 187

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYP 151
           +T  +HMPR+    +++   +  +P+P
Sbjct: 188 ITSGFHMPRSVGIFRKL--GIDIVPWP 212


>gi|167836831|ref|ZP_02463714.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis MSMB43]
          Length = 240

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 57/157 (36%), Gaps = 19/157 (12%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN--QIGEK--IFISGVHH---SVSKDI 78
           +++      P   A+        RI++  EL     +  ++  + +SG       +++  
Sbjct: 75  IRRRDGAAVPPRDAL-------ARIDKTAELYSACQRTAKRCTVVVSGGDPQMRGITEAD 127

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
                 + + +A   +     +  T  NA+         ++  +++VT  Y M R  L+ 
Sbjct: 128 TYAPYLLARGVAHADLIRERSSHTTYENARFTVPILRAQHYDDLILVTSSYQMKRALLDF 187

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           +R       +P P+ ++  +        +   ++  E
Sbjct: 188 ERFG----IVPQPVYANRRDAQLGWL-PRAANLVNAE 219


>gi|237812033|ref|YP_002896484.1| hypothetical protein GBP346_A1775 [Burkholderia pseudomallei
           MSHR346]
 gi|237506357|gb|ACQ98675.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 240

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 48/122 (39%), Gaps = 11/122 (9%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +    ++ 
Sbjct: 91  RIDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R      F P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFG----FAPQPVYANRRDARP 206

Query: 162 SI 163
             
Sbjct: 207 GW 208


>gi|167902941|ref|ZP_02490146.1| hypothetical protein BpseN_11835 [Burkholderia pseudomallei NCTC
           13177]
          Length = 240

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 48/122 (39%), Gaps = 11/122 (9%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +    ++ 
Sbjct: 91  RIDKTAELYSACRRTAQRCTVVVSGGDPQVRSIAEADTYAPYLLARGVASADLIREKRSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R      F P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFG----FAPQPVYANRRDARP 206

Query: 162 SI 163
             
Sbjct: 207 GW 208


>gi|241207055|ref|YP_002978151.1| hypothetical protein Rleg_4373 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860945|gb|ACS58612.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 262

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 51/151 (33%), Gaps = 28/151 (18%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
           C+I    GF + +   +             +   G   R   A  L +     +I +SG 
Sbjct: 80  CMIVLGGGFENEVNTARHG-----------IEFNGGADRFIEALRLAQKFPQSRILVSGG 128

Query: 71  H---------HSVSKDILLQKIPI-RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
                      + + +       + R  L E       ++  T  NA     +       
Sbjct: 129 DGSMSGIYEGDAAASERFFPLFGVGRDRLIE-----ERQSRTTFENAVNTKEFLASQGLS 183

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
           + L++T  +HMPR+    +++   +  +P+P
Sbjct: 184 NCLLITSGFHMPRSVGIFRKL--GIDIVPWP 212


>gi|218531176|ref|YP_002421992.1| hypothetical protein Mchl_3226 [Methylobacterium chloromethanicum
           CM4]
 gi|218523479|gb|ACK84064.1| protein of unknown function DUF218 [Methylobacterium
           chloromethanicum CM4]
          Length = 265

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 63/179 (35%), Gaps = 29/179 (16%)

Query: 2   RYFWYGLFVCLIFFIMG--FISFIRYVKQMHI---PDHPSVSAIVVLTG--------EPI 48
           R      FV L+   +       +  ++        D   V+ IVVL G           
Sbjct: 40  RVLTVAGFVGLLVAGLSPLSAWTLAPLENRFPSFTDDGTPVTGIVVLGGTVEADTSIGRD 99

Query: 49  RI------ERAF---ELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCI 94
           +I      ERA    +L       ++  SG        +VS+  ++ +      +    +
Sbjct: 100 QITVNEAGERAIALADLARRYPQARLVFSGGSGSTREDAVSEAEIVSRYADTLGVPRNRL 159

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
            +  ++ NT  NA  ++   +       L+VT  +HMPR+    ++    V    YP+ 
Sbjct: 160 ILEQQSRNTHENAVFSARMVQPKPGERWLLVTSAWHMPRSMGCFRKAGFDVT--AYPVD 216


>gi|307150072|ref|YP_003885456.1| hypothetical protein Cyan7822_0130 [Cyanothece sp. PCC 7822]
 gi|306980300|gb|ADN12181.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7822]
          Length = 278

 Score = 65.3 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 43/242 (17%), Positives = 79/242 (32%), Gaps = 68/242 (28%)

Query: 9   FVCLIFFIMGFISFIRYVKQMH-----IPDHPSVSAIVVLTG----------------EP 47
              +I  + G       + Q         + P+  AI+VL G                + 
Sbjct: 43  LALIIILVAGNEWVSNGLIQSLEWQNIPQNIPNAEAIIVLGGATKSASFPRPMVDLNEQG 102

Query: 48  IRIERAFELLENQIGEKIF----------------ISGVHHSVSKDI---------LLQK 82
            R+  A +L ++     I                 +SGV +S              LL  
Sbjct: 103 DRVVYAAKLYQDHKAPLIIASGGRIKWGGQQVTDKLSGVGNSFRTQQQPESADIATLLTL 162

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
           + +        I     +LNT  N         +     VL+VT   HMPR+ L  ++  
Sbjct: 163 MGVPPSA----ILQDSTSLNTYENVVNVKKILNEKGIKRVLLVTSALHMPRSLLIFKK-- 216

Query: 143 STVQFIPYP----IISHDLEENSSIFKIKILRVL------------LIEYLKILLLSIQL 186
             +  IP P    +   +LE++    +  +L ++            L EY+ +++  ++ 
Sbjct: 217 QGIDVIPAPTDFLVSQPELEQSDLSVETIMLNLIPDAGRLEGTTKALKEYIGMVIYRLKG 276

Query: 187 SL 188
            L
Sbjct: 277 WL 278


>gi|190889771|ref|YP_001976313.1| hypothetical protein RHECIAT_CH0000139 [Rhizobium etli CIAT 652]
 gi|190695050|gb|ACE89135.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 262

 Score = 64.9 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 42/117 (35%), Gaps = 17/117 (14%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGVH---------HSVSKDILLQKIPI-RQDLAECCI 94
           G   R   A  L +     +I +SG            + + +       I R  L E   
Sbjct: 103 GGADRFVEALRLAQKFPQSRILVSGGDGSMSGIYEGDAAASERFFPLFGIGRDRLIE--- 159

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
               ++  T  NA     +       H L++T  +HMPR+    +++   +  +P+P
Sbjct: 160 --ETQSRTTFENAVNTRDFLAGQGLSHCLLITSGFHMPRSVGIFRKL--GIDIVPWP 212


>gi|163790688|ref|ZP_02185115.1| hypothetical protein CAT7_00865 [Carnobacterium sp. AT7]
 gi|159873989|gb|EDP68066.1| hypothetical protein CAT7_00865 [Carnobacterium sp. AT7]
          Length = 196

 Score = 64.9 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 39/149 (26%), Positives = 66/149 (44%), Gaps = 11/149 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPI-RIERAFELLENQ 60
             + G+ +  +  ++G +S+   +  + I + P     I+V  G+   R  RA ELL   
Sbjct: 7   IIFIGVVIVFMCLVIG-VSYPIIINNLIIDEGPVQSDVIIVPEGQEYVRAYRAAELLHEG 65

Query: 61  IGE--KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
                +I +S +  +       ++  + Q+     I    KA +T  NA       E++ 
Sbjct: 66  FSTSGQIIVSPIDKAT--VQGYKEFWVSQEQ----IIPETKATSTYENAVITLRMMEEHG 119

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQF 147
           F   +IV+ DYHM RT L  +RINS   F
Sbjct: 120 FDSAIIVSSDYHMRRTKLIYERINSDYDF 148


>gi|219872211|ref|YP_002476586.1| hypothetical protein HAPS_2205 [Haemophilus parasuis SH0165]
 gi|219692415|gb|ACL33638.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 201

 Score = 64.9 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 53/137 (38%), Gaps = 30/137 (21%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP-----------------IRIERAFELLENQIGEKIFISG 69
             + I D+ S  AIV+L+G                    R+  A   L+ + G  + I+G
Sbjct: 22  DNLSIEDYKSAQAIVLLSGGLRDSKELFGKLAISEIALERVRYA-AFLQKETGLPLLITG 80

Query: 70  VHH------SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
                    +V K  L Q   I          +  KA  T  NA+ +    EK   + ++
Sbjct: 81  SSPKGTSEAAVMKKELEQFFHIPTQW------LEEKAKTTAENAKFSKPILEKEGINKIV 134

Query: 124 IVTHDYHMPRTFLELQR 140
           +VT+ +HM R  +  +R
Sbjct: 135 LVTNQWHMQRARMLFER 151


>gi|330811913|ref|YP_004356375.1| hypothetical protein PSEBR_a4949 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380021|gb|AEA71371.1| Conserved hypothetical protein; putative membrane protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 253

 Score = 64.9 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 56/177 (31%), Gaps = 36/177 (20%)

Query: 10  VCLIFFIMGF--------ISFIRYVKQMHIPDHP--------SVSAIVVLTGEPIRIE-- 51
           +C    + GF        + +     +   P              AIVVL     R +  
Sbjct: 37  LCFAVGLGGFWLMSLPVVVQWSAKALEREPPLLRSEWATLAQRADAIVVLGSGRERGDLA 96

Query: 52  ------RAFELLENQIGEKIF-ISGVHHSVSKDILLQKIPIRQDLAECCIDIGY------ 98
                     L   +   ++  +SG+    +  +     P    L    +   +      
Sbjct: 97  WGADQPTGVGLERQRYAARLAKVSGLPVLTTGGLHYGTPPSEAKLMADSMLDDFGVNVRW 156

Query: 99  ---KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
              ++  T  NAQ ++          V+++T  +HMPR+    +R     + +P P+
Sbjct: 157 QEGRSRTTWENAQMSAEILLPEGIKRVVVITQAWHMPRSVWSFERA--GFEVVPAPV 211


>gi|56476276|ref|YP_157865.1| hypothetical protein ebA1532 [Aromatoleum aromaticum EbN1]
 gi|56312319|emb|CAI06964.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 248

 Score = 64.9 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 34/182 (18%), Positives = 64/182 (35%), Gaps = 37/182 (20%)

Query: 12  LIFFIMGFISFIR----YVKQMHIPDHPSVSAIVVL-----------------TGEPIRI 50
           + F ++GF +F R     V +     +P   AIVVL                  G   R+
Sbjct: 50  IAFSLVGFDNFARSPWPQVPERIALPYPRAEAIVVLGAGRYLQAPEYDGDTAAAGSLERV 109

Query: 51  ERAFELLENQIGEKIFISGVHH----SVSKDILLQ-----KIPIRQDLAECCIDIGYKAL 101
             A +L     G  I +SG       + S+  ++Q     +  +     E        + 
Sbjct: 110 RYAAKLYRE-TGLPILVSGGRPGDIGTRSEAEIMQDILEQEFHVPVRWVE------PDSE 162

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           +T+ NA+ ++A         + +VTH +H+ R   +  +    V  +    +    +   
Sbjct: 163 DTQQNAERSAALLRAEGVTCIYLVTHGFHIDRAAAQFHKHGLEVVPMATGFVRPQPDTVL 222

Query: 162 SI 163
           S 
Sbjct: 223 SW 224


>gi|219855730|ref|YP_002472852.1| hypothetical protein CKR_2387 [Clostridium kluyveri NBRC 12016]
 gi|219569454|dbj|BAH07438.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 199

 Score = 64.9 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 60/145 (41%), Gaps = 15/145 (10%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----EPI-------RIERAF 54
           + L+  ++ F++  I+ I+ +             I+VL G              R+ +  
Sbjct: 10  FVLYFIIVIFLLALITEIQIIYFGENAKPKKSDCIIVL-GCRVYGSTPSPFLIWRLNKGL 68

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           EL +   G+ I +SG      ++S+   ++   + + +    + +  K+++T  N   + 
Sbjct: 69  ELYDKGYGDYIIVSGGKGPGENISEAKAMKNYLVYKGIDSSRVIMEDKSMSTMENLSNSK 128

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFL 136
              E+      +IV++ YH+ R  L
Sbjct: 129 RVMEEKGLKTAVIVSNKYHLKRASL 153


>gi|153955310|ref|YP_001396075.1| hypothetical protein CKL_2692 [Clostridium kluyveri DSM 555]
 gi|146348168|gb|EDK34704.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
          Length = 196

 Score = 64.9 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 60/145 (41%), Gaps = 15/145 (10%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----EPI-------RIERAF 54
           + L+  ++ F++  I+ I+ +             I+VL G              R+ +  
Sbjct: 7   FVLYFIIVIFLLALITEIQIIYFGENAKPKKSDCIIVL-GCRVYGSTPSPFLIWRLNKGL 65

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           EL +   G+ I +SG      ++S+   ++   + + +    + +  K+++T  N   + 
Sbjct: 66  ELYDKGYGDYIIVSGGKGPGENISEAKAMKNYLVYKGIDSSRVIMEDKSMSTMENLSNSK 125

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFL 136
              E+      +IV++ YH+ R  L
Sbjct: 126 RVMEEKGLKTAVIVSNKYHLKRASL 150


>gi|300690675|ref|YP_003751670.1| hypothetical protein RPSI07_1014 [Ralstonia solanacearum PSI07]
 gi|299077735|emb|CBJ50373.1| conserved protein of unknown function, DUF218 [Ralstonia
           solanacearum PSI07]
          Length = 190

 Score = 64.9 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 60/153 (39%), Gaps = 11/153 (7%)

Query: 36  SVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAEC 92
               IVVL GE   R+  A EL    +  ++F+SG      + + +++  +P  +   EC
Sbjct: 45  HADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCLLIVRRLVMAGVPADRIGHEC 104

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
                 ++ +T GNA+              ++VT  YH  R     +++   V +    +
Sbjct: 105 ------ESGSTMGNAEMTHRALTGQPVRSAVLVTSWYHTGRALEVFRQVWPEVTWGARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
              D    S          +L EY+K    +++
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYIKRAWYAVR 189


>gi|238927939|ref|ZP_04659699.1| protein of hypothetical function DUF218 [Selenomonas flueggei ATCC
           43531]
 gi|238884272|gb|EEQ47910.1| protein of hypothetical function DUF218 [Selenomonas flueggei ATCC
           43531]
          Length = 253

 Score = 64.9 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 54/147 (36%), Gaps = 26/147 (17%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRIER-----AFELLENQIGEKIF--------------I 67
           +   +P+ P    I++L G    I          +L      ++               +
Sbjct: 68  RTYPVPEVPQGDVIIMLGGGA--IADVQDVDGMGMLAQSPSSRLLAAYRLHLRTHLPILL 125

Query: 68  SG--VHHSV-SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG  V     S+  + +++     + +  I +  ++L T  NA   +    +    H ++
Sbjct: 126 SGGQVFSDTGSEAEIARRVLRSLGVPDEMIRVETRSLTTGQNAHYTAEILRREGLMHPIL 185

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYP 151
           VT  +H+PR  L  ++    +   PYP
Sbjct: 186 VTSAFHLPRAVLNFEK--QGITVTPYP 210


>gi|254562167|ref|YP_003069262.1| hypothetical protein METDI3773 [Methylobacterium extorquens DM4]
 gi|254269445|emb|CAX25411.1| conserved hypothetical protein, DUF218; putative membrane protein
           precursor [Methylobacterium extorquens DM4]
          Length = 265

 Score = 64.9 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 54/143 (37%), Gaps = 24/143 (16%)

Query: 33  DHPSVSAIVVLTG--------EPIRI------ERAF---ELLENQIGEKIFISGV----- 70
           D   V+ IVVL G           +I      ERA    +L       ++  SG      
Sbjct: 76  DGTPVTGIVVLGGTVEADTSIGRDQITVNEAGERAIALADLARRYPQARLVFSGGAGSTR 135

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
             +VS+  ++ +      +    + +  ++ NT  NA  ++   +       L+VT  +H
Sbjct: 136 EDAVSEAEIVSRYADTLGVPRNRLILEQQSRNTHENAVFSARMVQPKPGERWLLVTSAWH 195

Query: 131 MPRTFLELQRINSTVQFIPYPII 153
           MPR+    ++    V    YP+ 
Sbjct: 196 MPRSMGCFRKAGFDVT--AYPVD 216


>gi|182678647|ref|YP_001832793.1| hypothetical protein Bind_1673 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634530|gb|ACB95304.1| protein of unknown function DUF218 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 284

 Score = 64.5 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 67/218 (30%), Gaps = 39/218 (17%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP----SVSAIVVLTGE----------- 46
           R     + +     +  F +F+    +   P+        + I+VL G            
Sbjct: 40  RLQAIAILLLAFVLLTPFGAFVVRPLEDRFPNPDLHAIDPAGIIVLGGGMDSRESKARGV 99

Query: 47  ------PIRIERAFELLENQIGEKIFISGVH---------HSVSKDILLQKIPIRQDLAE 91
                   R+    EL       K+  +G            S+    L Q + +  +   
Sbjct: 100 PILNTAGSRMTAGVELSRLFPQAKLIFTGGSGDLMGDQPSESIYARELWQNLGVPAEQM- 158

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFI--P 149
                   + NT  NA       +       L+VT   HMPR+    +++   V      
Sbjct: 159 ---VFEGNSRNTWENAVFTRDLIKPKPEDRYLLVTSAAHMPRSVGIFRKVGFNVIPYNAN 215

Query: 150 YPIISHDLEENSSIFKIKILRVL---LIEYLKILLLSI 184
           Y  I    + + +      LR+L   L E++ +L   +
Sbjct: 216 YMTIGDARDWSVTTLAHDRLRMLSFGLREWIGLLAYRL 253


>gi|34558162|ref|NP_907977.1| hypothetical protein WS1867 [Wolinella succinogenes DSM 1740]
 gi|34483881|emb|CAE10877.1| hypothetical protein WS1867 [Wolinella succinogenes]
          Length = 214

 Score = 64.5 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 59/172 (34%), Gaps = 24/172 (13%)

Query: 33  DHPSVSAIVVLTGE--PIRIERAFELLENQIGEKIFISGV-------------HHSVSKD 77
                 AI+VL G     R+  A  LL+      + ++ V             H S    
Sbjct: 36  AQRGADAILVL-GGNKSSRLPHAISLLKAGYAPLLLVTEVKRYSNQTFDGLLRHESDEVV 94

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            +L  + +   L      +   A +T   A +  A+A+ +N   ++IVT  +H  R    
Sbjct: 95  HILSSLHLPHHLIP---SLKGGATSTYDEAYDFFAYAKDSNIRSIIIVTDAFHTRRALGA 151

Query: 138 LQRINS-----TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
             ++        +Q    P  +    E         L+  ++E +K  L  I
Sbjct: 152 FLKVQRRLQEEKIQIQISPAPNTHFNEKDWYLTEAGLQAYILEGIKTFLYLI 203


>gi|317968461|ref|ZP_07969851.1| hypothetical protein SCB02_02886 [Synechococcus sp. CB0205]
          Length = 266

 Score = 64.5 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 51/149 (34%), Gaps = 24/149 (16%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQIGEKIFI 67
                +     P+  A+VVL G                   R+     L+  +    +  
Sbjct: 65  ERAAALTPKTIPNADAVVVLGGGLKPALPPRRGVEVSEGGDRLLTGVRLMSQKKAGTLVT 124

Query: 68  SGV-------HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           SG          + ++    + +     +    I     +  T   A++    A++  + 
Sbjct: 125 SGAQISFTAADPAPAEAFSAKALAEELGVPSQRIVPNPLSKTTAEEARDIGQLAKQRGWS 184

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            VL+VT  +HMPR+    QR +  +Q IP
Sbjct: 185 QVLLVTSAFHMPRSLATFQRRS-GLQVIP 212


>gi|15964004|ref|NP_384357.1| hypothetical protein SMc00331 [Sinorhizobium meliloti 1021]
 gi|15073180|emb|CAC41688.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
          Length = 335

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 56/175 (32%), Gaps = 26/175 (14%)

Query: 1   MRYFWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLTGE------------ 46
           +  F   +    +F   G  F+  +        P+   ++ I+VL G             
Sbjct: 113 LSAFGLAVLFVTLFTTAGSYFLQILEDRFPRPTPEPTELACIIVLGGAFENVVMASRGGM 172

Query: 47  -----PIRIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDI 96
                  R      L +     +I +SG   S+S          +       +    +  
Sbjct: 173 ELNQAAERFVETLRLAQAYPQARILVSGGDGSLSGIYEGDAHASENFFGTFGIGSDRLIR 232

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             ++  T  NA+       KN      +VT  YHMPR+    +   + ++  P+P
Sbjct: 233 EGESRTTFENARYTRDLLAKNGLERCALVTSAYHMPRSIGLFRA--NGMEVTPWP 285


>gi|90421278|ref|ZP_01229163.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334463|gb|EAS48266.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 211

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 52/167 (31%), Gaps = 24/167 (14%)

Query: 25  YVKQMHIPDHPSVSAIVVLTGE-----------------PIRIERAFELLENQIGEKIFI 67
            V +  + D  + + I+VL G                    R+    EL +     K+  
Sbjct: 44  SVIRAVVLDRRARNGIIVLGGAFDTRVARTRGMNELNDAADRVTAGMELAQRYPKAKLLF 103

Query: 68  SGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           SG         + +    + +     LA   + +  +A +T  NA  A   A+       
Sbjct: 104 SGGVAALLEEDIPETEAAEALYRGLGLAPDRLLLDGRARDTFENAVFAKELAQPKPGEVW 163

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           ++VT   HMPR     +        +PYP+        +        
Sbjct: 164 VLVTSASHMPRAVGCFRVA--GFDIVPYPVDYRTPSGPALWRPSSTT 208


>gi|21673458|ref|NP_661523.1| hypothetical protein CT0624 [Chlorobium tepidum TLS]
 gi|21646562|gb|AAM71865.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 257

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 51/160 (31%), Gaps = 22/160 (13%)

Query: 28  QMHIPDHPSVSAIVVLTG---------------EPIRIERAFELLENQIGEKIFISGV-- 70
           ++ +       AIVVL+G                  R E   +L +      +  +G   
Sbjct: 63  RVPVEQVRKADAIVVLSGMLQQIHGAPLGEFGEAADRFESGIDLFKAGKAPVLVFTGGQM 122

Query: 71  --HHS-VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW--AEKNNFHHVLIV 125
                 V +  LL      + +    I +     NT G A   +            +++V
Sbjct: 123 PWDPDCVPEGELLAARARLRGVPAGSIRLTSTVANTAGEALATALLLGVSPGKPKRIILV 182

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           T  +HM R  +        V+  P    + DL+  +++  
Sbjct: 183 TSAFHMQRALMLFMAAGFEVEPCPVDFWATDLKSRTTLLD 222


>gi|33240920|ref|NP_875862.1| hypothetical protein Pro1471 [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33238449|gb|AAQ00515.1| Uncharacterized conserved protein with signal peptide
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 241

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 35/189 (18%), Positives = 65/189 (34%), Gaps = 28/189 (14%)

Query: 6   YGLFVCLIFFIMGFIS-----FIRY-VKQMHIPDHPSVSAIVVLTGE------------- 46
             +F+ L  F +G +S     F+ +  +++     P+  AIVVL+               
Sbjct: 24  LSIFIFLWTFSIGLVSQMLWKFVEHPWQRIDESHAPTADAIVVLSSGGRSLAPGISNIIE 83

Query: 47  ---PIRIERAFELLENQIGEKIFISGVHHSVSKD-----ILLQKIPIRQDLAECCIDIGY 98
              P R     +L + +   K+F +G      K       L ++  I   + +  I    
Sbjct: 84  WNDPDRFLAGVKLFKEKKAPKLFFTGGASPYRKALKTEGDLYKEEAISLGIPKKAISTTG 143

Query: 99  KALNTEGNAQEASAWAEKNNFHH-VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
           +  NT   A +     +       +L+VT  +HM R   + +R    VQ  P    +   
Sbjct: 144 RVFNTAEEAFQIRRNIKDKGSPSKILLVTSAFHMQRAKRQFERQGFIVQPFPVDFKTERK 203

Query: 158 EENSSIFKI 166
              +     
Sbjct: 204 FRKTYWKNP 212


>gi|315652448|ref|ZP_07905435.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315485286|gb|EFU75681.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 365

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 72/198 (36%), Gaps = 25/198 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           + Y         + F+M        +  +HI  +  +  I+VL               RI
Sbjct: 144 LVYKMLSFIFIYLLFLMAMYCISAILNLIHIGRNKKLDYIIVLGAGIKGKRVTPLLAGRI 203

Query: 51  ERAFELLENQIGEKIFISGV-HHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++  ELL+     K+ +SG             +     ++ +++  I I  K+ NT+ N 
Sbjct: 204 DKGIELLKYNPNAKLILSGGMGPGEDIPEGVAMADYAKQKGVSDEKIIIEDKSKNTKENL 263

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +    +  N   + IVT  YH+ R  +  +++   +  I Y   +             
Sbjct: 264 LFSYKLIDNKN-SKIAIVTTSYHVFRALVFAKKL--NIPCIGYGSKT---------KWYF 311

Query: 168 ILRVLLIEYLKILLLSIQ 185
            L  L+ EY+  L +S +
Sbjct: 312 TLNALIREYIGYLSISYR 329


>gi|307306416|ref|ZP_07586160.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
 gi|306902258|gb|EFN32855.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
          Length = 262

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 56/175 (32%), Gaps = 26/175 (14%)

Query: 1   MRYFWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLTGE------------ 46
           +  F   +    +F   G  F+  +        P+   ++ I+VL G             
Sbjct: 40  LSAFGLAVLFVTLFTTAGSYFLQILEDRFPRPTPEPTELACIIVLGGAFENVVMASRGGM 99

Query: 47  -----PIRIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDI 96
                  R      L +     +I +SG   S+S          +       +    +  
Sbjct: 100 ELNQAAERFVETLRLAQAYPQARILVSGGDGSLSGIYEGDAHASENFFGTFGIGSDRLIR 159

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             ++  T  NA+       KN      +VT  YHMPR+    +   + ++  P+P
Sbjct: 160 EGESRTTFENARYTRDLLAKNGLERCALVTSAYHMPRSIGLFRA--NGMEVTPWP 212


>gi|218509953|ref|ZP_03507831.1| hypothetical protein RetlB5_22095 [Rhizobium etli Brasil 5]
          Length = 262

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 43/117 (36%), Gaps = 17/117 (14%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGVH---------HSVSKDILLQKIPI-RQDLAECCI 94
           G   R   A  L +     +I +SG            + + +       I R+ L E   
Sbjct: 103 GGADRFVEALRLAQKFPDSRILVSGGDGSMSGIYEGDAAASERFFPLFGIGRERLIE--- 159

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
               ++  T  NA     +       H L++T  +HMPR+    +++   +  +P+P
Sbjct: 160 --ETQSRTTFENAVNTREFLASQGLSHCLLITSGFHMPRSVGIFRKL--GIDIVPWP 212


>gi|194336436|ref|YP_002018230.1| protein of unknown function DUF218 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308913|gb|ACF43613.1| protein of unknown function DUF218 [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 196

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 66/193 (34%), Gaps = 9/193 (4%)

Query: 1   MRYF---WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFEL 56
           MR F       F+ L       +S +  +   H  D      I+VL G+   R+ +  EL
Sbjct: 1   MRLFVKITLIFFLSLTTAAALLLSCLGILVSQHAADPEKCDVIIVLGGDNGLRVRKGAEL 60

Query: 57  LENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
                   + ++G+       S     ++  I   + +  I I  K+  T   A+  S  
Sbjct: 61  YNAGYASHVILTGIDERFYRPSHPNWRERRMIALGVPKKAIKIDTKSKTTWEEAENTSNT 120

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRV 171
            EK  +   +IV+   HM R      R    S+  FI         +        +  + 
Sbjct: 121 MEKKGWKSAIIVSDPPHMLRLHQTWNRAFKGSSKTFILVSTTPSWWDRVLWWKNRQSYQF 180

Query: 172 LLIEYLKILLLSI 184
           ++ E  K L  + 
Sbjct: 181 VISEIKKNLFYAA 193


>gi|261252465|ref|ZP_05945038.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio orientalis CIP 102891]
 gi|260935856|gb|EEX91845.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio orientalis CIP 102891]
          Length = 267

 Score = 64.5 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 51/118 (43%), Gaps = 9/118 (7%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     ++    G K+ +SG      VS   ++ K+ +   +++  I +   A +T
Sbjct: 105 GLMRLAEGIRVMRIYPGSKLILSGYAGGSEVSNARMMAKVALSLGVSKSDIILLETAKDT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
              A++A+A+        +++VT   HM R   E           PYP  ++ L +N+
Sbjct: 165 WEEARQAAAFVTTKK---LVVVTSASHMKRALNEFHSAGMD----PYPAPTNYLAQNN 215


>gi|325917198|ref|ZP_08179425.1| hypothetical protein XVE_3418 [Xanthomonas vesicatoria ATCC 35937]
 gi|325536588|gb|EGD08357.1| hypothetical protein XVE_3418 [Xanthomonas vesicatoria ATCC 35937]
          Length = 183

 Score = 64.5 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/141 (17%), Positives = 49/141 (34%), Gaps = 18/141 (12%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRIERAFELL 57
           L +  +  +  +I ++    Q           I+VL               RI  A +L 
Sbjct: 2   LALIWLVAVAAWIVWVGDRDQAAP-----ADVIIVLGAAAYDARPSPVFEERIRHALDLY 56

Query: 58  ENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
                 ++  +G        ++  + ++  +R  +    I I   +  T  N  +A A  
Sbjct: 57  GQGYAPRLLFTGGFGNGARFAESQVARRYALRHGVPPEAIVIETSSRTTRQNLLQARALM 116

Query: 115 EKNNFHHVLIVTHDYHMPRTF 135
           E++  H  +IV+   HM R  
Sbjct: 117 ERHGMHRAIIVSDPLHMARAL 137


>gi|166368105|ref|YP_001660378.1| hypothetical protein MAE_53640 [Microcystis aeruginosa NIES-843]
 gi|166090478|dbj|BAG05186.1| hypothetical protein MAE_53640 [Microcystis aeruginosa NIES-843]
          Length = 207

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 56/156 (35%), Gaps = 12/156 (7%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L + LI  I+G++     ++Q          AI VL G   R   A +L +      I+
Sbjct: 26  LLAIPLILAILGWL--YHDLRQ----QWLKPEAIFVLGGHADRERFAAKLAKEYPDLPIW 79

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           +S          + +K  I  +       + Y A +T  N    +   +      V +VT
Sbjct: 80  VSSGSPRRYVRKIFKKAGIPPERLH----LDYNARDTVTNFTSLADQLKAQGIDSVYLVT 135

Query: 127 HDYHMPRTFL--ELQRINSTVQFIPYPIISHDLEEN 160
            D HM R  L  E+   +  +   P  + S    E 
Sbjct: 136 SDNHMRRARLVGEIVFGSRGIMIKPVTVPSQSPPEP 171


>gi|237746467|ref|ZP_04576947.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229377818|gb|EEO27909.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 203

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 48/149 (32%), Gaps = 21/149 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IR 49
           +R      F+ + +       F        +    +  A ++L G              R
Sbjct: 5   LRILVIAAFLFVAYIFCSIALFS------TVDQKKTADAAIIL-GAAAWYKRPSPVFEER 57

Query: 50  IERAFELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           I     L EN    K+ ++G        S+  + ++  +   + E  I I   +  T  N
Sbjct: 58  IRHGLWLYENGYVRKLILTGGKSKNAPYSEAFVARRYALSHAIPENDILIEEASQTTREN 117

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
              A A  + N     LIV+   HM R  
Sbjct: 118 LLNAKAIMQANGLSTALIVSDPIHMKRAM 146


>gi|186685641|ref|YP_001868837.1| hypothetical protein Npun_R5589 [Nostoc punctiforme PCC 73102]
 gi|186468093|gb|ACC83894.1| protein of unknown function DUF218 [Nostoc punctiforme PCC 73102]
          Length = 176

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 52/130 (40%), Gaps = 9/130 (6%)

Query: 36  SVSAIVVLTGEPIRIER---AFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
              A+VVL G   R+ER     E +       I+I+G     S     Q++  +  +   
Sbjct: 22  QPQAVVVLGGSTRRLEREKFTAEFVRQHPNIPIWITGG----SPPRFTQRVFTKAGVDPK 77

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRINSTVQFIPY 150
            + + Y+A++T  N        +      V ++T D+HM R     E+   +  +   P 
Sbjct: 78  RLHLDYEAVDTVTNFTTLVDDLQARGIKSVYLITSDFHMRRACVIGEIILGSRGIYLKPV 137

Query: 151 PIISHDLEEN 160
           P+ S    E+
Sbjct: 138 PVPSEKPPES 147


>gi|170749150|ref|YP_001755410.1| hypothetical protein Mrad2831_2743 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655672|gb|ACB24727.1| protein of unknown function DUF218 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 281

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 74/223 (33%), Gaps = 43/223 (19%)

Query: 2   RYFWYGLFVCLIF-FIMGFISFI----------RYVKQMHIPDHPSVSAIVVLTGEPIRI 50
           R+   GL + L+  F++G                     +  D P+ + I+VL G    I
Sbjct: 34  RWRRSGLGLALLGSFLLGAAGLAPLSDVALIPLEQRFPAYPDDGPAPTGIIVLGGG---I 90

Query: 51  ERAF--------------------ELLENQIGEKIFISG----VHHSVSKDILLQKIPIR 86
           E                       +L       ++  SG    +   +++  ++ +    
Sbjct: 91  EAGLSEARRQIVVNDAGERPIYLGDLARRYPAARLVFSGGSGFIAGGMAEADIVSRQADV 150

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
             +    + +  ++ NT  NA  ++A  +       L+VT  +HMPR     ++    V 
Sbjct: 151 IGVPRTRLILENRSRNTHENAAFSAALVKPKPGERWLLVTSAWHMPRAVGCFRQAGFAVD 210

Query: 147 FIPYPIISHDLEENSSIFKIKILRVL-----LIEYLKILLLSI 184
             P    +    + +         +L     + E++ ++   +
Sbjct: 211 AFPVDYRTRGWSDVAHFHGFASDGLLQFDLAVKEWIGLVAYRL 253


>gi|254504841|ref|ZP_05116992.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222440912|gb|EEE47591.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 268

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 69/229 (30%), Gaps = 49/229 (21%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM------HIPDHPSVSAIVVL--------TGEP 47
           R+ W G    +I    GF      + Q          +  S + +++L        TG  
Sbjct: 41  RFIWVGALGLVI---CGFSPAANLLIQPLEDRFSRPAELGSFNGVIILGGAVDTVVTGAR 97

Query: 48  I---------RIERAFELLEN----------QIGEKIFISGVHHSVSKDILLQKIPIRQD 88
                     R+  A  L +             G    I+G     ++     ++     
Sbjct: 98  GETALTVSGERLTIAARLAKQLPEALIIHTGGQGT--IITG---QATESEGASRLFDDFG 152

Query: 89  LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFI 148
           +A   I +  ++ NT  NA       +       L+VT  YHMPR+    +         
Sbjct: 153 IASQRIILEDESRNTWENAVLTKELVDPKPGQTWLLVTSAYHMPRSMGVFEAAG-WTGVT 211

Query: 149 PYPIISHDLEENSSI----FKIKILRVL---LIEYLKILLLSIQLSLST 190
            YP+                  K LR L   + E++ + +  +    S 
Sbjct: 212 AYPVDYRTRGGADWGLGFDGASKGLRRLDIGVREWIGLTVYWMTGRSSA 260


>gi|91782979|ref|YP_558185.1| putative lipoprotein transmembrane [Burkholderia xenovorans LB400]
 gi|91686933|gb|ABE30133.1| Putative lipoprotein transmembrane [Burkholderia xenovorans LB400]
          Length = 225

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 66/185 (35%), Gaps = 34/185 (18%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVS--------AIVVLTGEP---------- 47
             +    +F+++        +  +  P   + +        AI++L G            
Sbjct: 10  LAVCTAALFWLLAAGWLTAPLLHLAQPRSQTDAPARFAPRTAIIMLGGGTVYDDNHVLVP 69

Query: 48  -----IRIERAFELLEN-QIGE---KIFISGVHH---SVSKDILLQKIPIRQDLAECCID 95
                 RI  + +     +  E    + +SG +    S ++        +RQ +    I 
Sbjct: 70  PRDVLARITASAQNYAACKRAEATCHVIVSGGNPQRHSATEADTYLPYLLRQQVPRADIV 129

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +   +  T  NA+  SA  E + +  +++VT  Y MPR  L+  R      F P P+IS+
Sbjct: 130 LENSSRTTYENARNVSAILEGSRYDSLILVTSAYQMPRAMLDFHRFG----FAPQPMISN 185

Query: 156 DLEEN 160
                
Sbjct: 186 ARRAR 190


>gi|260779195|ref|ZP_05888087.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605359|gb|EEX31654.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 267

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 51/117 (43%), Gaps = 9/117 (7%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     ++    G K+ +SG      VS   ++ K+ +   +++  I +   A +T
Sbjct: 105 GLMRLAEGIRIMRIYPGSKLILSGYAGGSEVSNARMMAKVALALGVSKSDIILLETAKDT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
              A++A+A+ ++     +++VT   HM R   E           PYP  ++ L  +
Sbjct: 165 WEEARQAAAFVKRKK---LVVVTSASHMKRALNEFHSAG----LKPYPAPTNYLAHD 214


>gi|317064197|ref|ZP_07928682.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689873|gb|EFS26708.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 241

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 34/151 (22%), Positives = 59/151 (39%), Gaps = 11/151 (7%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           G   RI +  +   N+  +KI+ISG        S+  + ++  +   +    I I  K+ 
Sbjct: 91  GANARIIKTAQFY-NKYPKKIYISGGSPLQNKESESSVYKRELVALGIPSENIVIEEKSR 149

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN- 160
           NT  NA       E +     +++T  +H+PR+          + F P P      +E  
Sbjct: 150 NTRENALYIRKMMEGSKEKKAVLITSAFHIPRSVKTFDDGEGGLIFYPAPCDFMAKKEAE 209

Query: 161 ------SSIFKIKILRVLLIEYLKILLLSIQ 185
                       K L +LL EY+ +L   I+
Sbjct: 210 NFFDYIPEYTNFKKLGILLKEYIGMLYYRIR 240


>gi|257469971|ref|ZP_05634063.1| hypothetical protein FulcA4_11568 [Fusobacterium ulcerans ATCC
           49185]
          Length = 252

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 34/151 (22%), Positives = 59/151 (39%), Gaps = 11/151 (7%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           G   RI +  +   N+  +KI+ISG        S+  + ++  +   +    I I  K+ 
Sbjct: 102 GANARIIKTAQFY-NKYPKKIYISGGSPLQNKESESSVYKRELVALGIPSENIVIEEKSR 160

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN- 160
           NT  NA       E +     +++T  +H+PR+          + F P P      +E  
Sbjct: 161 NTRENALYIRKMMEGSKEKKAVLITSAFHIPRSVKTFDDGEGGLIFYPAPCDFMAKKEAE 220

Query: 161 ------SSIFKIKILRVLLIEYLKILLLSIQ 185
                       K L +LL EY+ +L   I+
Sbjct: 221 NFFDYIPEYTNFKKLGILLKEYIGMLYYRIR 251


>gi|229592788|ref|YP_002874907.1| hypothetical protein PFLU5409 [Pseudomonas fluorescens SBW25]
 gi|229364654|emb|CAY52578.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 253

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 49/157 (31%), Gaps = 24/157 (15%)

Query: 36  SVSAIVVLTGEPIRIE--------RAFELLENQIGEKI--------FISGV-HHSVSKDI 78
              AIVVL     R +            L   +   ++          +G  H+      
Sbjct: 79  RADAIVVLGSGRERGDPAWGTDQPTGIGLERQRYAARLAKASGLPVLTTGGLHYGTPPSE 138

Query: 79  LLQKIPIRQDLAECCIDI-GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
                   QD     +     ++  T  NAQ ++          V++VT  +HMPR+   
Sbjct: 139 AALMAVSMQDDFGVTVRWKEERSRTTWENAQMSAEILLPEGIKRVVVVTQAWHMPRSVWS 198

Query: 138 LQRINSTVQFIPYPI----ISHDLEENSSIFKIKILR 170
            ++       +P P+    + +       + + K + 
Sbjct: 199 FEKA--GFTVVPAPVGFLGVDNARPLGGWMPEFKSVW 233


>gi|148241344|ref|YP_001226501.1| hypothetical protein SynRCC307_0245 [Synechococcus sp. RCC307]
 gi|147849654|emb|CAK27148.1| Conserved hypothetical protein [Synechococcus sp. RCC307]
          Length = 186

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 54/151 (35%), Gaps = 9/151 (5%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIR 86
            ++  P  P    I+VL G+  R ++A  L        +   G +         Q +   
Sbjct: 22  PRLLEPWMPPPQMILVLGGDVEREKQAAALARQSNLPVLITGGSNP-----EYAQWVFEG 76

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI--NST 144
           Q +    + + Y A +T  N         +    HVL+VT   HM R  L  + +  +  
Sbjct: 77  QGVDAQKLQLDYAARDTLSNFTTLVDRLRRRGIRHVLLVTSSDHMDRALLVGRVVAGSRG 136

Query: 145 VQFIPYPIISHD--LEENSSIFKIKILRVLL 173
           +   P P+   D    E  S      +R L+
Sbjct: 137 IHLTPVPVPCGDDCRPERRSKVWGDGVRALV 167


>gi|83589867|ref|YP_429876.1| hypothetical protein Moth_1019 [Moorella thermoacetica ATCC 39073]
 gi|83572781|gb|ABC19333.1| Protein of unknown function DUF218 [Moorella thermoacetica ATCC
           39073]
          Length = 461

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 70/193 (36%), Gaps = 23/193 (11%)

Query: 8   LFVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVL-----TGEPI-----RIERAFEL 56
           +F  LI  I+G    +I +      P       I+VL        P      RI  A  L
Sbjct: 10  IFAALITLILGSTYWYIEWFGWNTAP--KRADVIIVLGAAVWANGPSPALMERITLAETL 67

Query: 57  LENQIGEKIFISG-VHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
            +      +  +G +  S         +++ I   +    I     + NT  N   A   
Sbjct: 68  YQQVYAATLITTGGIGRSNPTPEGSAARQVLISHGIPANVIYEEVTSSNTRENLVGALNI 127

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
             K+ +   +IVTHD+H+ R   E +R+          +    + E +      +LR ++
Sbjct: 128 MRKHGWKSAVIVTHDFHLLRAMTEARRLGIE-------VSGAGVHETAMFRPPLVLREVI 180

Query: 174 IEYLKILLLSIQL 186
              +K +  ++Q+
Sbjct: 181 ANLVKAIGYNLQM 193


>gi|168183333|ref|ZP_02617997.1| putative sanA protein [Clostridium botulinum Bf]
 gi|237793971|ref|YP_002861523.1| putative SanA protein [Clostridium botulinum Ba4 str. 657]
 gi|182673423|gb|EDT85384.1| putative sanA protein [Clostridium botulinum Bf]
 gi|229261043|gb|ACQ52076.1| putative SanA protein [Clostridium botulinum Ba4 str. 657]
          Length = 222

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 66/174 (37%), Gaps = 27/174 (15%)

Query: 2   RYFWYGLFVCLIF-FIMGFISFIRYVKQ----MHIPDHPSVSAIVVLTGE---------- 46
           R     + + LI    + FI F    +     ++  D P   AI+VL G           
Sbjct: 7   RILMVIIVIALIGTAAIFFIDFKVRSESKKYIVNPKDVPEAEAILVL-GAYVKPNGKLCD 65

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALN 102
               R+    +L +N   +K+  SG H  V+ D +  ++K+  ++ + +  I + +   +
Sbjct: 66  MLEDRVAVGIDLYKNNKAKKLLFSGDHGQVNYDEVNGMKKVAEKKGVKKEDIFLDHAGFS 125

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           T  +   A    +      ++IVT  YH+ R       I   +    Y + S  
Sbjct: 126 TYESMYRAKEIFKAKK---IIIVTQQYHLMRAV----YIARQLGLDAYGVNSDQ 172


>gi|325661886|ref|ZP_08150507.1| hypothetical protein HMPREF0490_01245 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471864|gb|EGC75081.1| hypothetical protein HMPREF0490_01245 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 241

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 60/150 (40%), Gaps = 21/150 (14%)

Query: 5   WYGLFVCLIFFIMGFISFIRYV---KQMHIPDHPSVSAIVVLTGEPI------------R 49
           W    +  + FI  F+ F   V     M       +  I+VL                 R
Sbjct: 54  WLQYILLTLNFIAYFVFFAVQVIICSAMLTLPPKKLDVIIVL--GAQVRGKKITNSLKRR 111

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++R  E L+     ++ +SG       V++   + +  +   +AE  I +  K+ NT  N
Sbjct: 112 LDRGIEYLKENPETRVVVSGGQGKGEDVTEAFAMAQYLVSHGIAEEQISLEEKSRNTYEN 171

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
            + ++   +  +   + IV++++H+ R+ L
Sbjct: 172 LKYSALLVDSMD-DRIGIVSNNFHIYRSLL 200


>gi|87301819|ref|ZP_01084653.1| hypothetical protein WH5701_00800 [Synechococcus sp. WH 5701]
 gi|87283387|gb|EAQ75342.1| hypothetical protein WH5701_00800 [Synechococcus sp. WH 5701]
          Length = 194

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 63/180 (35%), Gaps = 23/180 (12%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           + ++  + G +  +     +    HP +  I+VL G+  R + A  L     G  + +SG
Sbjct: 4   LLVMALLAGALIVVGRGLLLPSLGHPQL--ILVLGGDIEREKLAGRLAHRD-GLPLLVSG 60

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
             +      L  +  + +        + Y+A +T GN        ++   HHVL+VT   
Sbjct: 61  GSNPEYAQWLFSQEGLDRRQFR----LDYRARDTLGNFTTVVDDLKRLGIHHVLLVTSSD 116

Query: 130 HMPRTFL--ELQRINSTVQFIPYPII--------------SHDLEENSSIFKIKILRVLL 173
           HM R  L   +   +  +   P  +                  L   + +   + LR   
Sbjct: 117 HMDRALLVGRIVAGSRGIHLTPVAVPCGDRCLPEGRRKVWGDGLRAAAWVLTGRDLRSWA 176


>gi|160881431|ref|YP_001560399.1| hypothetical protein Cphy_3306 [Clostridium phytofermentans ISDg]
 gi|160430097|gb|ABX43660.1| protein of unknown function DUF218 [Clostridium phytofermentans
           ISDg]
          Length = 189

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 63/150 (42%), Gaps = 11/150 (7%)

Query: 40  IVVLTGE--PIRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAEC 92
           I+++ G   P  +E+A +LLE  + + I  SG  +       ++   L+ I I++ ++  
Sbjct: 23  IILIPGGSHPQLMEKAVDLLEMGMAKYILPSGGKNKKLPDYPNEADFLKTIAIKRGISSD 82

Query: 93  CIDIGYKALNTEGNAQEASAWAEKN--NFHHVLIVTHDYHMPRTFLELQRINS-TVQFIP 149
            I    KA NT  NA  +         +   V++V   YH  R     Q++      F  
Sbjct: 83  IIICENKATNTYENALFSYELLMGKCIDITKVILVCKAYHSRRALFSYQKVFPANTTFFV 142

Query: 150 YPI-ISHDLEENSSIFKIKILRVLLIEYLK 178
            P+  +  + + +   +   + +++ E  K
Sbjct: 143 CPVTDNRGITKENWFTRNDYIELIMREVEK 172


>gi|260459193|ref|ZP_05807448.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034747|gb|EEW36003.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
          Length = 265

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 60/188 (31%), Gaps = 37/188 (19%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRIERAFELLENQI-----GEKIF---------------IS 68
              P    V  IVVL G     E A  L          G+++                +S
Sbjct: 70  ARPPLPQKVDGIVVLGGGF---EGAINLTRGGYELSSSGDRMVETAILARRFPQAKVVVS 126

Query: 69  GVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           G +               ++     ++   + +  K+ NT  NA  +    E       L
Sbjct: 127 GGNGSLFLDGEGDADTAPRLLGPLGVSADRLVLEDKSRNTYENAVFSRKLVEPKPGETWL 186

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPII-------SHDLEENSSIFKIKILRVLLIEY 176
           +VT  +HMPR      +       +P+P+           L  +++   ++   + + E+
Sbjct: 187 LVTSAFHMPRAKALFDKA--GFPTVPWPVDYRTSGKEGVGLFRDNAADSLENTTMAIREW 244

Query: 177 LKILLLSI 184
           + +    +
Sbjct: 245 IGLFAYWL 252


>gi|186476497|ref|YP_001857967.1| hypothetical protein Bphy_1739 [Burkholderia phymatum STM815]
 gi|184192956|gb|ACC70921.1| protein of unknown function DUF218 [Burkholderia phymatum STM815]
          Length = 228

 Score = 64.1 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 67/183 (36%), Gaps = 37/183 (20%)

Query: 6   YGLFVCLIFFIMGFISFIRYV------------KQMHIPDHPSVSAIVVL-TGEPIR--- 49
            G    ++F+ +G     + +            + +    + + +AIV+L TG   R   
Sbjct: 10  IGTTTIVLFWAVGAGWLAQPLLDLAQRGAPPGGQTVAPATYAAHTAIVLLGTGTVHRDGK 69

Query: 50  ----------IERAFELLENQIGE----KIFISGVHH---SVSKDILLQKIPIRQDLAEC 92
                     I  + +L            + +SG +      ++        +R+++   
Sbjct: 70  LVPPRDAIARIAMSADLYARCKQVSSVCHVIVSGGNPQEHEATEADTYLPYLLREEVPRG 129

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I +  +++ T  NA+  +A      +  +++VT  Y MPR  L   R        P P+
Sbjct: 130 DIILENRSMTTYENARNVAAILPDGYYGSLMLVTSAYQMPRALLNFHRFGMN----PLPV 185

Query: 153 ISH 155
           +S+
Sbjct: 186 VSN 188


>gi|87123192|ref|ZP_01079043.1| hypothetical protein RS9917_05015 [Synechococcus sp. RS9917]
 gi|86168912|gb|EAQ70168.1| hypothetical protein RS9917_05015 [Synechococcus sp. RS9917]
          Length = 250

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/199 (16%), Positives = 57/199 (28%), Gaps = 37/199 (18%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLTGEPI------- 48
           R+   G    L FF +G +            +++     P+  AIVVL+G          
Sbjct: 32  RWPLIGALALLWFFSLGLVSQVLWRWLEAPWQRLPAAAAPTADAIVVLSGGRHPAPGAAR 91

Query: 49  --------RIERAFELLENQIGEKIFISGVHHSVSK---DILLQKIPIRQDLAECCIDIG 97
                   R     +L       ++  +G              + +   + L      I 
Sbjct: 92  VSEWEDPDRFLAGLDLYRAGKAPRLLFTGGASPFRPGQPPEGQRYLAEAEQLG-----IP 146

Query: 98  YKAL-------NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
            +A+       NT   A       +  +   +L+VT  +HM R     +R    V+  P 
Sbjct: 147 SEAMASTPVVVNTAEEAVAIRRLLQAPSAR-ILLVTSAFHMRRAQRLFERQGLEVKPFPV 205

Query: 151 PIISHDLEENSSIFKIKIL 169
              +      S        
Sbjct: 206 DFQTRGAWAGSLWRDPSQW 224


>gi|218779182|ref|YP_002430500.1| hypothetical protein Dalk_1331 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760566|gb|ACL03032.1| protein of unknown function DUF218 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 178

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 67/157 (42%), Gaps = 16/157 (10%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECC-IDIGYKAL 101
            +G   R+E  + L +  + E + IS    +   +  L+    R  L +     +  KA 
Sbjct: 2   FSGAVSRVEATYGLAKEGLAESLVIS---PAT--EQSLRFYKNRYGLPDSVNQVLEPKAR 56

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEE 159
            T  NA       ++  +++V++VTH++HMPR++  L+ +     V+   Y +    +E 
Sbjct: 57  TTFENALLCGEIIKREGWNNVILVTHEHHMPRSYFLLRWVLLGEGVEIQRYGVPLRSIEG 116

Query: 160 NSSIFKIKILRVLLIEYL-------KILLLSIQLSLS 189
                 I  L+++  E +       + +L  I+  L 
Sbjct: 117 REVSTTID-LKIMYNEMVDLWGSLGEWVLYKIRGRLP 152


>gi|297538308|ref|YP_003674077.1| hypothetical protein M301_1116 [Methylotenera sp. 301]
 gi|297257655|gb|ADI29500.1| protein of unknown function DUF218 [Methylotenera sp. 301]
          Length = 227

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 49/132 (37%), Gaps = 8/132 (6%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKA 100
           LTG   R++    L +  +   + +SG   +     + +  +   R    +  I +  ++
Sbjct: 86  LTG---RVDEGLLLAQQGLVSTLLMSGGLDYEDERIEAVTMEAHARSKGFQGEILLESRS 142

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRINSTVQFIPYPIISHDLE 158
            +T  N   +    E  +  +++I +  YHM R    +E   +   +  + Y   S    
Sbjct: 143 SSTLENLTFSRPILEAADIKNIIITSEPYHMWRVKKLVEAGHLGRKIN-VSYAAASSQCW 201

Query: 159 ENSSIFKIKILR 170
            N  +     LR
Sbjct: 202 VNWGMAFKGALR 213


>gi|78189450|ref|YP_379788.1| hypothetical protein Cag_1489 [Chlorobium chlorochromatii CaD3]
 gi|78171649|gb|ABB28745.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 235

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 59/165 (35%), Gaps = 6/165 (3%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHHSV---SKDILLQ 81
           +  +          IVVL G+   R+++  EL  +   +K+ ++G+       S+    +
Sbjct: 53  LLSLPASKPQKADVIVVLGGDKGLRVQKGAELYNDGFSKKVLLTGIDRRYYRPSRPNWRE 112

Query: 82  KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
           +      + +  I +  K+  +   A   +A  E+  +   ++V+   HM R +L     
Sbjct: 113 RRIRDLGVKKSAIVVDTKSQTSWEEAMNTAATMERRKWESAIVVSDPPHMLRLWLTWHHA 172

Query: 142 NSTVQFIPYPIISHDLEENS--SIFKIKILRVLLIEYLKILLLSI 184
            +        + +     +           + ++ E  K +   +
Sbjct: 173 FAGTSKRFTLVATKPDWWHPIFWWKHKTNYKFVVSELKKNIAYVV 217


>gi|307319303|ref|ZP_07598732.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|306895139|gb|EFN25896.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
          Length = 262

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 56/177 (31%), Gaps = 30/177 (16%)

Query: 1   MRYFWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLTGE------------ 46
           +  F   +    +F   G  F+  +        P+   ++ I+VL G             
Sbjct: 40  LSAFGLAVLFVTLFTTAGSYFLQILEDRFPRPTPEPTELACIIVLGGAFENVVMASRGGM 99

Query: 47  -----PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGY--- 98
                  R      L +     +I +SG     S   + +      +       IG    
Sbjct: 100 ELNQAAERFVETLRLAQAYPQARILVSGGD--GSLSGIYEGDAHASENFFGTFGIGSDRL 157

Query: 99  ----KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
               ++  T  NA+       KN      +VT  YHMPR+    +   + ++  P+P
Sbjct: 158 IRAGESRTTFENARYTRDLLAKNGLERCALVTSAYHMPRSIGLFRA--NGMEVTPWP 212


>gi|149191740|ref|ZP_01869980.1| hypothetical protein VSAK1_04082 [Vibrio shilonii AK1]
 gi|148834429|gb|EDL51426.1| hypothetical protein VSAK1_04082 [Vibrio shilonii AK1]
          Length = 297

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 63/162 (38%), Gaps = 11/162 (6%)

Query: 49  RIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L    G K+ +SG      VS    + K+ +   +A+  I +   A +T   
Sbjct: 108 RLSEGIRILRMYPGAKLILSGYDGGTGVSHARTMAKVALALGIAKPDIILLETAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           A++A+ + +      +++VT   HM R   E +         P   ++    E +     
Sbjct: 168 ARQAAGFVQNKK---LVLVTSASHMKRAMHEFEAAGLNPLPAPTNFLAQKDIEQAWQKYT 224

Query: 167 KILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIE 202
              R L        E + ++  +++  ++ +   +F  ++ E
Sbjct: 225 PSSRYLEQTERYWHETMGLIWQNLRDWVANEGNQEFLPSVSE 266


>gi|28211594|ref|NP_782538.1| membrane associated protein [Clostridium tetani E88]
 gi|28204035|gb|AAO36475.1| membrane associated protein [Clostridium tetani E88]
          Length = 192

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 50/114 (43%), Gaps = 3/114 (2%)

Query: 49  RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RIE  + L +   G  I  SG      S+S+   +++  I + + E  I    K+ +T  
Sbjct: 60  RIEEGYRLYKEGYGRYILASGGKGPGESISEAEAMKRYLISKGIKEEYIIKEDKSTSTME 119

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           N +  +   EK    + +IV++ YH+ R  L  +++     F    + S+   E
Sbjct: 120 NLKNCNKIMEKKGLKNAVIVSNKYHLKRASLMTKKVGIDSSFSGVYVTSYKKHE 173


>gi|170744388|ref|YP_001773043.1| hypothetical protein M446_6345 [Methylobacterium sp. 4-46]
 gi|168198662|gb|ACA20609.1| protein of unknown function DUF218 [Methylobacterium sp. 4-46]
          Length = 273

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 59/180 (32%), Gaps = 15/180 (8%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHH 72
           +  + G ++     ++     +     +V       R   A  +           SG   
Sbjct: 84  VVVLGGALAEGIRAERGAPGLNREADRLVAFAALARRYPAAKLVFAGGPA-----SGRRE 138

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
            +++    + +     L    + +  ++ +T  NA EA A A        L+VT   HMP
Sbjct: 139 GLTEAQASRALLEEIGLPPGRLLVDDRSRSTWENAVEARALARPGPGETWLLVTSASHMP 198

Query: 133 RTFLELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRVLLI-----EYLKILLLSIQ 185
           R     +R         + +P+        ++  +    ++  I     E+  +L   ++
Sbjct: 199 RAMGAFRRAGWPP---LLAWPVAYRTTRRGAAALRPLGAKLAAIDLAAHEWAGLLAYRLR 255


>gi|53719541|ref|YP_108527.1| hypothetical protein BPSL1927 [Burkholderia pseudomallei K96243]
 gi|126452373|ref|YP_001066022.1| hypothetical protein BURPS1106A_1753 [Burkholderia pseudomallei
           1106a]
 gi|167816053|ref|ZP_02447733.1| hypothetical protein Bpse9_12987 [Burkholderia pseudomallei 91]
 gi|167824429|ref|ZP_02455900.1| hypothetical protein Bpseu9_12213 [Burkholderia pseudomallei 9]
 gi|167845961|ref|ZP_02471469.1| hypothetical protein BpseB_11780 [Burkholderia pseudomallei B7210]
 gi|226199704|ref|ZP_03795257.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242315371|ref|ZP_04814387.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254179990|ref|ZP_04886589.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254297823|ref|ZP_04965276.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|52209955|emb|CAH35927.1| putative exported protein [Burkholderia pseudomallei K96243]
 gi|126226015|gb|ABN89555.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|157807296|gb|EDO84466.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|184210530|gb|EDU07573.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|225928290|gb|EEH24324.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242138610|gb|EES25012.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 240

 Score = 63.7 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 48/122 (39%), Gaps = 11/122 (9%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +    ++ 
Sbjct: 91  RIDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R      F P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFG----FAPQPVYANRRDARL 206

Query: 162 SI 163
             
Sbjct: 207 GW 208


>gi|224542305|ref|ZP_03682844.1| hypothetical protein CATMIT_01484 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524754|gb|EEF93859.1| hypothetical protein CATMIT_01484 [Catenibacterium mitsuokai DSM
           15897]
          Length = 210

 Score = 63.7 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/198 (18%), Positives = 66/198 (33%), Gaps = 19/198 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IR 49
           M+     + +  +     F + +         D  +    +VL G              R
Sbjct: 11  MKILKKLIIIVALVICYVFSNAVSIYIYSFKDDARNADVAIVL-GASTYNGHPSPVYQER 69

Query: 50  IERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           I  A +L    + +KI ++G +     VS     +   + Q + E  +    ++  T  N
Sbjct: 70  INHAVDLYNKHLVKKIIMTGGYGKGNPVSDAYNAKLYAVSQGVPEDDVLTEDQSTVTLEN 129

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
              A    +  N+   LIV+   HM R  L+          I Y   +H     +   K 
Sbjct: 130 LINAKKIMDVYNYQTALIVSDPLHMKRAMLQ----AKDAGIIAYTSPTHSSRFRTRDTKF 185

Query: 167 KILRVLLIEYLKILLLSI 184
           K L+  +I Y+      +
Sbjct: 186 KFLKREVINYIGYKWYRL 203


>gi|121604040|ref|YP_981369.1| hypothetical protein Pnap_1132 [Polaromonas naphthalenivorans CJ2]
 gi|120593009|gb|ABM36448.1| protein of unknown function DUF218 [Polaromonas naphthalenivorans
           CJ2]
          Length = 259

 Score = 63.7 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/139 (18%), Positives = 52/139 (37%), Gaps = 22/139 (15%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKA 100
           V  TG         +                 + S+  +  ++ ++             +
Sbjct: 127 VAFTGGTGWAADGMQ-----------------TASEAEVAAQVALQDYGFTLRWS-ESAS 168

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP----YPIISHD 156
            +T GNA+  +   +++    + +VTH +HMPR     +R   +V   P     PI +H 
Sbjct: 169 RDTSGNARLLAPLLQRDGVQRIALVTHSWHMPRALAAFERAGLSVTPAPMGFTEPIENHL 228

Query: 157 LEENSSIFKIKILRVLLIE 175
           L+   S   ++  R++L E
Sbjct: 229 LQWLPSAQGLQASRLVLRE 247


>gi|53724817|ref|YP_102769.1| hypothetical protein BMA1073 [Burkholderia mallei ATCC 23344]
 gi|67641348|ref|ZP_00440128.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|121599410|ref|YP_992846.1| hypothetical protein BMASAVP1_A1516 [Burkholderia mallei SAVP1]
 gi|124385403|ref|YP_001026188.1| hypothetical protein BMA10229_A0183 [Burkholderia mallei NCTC
           10229]
 gi|134282282|ref|ZP_01768987.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|167003067|ref|ZP_02268857.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|167719831|ref|ZP_02403067.1| hypothetical protein BpseD_12495 [Burkholderia pseudomallei DM98]
 gi|254178040|ref|ZP_04884695.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254188599|ref|ZP_04895110.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254199716|ref|ZP_04906082.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254206038|ref|ZP_04912390.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254358413|ref|ZP_04974686.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52428240|gb|AAU48833.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|121228220|gb|ABM50738.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124293423|gb|ABN02692.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|134246320|gb|EBA46409.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|147749312|gb|EDK56386.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147753481|gb|EDK60546.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|148027540|gb|EDK85561.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157936278|gb|EDO91948.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160699079|gb|EDP89049.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|238522267|gb|EEP85712.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|243061318|gb|EES43504.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
          Length = 240

 Score = 63.7 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 48/122 (39%), Gaps = 11/122 (9%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +    ++ 
Sbjct: 91  RIDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R      F P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFG----FAPQPVYANRRDARL 206

Query: 162 SI 163
             
Sbjct: 207 GW 208


>gi|167854576|ref|ZP_02477357.1| hypothetical protein HPS_02329 [Haemophilus parasuis 29755]
 gi|167854331|gb|EDS25564.1| hypothetical protein HPS_02329 [Haemophilus parasuis 29755]
          Length = 247

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 53/137 (38%), Gaps = 30/137 (21%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP-----------------IRIERAFELLENQIGEKIFISG 69
             + I D+ S  AIV+L+G                    R+  A   L+ + G  + I+G
Sbjct: 68  DNLSIEDYKSAQAIVLLSGGLRDSKELFGKLAISEIALERVRYA-AFLQKETGLPLLITG 126

Query: 70  VHH------SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
                    +V K  L Q   I          +  KA  T  NA+ +    EK   + ++
Sbjct: 127 SSPKGTSEAAVMKKELEQFFHIPTQW------LEEKAKTTAENAKFSKPILEKEGINKIV 180

Query: 124 IVTHDYHMPRTFLELQR 140
           +VT+ +HM R  +  +R
Sbjct: 181 LVTNQWHMQRARMLFER 197


>gi|284039129|ref|YP_003389059.1| hypothetical protein Slin_4276 [Spirosoma linguale DSM 74]
 gi|283818422|gb|ADB40260.1| protein of unknown function DUF218 [Spirosoma linguale DSM 74]
          Length = 272

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/243 (18%), Positives = 78/243 (32%), Gaps = 67/243 (27%)

Query: 1   MRYFWYGLFVCLIFFIMG---------FISFIRYVKQMHIPDHPSVSAIVVLTGE----- 46
           +R    GL +  +F++ G                   MH P        +VLTG      
Sbjct: 34  LRRQLIGLALG-VFWLFGNSFLVNELALWWEYPIKPDMHAPGDSVKRVAIVLTGGMINGE 92

Query: 47  ---------------------PIRIERAFELLENQIGEKIFISGV------------HHS 73
                                  RI +A  L +    +K+ ISG                
Sbjct: 93  REAPGKPLNRTHLARFLLGREADRIGQALYLYKTGAVQKVLISGGLGSWPFQPISLNDEG 152

Query: 74  VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN----NFHHVLIVTHDY 129
                LL    +R +     I +  K+ NT  NA+ ++    K+    ++ +V ++T  +
Sbjct: 153 HLAGELLIIAGVRPE----DIMLEGKSRNTHENARFSAPILRKHFDKAHYEYV-LITSAW 207

Query: 130 HMPRTFLELQRINSTVQFIPYP---IISHDLEENSSIFKIKILRV-----LLIEYLKILL 181
           HM R     Q+    VQ IP+P   + +  L   +               L+ E++  + 
Sbjct: 208 HMKRAIACFQK--EGVQTIPFPSNFLGNRRLSGPAEWLLPDEEAFFESYYLIREFVGYIT 265

Query: 182 LSI 184
             +
Sbjct: 266 YKV 268


>gi|189346479|ref|YP_001943008.1| hypothetical protein Clim_0953 [Chlorobium limicola DSM 245]
 gi|189340626|gb|ACD90029.1| protein of unknown function DUF218 [Chlorobium limicola DSM 245]
          Length = 197

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 7/189 (3%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQ 60
           RY    +   +      F+S + +              IVVL G+   R+E+  EL  N 
Sbjct: 7   RYLSIFILSVVTVTAAVFLS-LGFAVSYPAQKPEKADVIVVLGGDDGLRVEKGAELYNNG 65

Query: 61  IGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
               + ++G+        +    ++      + +  I +  ++  T   A  AS   +K 
Sbjct: 66  FAPNVLLTGIDARFYRPGRPNWRERRMRDLGVPKKAIRVDTESETTWEEAVNASETLQKQ 125

Query: 118 NFHHVLIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            +   ++V+   HM R     +R+   S+ + I                     R ++ E
Sbjct: 126 KWESAIVVSDPPHMLRIHQTWRRVFEGSSKKIILVSTEPDWWNALLWWKNKTSYRFVISE 185

Query: 176 YLKILLLSI 184
             K +    
Sbjct: 186 IKKNIYYYA 194


>gi|316933607|ref|YP_004108589.1| hypothetical protein Rpdx1_2264 [Rhodopseudomonas palustris DX-1]
 gi|315601321|gb|ADU43856.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           DX-1]
          Length = 264

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 61/192 (31%), Gaps = 34/192 (17%)

Query: 25  YVKQMHIPDH---PSVSAIVVLTG-----------------EPIRIERAFELLENQIGEK 64
            + + + P H    +   I+VL G                    R+    +L       +
Sbjct: 64  SLSERYPPWHDTGRAPDGIIVLGGAINSEVSAARNTVELDASAERVLATLDLARRYPQAR 123

Query: 65  IFISG-----VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           I  SG     +  S ++  L  ++  R  LA   + +  ++  T  NA    A       
Sbjct: 124 IVYSGGSGNLIQRSAAEAPLAGELLERFGLAAGRVVLEDQSRTTAENAANTRALVSPKPG 183

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR-------VL 172
              L+VT  +HMPR+ +  Q     V  + YP+                L        V 
Sbjct: 184 ELWLLVTSSFHMPRSIMAFQAAGFDV--VAYPVDWRTRGREDVALPFATLAAGLARTDVA 241

Query: 173 LIEYLKILLLSI 184
             E+  +L   +
Sbjct: 242 AHEWAGLLAYRL 253


>gi|304316432|ref|YP_003851577.1| hypothetical protein Tthe_0963 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777934|gb|ADL68493.1| protein of unknown function DUF218 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 191

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/140 (13%), Positives = 57/140 (40%), Gaps = 17/140 (12%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------------PIRIERAFELL 57
           +     ++  I+ ++ +   +     +  AI+VL                 R+  A +L 
Sbjct: 7   ITAFVVLLNIIAELQVITFAYNAKPVNSDAIIVL--GCAVYGKNPSPFFKERLSEAIKLY 64

Query: 58  ENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           +  +G+ I +SG       +S+    ++  ++  + +  + +   + +T  N + +    
Sbjct: 65  KEGLGKYIIVSGGKGPGEDISEAEAGKEYLLKNGITDNVVLMDDGSYSTLQNLENSKKIM 124

Query: 115 EKNNFHHVLIVTHDYHMPRT 134
           ++ +    +IV++ +H+ R 
Sbjct: 125 DEKSLKTAIIVSNKFHLKRA 144


>gi|52424963|ref|YP_088100.1| hypothetical protein MS0908 [Mannheimia succiniciproducens MBEL55E]
 gi|52307015|gb|AAU37515.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 250

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 47/136 (34%), Gaps = 28/136 (20%)

Query: 27  KQMHIPDHPSVSAIVVLTGE-------PIRIER-AFELLENQIGEKI--------FISGV 70
             + + D+ S  AIVVL            +I      L   +    +         ISG 
Sbjct: 70  DNLTVEDYRSAQAIVVLGAGLRDSKELYNKITVPGIALERMRYAAYLHKETELPILISGA 129

Query: 71  HH-SVSKDILLQK-----IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
                S+  ++ +       ++         +  ++ NT+ NA       E+     +++
Sbjct: 130 GPNGNSEAKIMGQEFFTFFGVQPKW------LEERSTNTKQNALYTREMLEREGIKRIIL 183

Query: 125 VTHDYHMPRTFLELQR 140
           VT+ +HM R  L  + 
Sbjct: 184 VTNQWHMQRAKLLFEA 199


>gi|255065363|ref|ZP_05317218.1| putative SanA protein [Neisseria sicca ATCC 29256]
 gi|255050188|gb|EET45652.1| putative SanA protein [Neisseria sicca ATCC 29256]
          Length = 224

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 61/165 (36%), Gaps = 22/165 (13%)

Query: 7   GLFVCLIFFIMGFI-----SFIRYVKQMHIPDHPSVSAIVVLT-----GEP------IRI 50
            +F+ ++FF    +          V ++         A VVL+     G         R+
Sbjct: 33  LVFILVLFFTAALLPLWIMWRDFQVSRLDADTVRPADAAVVLSTRSYEGGRLNPCLVARV 92

Query: 51  ERAFELLENQIGEKIFISGVHHS--VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           E A EL      +K+ +SG       S    +Q I  +  +++  I    +A NT  N  
Sbjct: 93  EAAVELYRAGKVKKLVMSGGLSRDFQSASGNMQAIAEKMGVSKEDIIQERRAENTFENIV 152

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRINSTVQFIPYP 151
            +  + E  N   V+IV+  +H+ R     + Q     +Q    P
Sbjct: 153 FSRDFIE--NSPRVVIVSAGFHLARAQMMADRQWQGHDIQVYAAP 195


>gi|187923614|ref|YP_001895256.1| hypothetical protein Bphyt_1622 [Burkholderia phytofirmans PsJN]
 gi|187714808|gb|ACD16032.1| protein of unknown function DUF218 [Burkholderia phytofirmans PsJN]
          Length = 262

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 65/182 (35%), Gaps = 34/182 (18%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVS--------AIVVLTGEP---------- 47
             +F    F+++        + ++  P   + +        AI++L G            
Sbjct: 47  LAIFTVAFFWLLAAGWLTAPLLRLAQPHWRTEAPATFAPRTAIIMLGGGTIYGAGQVLMP 106

Query: 48  -----IRIERAFELLEN-QIGE---KIFISGVHH---SVSKDILLQKIPIRQDLAECCID 95
                 RI  + E     +       + +SG +      ++        +R+ +    I 
Sbjct: 107 PRDVLARIAASAEYYAACKRAADICHVIVSGGNPQRHRATEADTYLPYLLRRQVPRADIV 166

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +  ++L T  NA+  S     + +  ++++T  Y MPR  L+  R        P P+IS+
Sbjct: 167 LENRSLTTYENARNVSGIVHGSRYDSLILITSAYQMPRALLDFHRFG----LTPQPMISN 222

Query: 156 DL 157
            +
Sbjct: 223 AI 224


>gi|325578228|ref|ZP_08148363.1| hypothetical protein HMPREF9417_1104 [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159964|gb|EGC72093.1| hypothetical protein HMPREF9417_1104 [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 247

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 53/142 (37%), Gaps = 30/142 (21%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIR---------IERAFEL--------LENQIGEKIFISG 69
             + + D+    AIV+L G  +R              +L        L+ +    + I+G
Sbjct: 68  DHLTLQDYQQAQAIVLL-GGGLRDSKELYAPLASTGIQLERLRYAAFLQKETHLPLLITG 126

Query: 70  VHHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
              +      ++ + L     +          I  KAL T+ NA       EK   H ++
Sbjct: 127 ASPTGAIEAKIAAEELQNFFNVPTKW------IEPKALTTKENALFTKQMLEKEGIHKII 180

Query: 124 IVTHDYHMPRTFLELQRINSTV 145
           +VT+++HM R  L  Q+    V
Sbjct: 181 LVTNEWHMQRAKLLFQQQGFDV 202


>gi|77465405|ref|YP_354908.1| hypothetical protein RSP_3403 [Rhodobacter sphaeroides 2.4.1]
 gi|77389823|gb|ABA81007.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 280

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 57/154 (37%), Gaps = 27/154 (17%)

Query: 37  VSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECCID 95
             A V+ TG   R+    E+ E +I  +I +S GV  +                    + 
Sbjct: 135 PEARVLFTGGSGRL-FGAEIPEARIAREILVSAGVDPA-------------------RLI 174

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-- 153
           +  ++ NT  NA+ A A          L+VT  +HMPR              +P+P    
Sbjct: 175 LEGQSRNTAENARFAKALVANQGQGSWLLVTSAFHMPRAVETFCAAGWQ-DLVPWPTDYR 233

Query: 154 SHDLEENSSI---FKIKILRVLLIEYLKILLLSI 184
           +  L +         + +L V + E++ IL   +
Sbjct: 234 TASLRDGIGWDLARNLDLLNVAVREWIGILAYRV 267


>gi|294852515|ref|ZP_06793188.1| hypothetical protein BAZG_01442 [Brucella sp. NVSL 07-0026]
 gi|294821104|gb|EFG38103.1| hypothetical protein BAZG_01442 [Brucella sp. NVSL 07-0026]
          Length = 264

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 51/170 (30%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 215


>gi|17987093|ref|NP_539727.1| hypothetical protein BMEI0810 [Brucella melitensis bv. 1 str. 16M]
 gi|163843442|ref|YP_001627846.1| hypothetical protein BSUIS_A1225 [Brucella suis ATCC 23445]
 gi|189024327|ref|YP_001935095.1| hypothetical protein BAbS19_I11160 [Brucella abortus S19]
 gi|225852674|ref|YP_002732907.1| hypothetical protein BMEA_A1222 [Brucella melitensis ATCC 23457]
 gi|254689399|ref|ZP_05152653.1| hypothetical protein Babob68_04337 [Brucella abortus bv. 6 str.
           870]
 gi|254693883|ref|ZP_05155711.1| hypothetical protein Babob3T_04332 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697533|ref|ZP_05159361.1| hypothetical protein Babob28_07456 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701918|ref|ZP_05163746.1| hypothetical protein Bsuib55_13827 [Brucella suis bv. 5 str. 513]
 gi|254704463|ref|ZP_05166291.1| hypothetical protein Bsuib36_11145 [Brucella suis bv. 3 str. 686]
 gi|254710250|ref|ZP_05172061.1| hypothetical protein BpinB_08247 [Brucella pinnipedialis B2/94]
 gi|254714246|ref|ZP_05176057.1| hypothetical protein BcetM6_13021 [Brucella ceti M644/93/1]
 gi|254717682|ref|ZP_05179493.1| hypothetical protein BcetM_15020 [Brucella ceti M13/05/1]
 gi|254730428|ref|ZP_05189006.1| hypothetical protein Babob42_04352 [Brucella abortus bv. 4 str.
           292]
 gi|256031744|ref|ZP_05445358.1| hypothetical protein BpinM2_14019 [Brucella pinnipedialis
           M292/94/1]
 gi|256044830|ref|ZP_05447734.1| hypothetical protein Bmelb1R_10074 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113736|ref|ZP_05454540.1| hypothetical protein Bmelb3E_13258 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257645|ref|ZP_05463181.1| hypothetical protein Babob9C_09914 [Brucella abortus bv. 9 str.
           C68]
 gi|256263835|ref|ZP_05466367.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260168877|ref|ZP_05755688.1| hypothetical protein BruF5_11021 [Brucella sp. F5/99]
 gi|260546638|ref|ZP_05822377.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565570|ref|ZP_05836054.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260754918|ref|ZP_05867266.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758135|ref|ZP_05870483.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761961|ref|ZP_05874304.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883930|ref|ZP_05895544.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214170|ref|ZP_05928451.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261219524|ref|ZP_05933805.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261317810|ref|ZP_05957007.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322019|ref|ZP_05961216.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261752483|ref|ZP_05996192.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755142|ref|ZP_05998851.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758366|ref|ZP_06002075.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265988841|ref|ZP_06101398.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991256|ref|ZP_06103813.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995092|ref|ZP_06107649.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17982753|gb|AAL51991.1| putative membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|163674165|gb|ABY38276.1| protein of unknown function DUF218 [Brucella suis ATCC 23445]
 gi|189019899|gb|ACD72621.1| Protein of unknown function DUF218 [Brucella abortus S19]
 gi|225641039|gb|ACO00953.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|260095688|gb|EEW79565.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151638|gb|EEW86732.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668453|gb|EEX55393.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672393|gb|EEX59214.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675026|gb|EEX61847.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873458|gb|EEX80527.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915777|gb|EEX82638.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260924613|gb|EEX91181.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294709|gb|EEX98205.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297033|gb|EEY00530.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261738350|gb|EEY26346.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261742236|gb|EEY30162.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744895|gb|EEY32821.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262766205|gb|EEZ11994.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002040|gb|EEZ14615.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093964|gb|EEZ17898.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661038|gb|EEZ31299.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|326409195|gb|ADZ66260.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538905|gb|ADZ87120.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 264

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 51/170 (30%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 215


>gi|302392084|ref|YP_003827904.1| hypothetical protein Acear_1326 [Acetohalobium arabaticum DSM 5501]
 gi|302204161|gb|ADL12839.1| protein of unknown function DUF218 [Acetohalobium arabaticum DSM
           5501]
          Length = 264

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 12/104 (11%)

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           E   +L+ +         GV       S   +++++ +   + E  I +  KA NT  NA
Sbjct: 130 ETGLDLVVSG--------GVVPGADNTSGAEVMKEVLLDLGVKEDKIILEKKAKNTWQNA 181

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
              +   E+  +  +++VT   HM R     +R N   + IP P
Sbjct: 182 VNTALLLEEREYEQIILVTSALHMKRAVYSFER-NCNQRLIPAP 224


>gi|256159910|ref|ZP_05457632.1| hypothetical protein BcetM4_13019 [Brucella ceti M490/95/1]
 gi|256255144|ref|ZP_05460680.1| hypothetical protein BcetB_12801 [Brucella ceti B1/94]
 gi|261222341|ref|ZP_05936622.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265998306|ref|ZP_06110863.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920925|gb|EEX87578.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552774|gb|EEZ08764.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 264

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 51/170 (30%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 215


>gi|161619130|ref|YP_001593017.1| hypothetical protein BCAN_A1197 [Brucella canis ATCC 23365]
 gi|260566292|ref|ZP_05836762.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335941|gb|ABX62246.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|260155810|gb|EEW90890.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 264

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 51/170 (30%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 215


>gi|23502055|ref|NP_698182.1| hypothetical protein BR1177 [Brucella suis 1330]
 gi|62290089|ref|YP_221882.1| hypothetical protein BruAb1_1183 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700013|ref|YP_414587.1| hypothetical protein BAB1_1199 [Brucella melitensis biovar Abortus
           2308]
 gi|225627645|ref|ZP_03785682.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237815595|ref|ZP_04594592.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|256369602|ref|YP_003107112.1| hypothetical protein BMI_I1188 [Brucella microti CCM 4915]
 gi|297248487|ref|ZP_06932205.1| hypothetical protein BAYG_01444 [Brucella abortus bv. 5 str. B3196]
 gi|23348011|gb|AAN30097.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196221|gb|AAX74521.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616114|emb|CAJ11155.1| Protein of unknown function DUF218 [Brucella melitensis biovar
           Abortus 2308]
 gi|225617650|gb|EEH14695.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237788893|gb|EEP63104.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|255999764|gb|ACU48163.1| hypothetical protein BMI_I1188 [Brucella microti CCM 4915]
 gi|297175656|gb|EFH35003.1| hypothetical protein BAYG_01444 [Brucella abortus bv. 5 str. B3196]
          Length = 268

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 51/170 (30%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 52  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 111

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K+ NT
Sbjct: 112 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 171

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 172 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 219


>gi|331085682|ref|ZP_08334765.1| hypothetical protein HMPREF0987_01068 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406605|gb|EGG86110.1| hypothetical protein HMPREF0987_01068 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 241

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 59/150 (39%), Gaps = 21/150 (14%)

Query: 5   WYGLFVCLIFFIMGFISFIRYV---KQMHIPDHPSVSAIVVLTGEPI------------R 49
           W    +  + FI  F+ F   V     M       +  I+VL                 R
Sbjct: 54  WLQYILLTLNFIAYFVFFAVQVIICSAMLTLPPKKLDVIIVL--GAQVRGKKITNSLKRR 111

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++R    L+     ++ +SG       V++   + +  +   +AE  I +  K+ NT  N
Sbjct: 112 LDRGVAYLKENPETRVVVSGGQGKGEDVTEAFAMAQYLVSHGIAEEQISLEEKSRNTYEN 171

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
            + ++   +  +   + IV++++H+ R+ L
Sbjct: 172 LKYSALLVDSMD-DRIGIVSNNFHIYRSLL 200


>gi|114319324|ref|YP_741007.1| hypothetical protein Mlg_0162 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225718|gb|ABI55517.1| protein of unknown function DUF218 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 247

 Score = 63.3 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 55/180 (30%), Gaps = 24/180 (13%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPI-----------------RIERAFELLENQIGEKIFISG 69
             +         AIVVL                      R+  A   L  + G  +  SG
Sbjct: 64  PPVQPAQLRDAQAIVVLGAGYRSGADEFSGETVNDLALVRLRYA-AYLHRETGLPVIASG 122

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
              +  +        +  +     I    +A +T GNAQ  +    +     V +V+H +
Sbjct: 123 GAATDREPEARWMAEVLAEFGVDPILTESEARDTWGNAQHTAELLARQGLSRVALVSHAH 182

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSS------IFKIKILRVLLIEYLKILLLS 183
           HMPR     ++   TV   P           S          +++  + + EYL +    
Sbjct: 183 HMPRAVWAFEQAGVTVLPAPTGAFVPHDRGWSWGMLRPQANALRMSWLAMHEYLGLFWYR 242


>gi|323499476|ref|ZP_08104447.1| hypothetical protein VISI1226_09254 [Vibrio sinaloensis DSM 21326]
 gi|323315463|gb|EGA68503.1| hypothetical protein VISI1226_09254 [Vibrio sinaloensis DSM 21326]
          Length = 267

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 51/118 (43%), Gaps = 9/118 (7%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     ++    G K+ +SG      +S   ++ K+ +   +++  I +   A +T
Sbjct: 105 GLMRLAEGIRIMRIYPGSKLILSGYAGGSEISNARMMAKVALALGVSKSDIVLLETAKDT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
              A++A+A+ +      +++VT   HM R   E           PYP  ++ L  ++
Sbjct: 165 WEEARQAAAFVK---HRKLVVVTSASHMQRALNEFHSAG----LKPYPAPTNYLAHDN 215


>gi|239624750|ref|ZP_04667781.1| exported protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239521136|gb|EEQ61002.1| exported protein [Clostridiales bacterium 1_7_47FAA]
          Length = 239

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 70/188 (37%), Gaps = 26/188 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV----SAIVVL------TGEPI---- 48
           +    L  CL+ F++      +  K +   +          I+VL       G P     
Sbjct: 14  FLVLALAGCLVLFLVNLYIIRKEEKYIVSAEEARAFEDVDCIMVLGCGVRPDGSPSGMLN 73

Query: 49  -RIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEG 105
            R+ +   L +  + +++ +SG H  V+ D   L+++  I + +    I + +   +T  
Sbjct: 74  DRLVQGISLYKEDVSDRLLMSGDHGKVNYDEVNLMKQFAIDRGVPSENIFMDHAGFSTYE 133

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           +   A    +      ++IVT  YHM R       +   +    Y + S          K
Sbjct: 134 SMYRARDIFQ---VKKIVIVTQRYHMYRAL----YVAQAMGMEAYGVASDPRTYGG--QK 184

Query: 166 IKILRVLL 173
           ++ LR LL
Sbjct: 185 MRDLRELL 192


>gi|159044137|ref|YP_001532931.1| hypothetical protein Dshi_1588 [Dinoroseobacter shibae DFL 12]
 gi|157911897|gb|ABV93330.1| hypothetical protein Dshi_1588 [Dinoroseobacter shibae DFL 12]
          Length = 213

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 54/156 (34%), Gaps = 22/156 (14%)

Query: 1   MRYFW----YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           MR  W     G+ V + F +  F   + Y      P     +AIVVL+            
Sbjct: 4   MRALWQLCKIGVLVLMGFAVATFAGIVLY----EPPARSEYAAIVVLSHGVAADGTLSPQ 59

Query: 47  -PIRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              R +   +  E     K+  SG        SK  L+ +  I   L      +  ++ +
Sbjct: 60  TAARTQAGLDAFEAGYAPKVIFSGGLGGLEPASKGALMAEAAIAAGLPAEVAMVEGESHS 119

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           T  NA   +    +     VL+VTH YH  R+    
Sbjct: 120 TLQNALFTARLVPELRDQPVLLVTHRYHGMRSIASF 155


>gi|78187520|ref|YP_375563.1| hypothetical protein Plut_1666 [Chlorobium luteolum DSM 273]
 gi|78167422|gb|ABB24520.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 246

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 47/137 (34%), Gaps = 22/137 (16%)

Query: 26  VKQMHIPDHPSVSAIVVLTG---------------EPIRIERAFELLENQIGEKIFISGV 70
            +++         AIVVL G                  R E   +L        +  +G 
Sbjct: 61  ARRVPAASVAHADAIVVLGGMTMQLPGAPLGEWGEAADRFEAGIDLYREGKAPLLVFTGG 120

Query: 71  -----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
                 + V +  LL    ++ D+    + +   A NT   A  A+     +    +++V
Sbjct: 121 RLPWRENFVPEGELLALRALQLDIPRASVLVTGIAGNTSDEAGAAAELLGPS--KKIILV 178

Query: 126 THDYHMPRTFLELQRIN 142
           T  +HMPR+ L   R  
Sbjct: 179 TSAFHMPRSILLFHRAG 195


>gi|120402709|ref|YP_952538.1| hypothetical protein Mvan_1708 [Mycobacterium vanbaalenii PYR-1]
 gi|119955527|gb|ABM12532.1| protein of unknown function DUF218 [Mycobacterium vanbaalenii
           PYR-1]
          Length = 190

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 43/121 (35%), Gaps = 14/121 (11%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGEP--IRIERAFELLENQIGEKIFISGVHHSVS 75
           G   F        +       AIVVL G     R      L E      + +S  +   S
Sbjct: 29  GTFLFA----HSKVDPLARADAIVVL-GGEHDGRETYGLTLAEQGYAPVVLLS--NPYRS 81

Query: 76  KDILLQKIPIRQDLAE--CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR 133
           KD ++ K    +      C   +      T G A      A+K+ +  V++V+  YH+PR
Sbjct: 82  KDKVMAKACAPRTDIRVICRAPVPS---TTRGEAMMTRELADKHGWTTVIVVSWRYHLPR 138

Query: 134 T 134
            
Sbjct: 139 A 139


>gi|170760763|ref|YP_001786003.1| putative sanA protein [Clostridium botulinum A3 str. Loch Maree]
 gi|169407752|gb|ACA56163.1| putative SanA protein [Clostridium botulinum A3 str. Loch Maree]
          Length = 222

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 66/174 (37%), Gaps = 27/174 (15%)

Query: 2   RYFWYGLFVCLIF-FIMGFISFIRYVKQ----MHIPDHPSVSAIVVLTGE---------- 46
           R     + + L+    + FI F    +     ++  D P   AI+VL G           
Sbjct: 7   RILTVIMVIVLMGTAAIFFIDFRVRSESKKYIVNPKDVPEAEAILVL-GAYVKPNGKLCD 65

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALN 102
               R+    +L +N   +K+  SG H  V+ D +  ++K+  ++ + +  I + +   +
Sbjct: 66  MLEDRVAVGIDLYKNNKAKKLLFSGDHGQVNYDEVNGMKKVAEKKGVKKEDIFLDHAGFS 125

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           T  +   A    +      ++IVT  YH+ R       I   +    Y + S  
Sbjct: 126 TYESMYRAKEIFKAKK---IIIVTQQYHLMRAV----YIARQLGLDAYGVNSDQ 172


>gi|325127259|gb|EGC50197.1| hypothetical protein NMXN1568_2007 [Neisseria meningitidis N1568]
          Length = 214

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|304392434|ref|ZP_07374375.1| periplasmic protein [Ahrensia sp. R2A130]
 gi|303295538|gb|EFL89897.1| periplasmic protein [Ahrensia sp. R2A130]
          Length = 189

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 57/157 (36%), Gaps = 22/157 (14%)

Query: 33  DHPSVSAIVVL------TGEPI-----RIERAFELLENQIGEKIFISGV---HHSVSKDI 78
           +  S  AIVVL       G        R   A  L +  +   + +SG    H       
Sbjct: 2   ELKSAYAIVVLGAAVWKDGRASPALERRTRHAIALHQQGLAPILVLSGGLGRHPPTEAKA 61

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
            + +I + + + +  + +  ++ NT  N   ++A   +   + VL+V+  YH+PR  +  
Sbjct: 62  -MAEICMGEGVPQAALLLEGRSTNTFENVAFSAALLREKRVNSVLVVSDAYHLPRAKMCF 120

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           + +     FI     +            +  R  L E
Sbjct: 121 RYLG----FIATGSAAVAGPTTPWY---RTARYWLRE 150


>gi|221369405|ref|YP_002520501.1| hypothetical protein RSKD131_3568 [Rhodobacter sphaeroides KD131]
 gi|221162457|gb|ACM03428.1| Hypothetical Protein RSKD131_3568 [Rhodobacter sphaeroides KD131]
          Length = 267

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 56/154 (36%), Gaps = 27/154 (17%)

Query: 37  VSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECCID 95
             A V+ TG   R+    E+ E +I  +I +S GV  +                    + 
Sbjct: 122 PEARVLFTGGSGRL-FGAEIPEARIAREILVSAGVDPA-------------------RLI 161

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-- 153
           +  ++ NT  NA  A A          L+VT  +HMPR              +P+P    
Sbjct: 162 LEGQSRNTAENAHFAKALVANQGQGSWLLVTSAFHMPRAVETFCAAGWQ-DLVPWPTDYR 220

Query: 154 SHDLEENSSI---FKIKILRVLLIEYLKILLLSI 184
           +  L +         + +L V + E++ IL   +
Sbjct: 221 TASLRDGIGWDLARNLDLLNVAVREWIGILAYRV 254


>gi|123966515|ref|YP_001011596.1| hypothetical protein P9515_12821 [Prochlorococcus marinus str. MIT
           9515]
 gi|123200881|gb|ABM72489.1| Hypothetical protein P9515_12821 [Prochlorococcus marinus str. MIT
           9515]
          Length = 236

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 62/181 (34%), Gaps = 30/181 (16%)

Query: 1   MRYFWYGLFVCLIFFIMGF---IS--FIRYVKQMHIPDHPSVSAIVVLTGEPI------- 48
           +R+ +  L + L+F    F   +        K++      S   IVVL+G          
Sbjct: 14  LRFIYSALIILLVFSNGVFSECLWRLLEYPWKRLEFSSINSADGIVVLSGGRHLPLGNTK 73

Query: 49  --------RIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCID 95
                   R     EL +     K+  +G    ++     +  +  K  I   + +  + 
Sbjct: 74  IIEWHDPDRFLAGIELYKANKSNKLIFTGGVSLLTSNLPPEGTIYIKEAISMGIPKKDVL 133

Query: 96  IGYKALNTEGNAQEASAWAEKNN---FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
             Y   NT   A+   A   +        +++VT  +HM R     +R    +  +PYP+
Sbjct: 134 TTYPVYNTLEEAEAVKALLYREKPLSKKKIILVTSAFHMKRAKKVFER--EGMNVLPYPV 191

Query: 153 I 153
            
Sbjct: 192 D 192


>gi|332561062|ref|ZP_08415380.1| hypothetical protein RSWS8N_18489 [Rhodobacter sphaeroides WS8N]
 gi|332274860|gb|EGJ20176.1| hypothetical protein RSWS8N_18489 [Rhodobacter sphaeroides WS8N]
          Length = 267

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 57/154 (37%), Gaps = 27/154 (17%)

Query: 37  VSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECCID 95
             A V+ TG   R+    E+ E +I  +I +S GV  +                    + 
Sbjct: 122 PEARVLFTGGSGRL-FGAEIPEARIAREILVSAGVDPA-------------------RLI 161

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-- 153
           +  ++ NT  NA+ A A          L+VT  +HMPR              +P+P    
Sbjct: 162 LEGQSRNTAENARFAKALVANQGQGSWLLVTSAFHMPRAVETFCAAGWQ-DLVPWPTDYR 220

Query: 154 SHDLEENSSI---FKIKILRVLLIEYLKILLLSI 184
           +  L +         + +L V + E++ IL   +
Sbjct: 221 TASLRDGIGWDLARNLDLLNVAVREWIGILAYRV 254


>gi|307298224|ref|ZP_07578028.1| protein of unknown function DUF218 [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306916310|gb|EFN46693.1| protein of unknown function DUF218 [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 252

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 76/168 (45%), Gaps = 28/168 (16%)

Query: 8   LFVCLIFFIM--GFI--SFIRYVKQMH-IPDHPSVSAIVVLTGE--------------PI 48
           + +C   +++  GF    +++ +++ +  P++ S  AIVVL+                  
Sbjct: 46  IILCFFAYLLSTGFGTHLYLQPLERAYTAPNNVSGQAIVVLSSGIIISPEGQVLDNHSVA 105

Query: 49  RIERAFEL-LENQIGEKIFISG----VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+ +A+ L L+ ++   I ++G       +V+   L++   + + +A   + +   A  T
Sbjct: 106 RLSKAYSLHLQTKL--PIIVTGSFMPGRSTVAVSELMRDWLLDRGVASSKVIVEPMAQTT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             NA+ ++    + N+  +++VT   HM R     ++    ++  P+P
Sbjct: 164 WENARYSADICSQFNWSSIVLVTSAVHMKRAVTSFEKF--GLRVTPFP 209


>gi|28198681|ref|NP_778995.1| hypothetical protein PD0776 [Xylella fastidiosa Temecula1]
 gi|28056772|gb|AAO28644.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|307579820|gb|ADN63789.1| hypothetical protein XFLM_09510 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 202

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 60/191 (31%), Gaps = 30/191 (15%)

Query: 3   YFWYGLFVCLIFF----IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------I 48
           + W  + V L+FF    + G+I +I    Q       S   I+VL               
Sbjct: 11  WQWICVLVVLVFFWLVAVAGWIVWIGQRDQAA-----SSDVIIVLGAAAYDAKPSPVFEE 65

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSKD----ILLQKIPIRQDLAECCIDIGYKALNTE 104
           RI     L ++     +  +G     S       + ++  +R D+    I I   +  T 
Sbjct: 66  RIRHGLYLYQHGYAPTLIFTGGFGGSSARFAESQVARRYALRYDVPSRAILIETVSRTTR 125

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            N  +A            ++V+   HM R      R+   +        +      S   
Sbjct: 126 QNLIQARQLMRVYGLRRAIVVSDPLHMARAL----RLCRELDIDALASATPSTRFRSLHT 181

Query: 165 KIKILRVLLIE 175
           +    R LL E
Sbjct: 182 R---WRFLLQE 189


>gi|330721274|gb|EGG99364.1| Putative membrane protein [gamma proteobacterium IMCC2047]
          Length = 256

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 46/133 (34%), Gaps = 25/133 (18%)

Query: 39  AIVVLTGEPIRIERA--------------FEL-----LENQIGEKIFISGV---HHSVSK 76
           AIVVL     R   A                L     L  + G  + ++G       V +
Sbjct: 83  AIVVL--GSGRYRAAPEYGGQDTAKPMGLVRLRYGAYLHRKTGLPLLVTGGAWLDDFVPE 140

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
              + ++   + L +       ++  T  NA+ +      +    +L+VTH +HMPR   
Sbjct: 141 AEFMARVLEEEFLVKATWQ-EPRSRTTWENAKYSRELTGSDGVQKILLVTHAWHMPRALY 199

Query: 137 ELQRINSTVQFIP 149
             +R    V   P
Sbjct: 200 SFERAGFDVTAAP 212


>gi|226308856|ref|YP_002768816.1| hypothetical protein RER_53690 [Rhodococcus erythropolis PR4]
 gi|226187973|dbj|BAH36077.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 229

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 50/168 (29%), Gaps = 21/168 (12%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------IR 49
           R+      +  + +    +               +  A VV+                 R
Sbjct: 19  RWVAGIAVLGAVVYAGSIVWISVASAGHTSDAADAPDAPVVIVLGAQIKDGKPMAFLKGR 78

Query: 50  IERAFELLENQIGEKIFISGVHHSVSKDILLQKIP--IRQDLAECCIDIGYKALNTEGNA 107
           ++ A EL+E    + + +SG  +  S D +       + Q + E  I      L+T    
Sbjct: 79  LDAAVELVEAGKAKAVLVSGDANGGSGDEIAAMTNYLVEQGIDERRIVGDPYGLDTYDTC 138

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
             A            LIVT  YH+PR       +   V      + S 
Sbjct: 139 FRA---IHTYGVTKALIVTQGYHVPRAV----ALCRDVGIDADGVNSD 179


>gi|298244343|ref|ZP_06968149.1| protein of unknown function DUF218 [Ktedonobacter racemifer DSM
           44963]
 gi|297551824|gb|EFH85689.1| protein of unknown function DUF218 [Ktedonobacter racemifer DSM
           44963]
          Length = 239

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 72/221 (32%), Gaps = 48/221 (21%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPI-------RIERA 53
           +  W    + L F  + ++ F    K+  + D    V AIVVL G          ++E A
Sbjct: 6   KVLWAISAITLSFIFI-WLLFYTRGKRFALRDKLQKVDAIVVLAGTRGNVEFLHKKVETA 64

Query: 54  FELLENQIGEKIFISG---------------------VHHS-VSKDILLQKIP------- 84
             L  +   + I   G                     V    + +  + +          
Sbjct: 65  ARLYRDGWAKHIICGGKFSAKVTDSPQLMSQEELRLAVDQGRIQEKDIARAAATWDIALG 124

Query: 85  --------IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
                   +   + +  I +  ++L+T   A+      +K+ ++ +++VT  +H  RT+L
Sbjct: 125 ARYMRDKAMAYGVPDDAIVLEEESLHTRETAEYVLDIVQKHKWYKIILVTSPFHQLRTYL 184

Query: 137 ELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
              ++     +Q   Y   S      +         +L  E
Sbjct: 185 TFAKVFLPYDIQISNYYADSDSWHPMAWFLSKSNRELLDSE 225


>gi|325143399|gb|EGC65728.1| hypothetical protein NMB9615945_0016 [Neisseria meningitidis
           961-5945]
          Length = 218

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|17227740|ref|NP_484288.1| hypothetical protein all0244 [Nostoc sp. PCC 7120]
 gi|17135222|dbj|BAB77768.1| all0244 [Nostoc sp. PCC 7120]
          Length = 174

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 58/167 (34%), Gaps = 14/167 (8%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIR-IER---AFELLENQIGEKIFIS 68
           + F+   + F     Q     +    A++VL G   R +ER               I+IS
Sbjct: 1   MLFLPLLMWFGY---QEAKNAYTQPQAVIVL-GGSTRNLEREKFTASFARKHPNLPIWIS 56

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           G    V    + +K  I          + Y+A++T  N        +      V ++T D
Sbjct: 57  GGSPPVYTKRVFKKAGIDTKRLH----LDYEAVDTVTNFTTLIDELQSRGIKSVYLITSD 112

Query: 129 YHMPRT--FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
           +HM R     E+   +  + F P  + S +  E          R LL
Sbjct: 113 FHMRRACIIGEIVLGSRGITFKPISVPSENSPEPIEKSLRDGARALL 159


>gi|325133332|gb|EGC55998.1| hypothetical protein NMBM13399_2155 [Neisseria meningitidis M13399]
          Length = 218

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 57/152 (37%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F   +F  ++ F   +  +       +P H    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFTSSVWAVYRTGGQVLPPHVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|75908946|ref|YP_323242.1| hypothetical protein Ava_2734 [Anabaena variabilis ATCC 29413]
 gi|75702671|gb|ABA22347.1| Protein of unknown function DUF218 [Anabaena variabilis ATCC 29413]
          Length = 167

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 55/160 (34%), Gaps = 14/160 (8%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPIR-IER---AFELLENQIGEKIFISGVHHSVS 75
           + F     Q     +    A++VL G   R +ER               I+ISG    V 
Sbjct: 1   MWFGY---QEAKNAYTQPQAVIVL-GGSTRNLEREKFTASFARQHPNLPIWISGGSPPVY 56

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT- 134
              + +K  I          + Y+A++T  N        +      V ++T D+HM R  
Sbjct: 57  TKRVFKKAGIDTKRLH----LDYEAVDTVTNFTTLIDELQSRGIKSVYLITSDFHMRRAC 112

Query: 135 -FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              E+   +  + F P  + S +  E          R LL
Sbjct: 113 IIGEIVLGSRGITFKPISVPSENSPEPIEKSLRDGARALL 152


>gi|218661819|ref|ZP_03517749.1| hypothetical protein RetlI_21178 [Rhizobium etli IE4771]
          Length = 214

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 42/115 (36%), Gaps = 17/115 (14%)

Query: 47  PIRIERAFELLENQIGEKIFISGVH---------HSVSKDILLQKIPIRQD-LAECCIDI 96
             R   A  L +     +I +SG            + + +       I +D L E     
Sbjct: 57  ADRFVEALRLAQKFPQSRILVSGGDGSLSGIYEGDAAASERFFPLFGIGKDRLIE----- 111

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             ++  T  NA     +       H L++T  +HMPR+    +++   +  +P+P
Sbjct: 112 ERQSRTTFENAVNTKEFLASQGLSHCLLITSGFHMPRSVGIFRKL--GIDIVPWP 164


>gi|77461176|ref|YP_350683.1| hypothetical protein Pfl01_4955 [Pseudomonas fluorescens Pf0-1]
 gi|77385179|gb|ABA76692.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 259

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 51/177 (28%), Gaps = 36/177 (20%)

Query: 10  VCLIFFIMGFI---------SFIRYVKQMHIPD-------HPSVSAIVVLTGEPIRIE-- 51
           +C      GF             + +++                 AIVVL     R +  
Sbjct: 37  LCFALGFGGFWLMSLPVVVQWGAKALEREPPLARDSWASLAQRADAIVVLGSGRERGDLA 96

Query: 52  ------RAFELLENQIGEKI--------FISGV-HHSVSKDILLQKIPIRQDLAECCIDI 96
                     L   +   ++          SG  H+              +D     +  
Sbjct: 97  WGEDQPTGVGLERQRYAARLAKASGLPILTSGGLHYGTPPTEAKLMADSLRDDFGVTVRW 156

Query: 97  -GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
              ++  T  NA+ ++          +++VT  +HMPR     Q+     + +P P+
Sbjct: 157 QEGESRTTWENAEFSAKVLLPEGVKRIVLVTQAWHMPRAVWSYQQA--GFEVVPAPV 211


>gi|254671270|emb|CBA08572.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
          Length = 218

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|126463807|ref|YP_001044920.1| hypothetical protein Rsph17029_3048 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105618|gb|ABN78148.1| protein of unknown function DUF218 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 280

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 58/154 (37%), Gaps = 27/154 (17%)

Query: 37  VSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPIRQDLAECCID 95
             A V+ TG   R+    E+ E +I  +I +S GV  +                    + 
Sbjct: 135 PEARVLFTGGSGRL-FGAEIPEARIAREILVSAGVDPA-------------------RLI 174

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-- 153
           +  ++ NT  NA+ A A          L+VT  +HMPR+             +P+P    
Sbjct: 175 LEGQSRNTAENARFAKALVANQGQGSWLLVTSAFHMPRSVETFCAAGWQ-NLVPWPTDYR 233

Query: 154 SHDLEENSSI---FKIKILRVLLIEYLKILLLSI 184
           +  L +         + +L V + E++ IL   +
Sbjct: 234 TASLRDGIGWDLARNLDLLNVAVREWIGILAYRV 267


>gi|301156135|emb|CBW15606.1| conserved inner membrane protein [Haemophilus parainfluenzae T3T1]
          Length = 247

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 54/142 (38%), Gaps = 30/142 (21%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIR---------IERAFEL--------LENQIGEKIFISG 69
             + + D+    AIV+L G  +R            A +L        L+ +    + I+G
Sbjct: 68  DHLTLQDYQQAQAIVLL-GGGLRDSKELYAPLASTAIQLERLRYAAFLQKETHLPLLITG 126

Query: 70  VHHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
              +      ++ + L     +          I  KAL T+ NA       EK   H ++
Sbjct: 127 ASPTGAIEAKIAAEELQNFFNVPTKW------IEPKALTTKENALFTKQMLEKEGIHKII 180

Query: 124 IVTHDYHMPRTFLELQRINSTV 145
           +VT+++HM R  L  Q+    V
Sbjct: 181 LVTNEWHMQRAKLLFQQQGFDV 202


>gi|298370494|ref|ZP_06981810.1| periplasmic protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281954|gb|EFI23443.1| periplasmic protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 220

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 64/187 (34%), Gaps = 23/187 (12%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IRIERAFELL 57
            + ++    G +  +       +P   +  A VVL G              RI  A  L 
Sbjct: 24  ILLVLAVFAGNVWQVYRTGNQTLPAAATADAAVVL-GAAAWNKQPSPVFLERINHAIALY 82

Query: 58  ENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           ++    KI  +G       +++  + ++  ++Q +    I     + NT  N +      
Sbjct: 83  QSHRVGKIVFTGGTPKKGYMTEAEVGRRYALKQGIPAKNILFENTSRNTYENLRNIKPIL 142

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             N+   ++IV+  YH+ R     + ++   +    P    D  E          R L  
Sbjct: 143 RANSVDSIIIVSDPYHLARAQAIARDLDLNAEVSATPTTRFDAREKKG-------RFLFQ 195

Query: 175 E-YLKIL 180
           E YL  L
Sbjct: 196 ESYLLFL 202


>gi|46143233|ref|ZP_00135637.2| COG1434: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207969|ref|YP_001053194.1| hypothetical protein APL_0485 [Actinobacillus pleuropneumoniae L20]
 gi|126096761|gb|ABN73589.1| hypothetical protein APL_0485 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 252

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 52/144 (36%), Gaps = 17/144 (11%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGE-------PIR--IERA-------FELLENQIG 62
            I  + + +++ I D+    AIVVL G          R  I  A          L  Q G
Sbjct: 64  LIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYAIAAAPLERMRYAAYLHKQTG 123

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHH 121
             I ++G      +           D     +  +   +  TE NA  + A  ++     
Sbjct: 124 LPILVTGGSPEGREPEAKIMAQELHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDR 183

Query: 122 VLIVTHDYHMPRTFLELQRINSTV 145
           +++VT+ +HM R  +  +R    V
Sbjct: 184 IILVTNQWHMKRAKMLFEREGFNV 207


>gi|313669320|ref|YP_004049604.1| periplasmic protein [Neisseria lactamica ST-640]
 gi|313006782|emb|CBN88252.1| putative periplasmic protein [Neisseria lactamica 020-06]
          Length = 218

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FQERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|241888952|ref|ZP_04776256.1| integral membrane protein [Gemella haemolysans ATCC 10379]
 gi|241864201|gb|EER68579.1| integral membrane protein [Gemella haemolysans ATCC 10379]
          Length = 345

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 58/153 (37%), Gaps = 16/153 (10%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
           Y + GL V L F  +     +  V  +       +  +VVL               RI +
Sbjct: 135 YSYVGLVV-LYFLCIAMSYLVSSVLNIINILPRRIDYVVVLGAGLIGERVTPLLASRIRK 193

Query: 53  AFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
              + +   G K+ +SG       VS+   ++     Q + E  I +  K+ +TE N   
Sbjct: 194 GINVYKANPGSKLIMSGGQGPDEVVSEAFAMKNYAFEQGVDENDIILEDKSTSTEENIIF 253

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
           +  +   +      +VT+ YH+ R  ++ + + 
Sbjct: 254 SKKFIPAD--KSFAVVTNYYHVYRALVQARTLG 284


>gi|295397171|ref|ZP_06807275.1| conserved hypothetical protein [Aerococcus viridans ATCC 11563]
 gi|294974593|gb|EFG50316.1| conserved hypothetical protein [Aerococcus viridans ATCC 11563]
          Length = 193

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 59/184 (32%), Gaps = 16/184 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R   +   + +   ++G I+    +             IVV  G   R   A +LLE  
Sbjct: 7   VRLAGFFAGIMIAIGLLGVITLSNLIVDEEP---RVSDIIVVPEGASERAGEAVDLLEAG 63

Query: 61  IGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
                  SG   V      +  L         ++  I+ G  A +T  NA+      ++ 
Sbjct: 64  YSR----SGKIIVSPLTQSN--LDFYVGAGAPSDALINEG-NATSTYTNARNTLKMMQEL 116

Query: 118 NFHHVLIVTHDYHMPR--TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            +   +I + DYHM R     E Q  +                E  + ++    R  L E
Sbjct: 117 GYDSAVITSSDYHMLRTKMIYERQNRHYGFDLTYVATYHDVAGEEVTWWQANR-RAGLSE 175

Query: 176 YLKI 179
             K 
Sbjct: 176 IRKF 179


>gi|224373337|ref|YP_002607709.1| hypothetical protein NAMH_1317 [Nautilia profundicola AmH]
 gi|223588336|gb|ACM92072.1| conserved hypothetical protein [Nautilia profundicola AmH]
          Length = 240

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 42/211 (19%), Positives = 76/211 (36%), Gaps = 29/211 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFIS--FIRYVKQMHIPDHPSVSAIVVLTGEPI----------- 48
           +  ++   V L      F++   +  ++  +  D  + SA+VVL G              
Sbjct: 33  KIVFFSAAVLLWAISTKFVANALLYPLEHGYKSDTITPSAVVVLGGGTNSRDVLKAMPDA 92

Query: 49  --RIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIG----YKALN 102
             R      + + +    IF  G   ++ +   ++K  I   L  C  DI      ++LN
Sbjct: 93  FKREVYGLLIAKQESLPYIFTGGGIQNIKEAENIKK-DIDMILKTCNCDIETFYENRSLN 151

Query: 103 TEGNAQEASAWAEKNNF-HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI-ISHDLEEN 160
           T  NA+  +   EK N    + +VT  YHM R  +         Q IP P+   +D E  
Sbjct: 152 TFQNAKYTAKLFEKLNLSKKIYLVTSAYHMKRAIMIFNNF--GFQIIPKPVGFYYDNEYT 209

Query: 161 SSIFKIKILRV-----LLIEYLKILLLSIQL 186
                            + EY  ++   +++
Sbjct: 210 FWDIFPNAGNFYHSYKAIHEYFGLIKTYLRI 240


>gi|115525420|ref|YP_782331.1| hypothetical protein RPE_3419 [Rhodopseudomonas palustris BisA53]
 gi|115519367|gb|ABJ07351.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisA53]
          Length = 267

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 57/186 (30%), Gaps = 29/186 (15%)

Query: 32  PDHPSVSAIVVLTGE-----------------PIRIERAFELLENQIGEKIFISGVHHSV 74
            +  +   IVVL G                    R+    +L       +I  +G   + 
Sbjct: 74  AEGRAPDGIVVLGGSIDSDISAARNALETDASAERVFAMLDLARRYPNARIVFTG-GSAN 132

Query: 75  SKDILLQKIPIRQDLAEC------CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
                  + P+   L E        I +   +  T  NA               L+VT  
Sbjct: 133 LIGDTAAEAPVAGQLLEQFGIAPDRIVLESGSRTTAENATMTRDLVAPKPGERWLLVTSA 192

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF---KIKILR--VLLIEYLKILLLS 183
           +HMPR+    + I   V+  P    +    +    F      + R  V + E++ ++   
Sbjct: 193 FHMPRSIGVFRAIGFEVEAYPVDWRTRGWIDLRWPFGKLSAGLARIDVAVHEWVGLIAYR 252

Query: 184 IQLSLS 189
           +   ++
Sbjct: 253 LTGRIA 258


>gi|34499564|ref|NP_903779.1| hypothetical protein CV_4109 [Chromobacterium violaceum ATCC 12472]
 gi|34105415|gb|AAQ61770.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 199

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/197 (17%), Positives = 64/197 (32%), Gaps = 26/197 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEP-----------I 48
           +R    G  + ++  ++GF      +      D  P   A +VL G              
Sbjct: 4   LRLMLRGFLLAVLLVVLGFACVAWSIVDYGSGDEVPGADAALVL-GAAAWGNKPSPVFRE 62

Query: 49  RIERAFELLENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           RI  A +L ++     I  +G         +  + ++   RQ +    + +  ++  T  
Sbjct: 63  RINHAVKLYQSGKVRWIVFTGGTPEPGYPAEADVGREFAARQGVPMTAMLVENQSRTTWQ 122

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N   A     +      L+V+   HM R    L   +  ++  P P  S      +S   
Sbjct: 123 NLSNARDLGNQFGIRSYLLVSDPLHMRRAV--LMAGDLGLRAYPAPTQSSRFRTLASWS- 179

Query: 166 IKILRVLLIE---YLKI 179
               R L  E   Y+  
Sbjct: 180 ----RFLARETWLYVGY 192


>gi|218440733|ref|YP_002379062.1| hypothetical protein PCC7424_3813 [Cyanothece sp. PCC 7424]
 gi|218173461|gb|ACK72194.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7424]
          Length = 194

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/157 (17%), Positives = 51/157 (32%), Gaps = 11/157 (7%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           + + L    +G     + ++   +       AI+VL G   R   A  L        I++
Sbjct: 20  VMILLPLLTVGSWWSYKQIQSYLVKPE----AILVLGGHEERERFAAHLAAKNPQLPIWV 75

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           S    S     +     +  D       + YKA +T  N        +      V ++T 
Sbjct: 76  SSGSPSNYVKRIFANAGVNSDRLH----LDYKAKDTVTNFTTLVDKLKAQGIDSVYLITS 131

Query: 128 DYHMPRTFL--ELQRINSTVQFIPYPIISHDLEENSS 162
           + HM R  +  E+   +  +   P  + S      S 
Sbjct: 132 ENHMRRARIIGEIVFGSRGIIIKPVAVPSDA-PSESW 167


>gi|322804976|emb|CBZ02535.1| sana protein [Clostridium botulinum H04402 065]
          Length = 222

 Score = 62.6 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 66/172 (38%), Gaps = 31/172 (18%)

Query: 8   LFVCLIFFIMGFIS--FIRYVKQMH-------IPDHPSVSAIVVLTGE------------ 46
           L V +   +MG  +  FI +  +           D P   AI+VL G             
Sbjct: 9   LVVIMAIVLMGTAAIFFIDFRVRSESKKYIVNPKDVPEAEAILVL-GAYVKPNGKLCDML 67

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTE 104
             R+    +L +N   +K+  SG H  V+ D +  ++K+  ++ + +  I + +   +T 
Sbjct: 68  EDRVAVGIDLYKNNKAKKLLFSGDHGQVNYDEVNGMKKVAEKKGVKKEDIFLDHAGFSTY 127

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
            +   A    +      ++IVT  YH+ R     +++        Y + S  
Sbjct: 128 ESMYRAKEIFKAKK---IIIVTQQYHLMRAVYIARKLGLD----AYGVNSDQ 172


>gi|261401556|ref|ZP_05987681.1| putative periplasmic protein [Neisseria lactamica ATCC 23970]
 gi|269208394|gb|EEZ74849.1| putative periplasmic protein [Neisseria lactamica ATCC 23970]
          Length = 218

 Score = 62.6 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|332528861|ref|ZP_08404835.1| hypothetical protein HGR_03097 [Hylemonella gracilis ATCC 19624]
 gi|332041720|gb|EGI78072.1| hypothetical protein HGR_03097 [Hylemonella gracilis ATCC 19624]
          Length = 255

 Score = 62.6 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 54/157 (34%), Gaps = 12/157 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDI 96
            L     R+  A  LL+ +    +  +G          S+    ++  + Q +    + +
Sbjct: 101 ALNSAAERLTAALPLLQREPRLVLLYTGGEGELLASGPSEAERARRFYVEQGVPPARLLL 160

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
              + NT  NA  ++A    +     L++T  +HMPR+    ++    V   P+P     
Sbjct: 161 ESASRNTHDNAVFSAALPGVDRTRPWLLITSAWHMPRSLRTFRKAGWNVT--PWPTDYRA 218

Query: 157 LEENSSIFK-----IKILRVLLIEYLKILLLSIQLSL 188
                             ++ L E L +    ++  L
Sbjct: 219 GLTTPWHQYSLSQGAAKWQLALHELLGLAAYRLRGWL 255


>gi|161524938|ref|YP_001579950.1| hypothetical protein Bmul_1765 [Burkholderia multivorans ATCC
           17616]
 gi|160342367|gb|ABX15453.1| protein of unknown function DUF218 [Burkholderia multivorans ATCC
           17616]
          Length = 281

 Score = 62.6 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 61/203 (30%), Gaps = 32/203 (15%)

Query: 2   RYFWYGLFVCLIFFIMGFIS--FIRYVK-QMHIPDHPSVSA---IVVLTGEPIRIERAFE 55
           R               G+++  FI + +  +   +HP +     ++VL     R +    
Sbjct: 65  RRIALAAVALFWLIASGWLAAPFIAWAEAGVEPVEHPDMHGQTVLIVLGAGTQRADDGLR 124

Query: 56  LLENQIGEK------------------IFISGVHHSVSKDILLQKIP---IRQDLAECCI 94
              +                       + +SG       D          +   +    +
Sbjct: 125 PPRDGAARIRKAAELYRSCRRQAERCTVVMSGGDPQHHGDTEAAVYGRGLVAAGVDPGDL 184

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  K+  T  NAQ  ++          +++T  Y M R  L+ +R        P P+ +
Sbjct: 185 VLEPKSRTTYENAQFTTSILRSRRDDARILITSSYQMRRALLDFRRFGID----PQPVFA 240

Query: 155 HDLEENSSIFKIKILRVLLIEYL 177
           +  E  +     +   V+  E+ 
Sbjct: 241 NRREAQTGWL-PRWSNVVATEFA 262


>gi|261391563|emb|CAX48996.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           8013]
          Length = 218

 Score = 62.6 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIDSVVIVSDPYHLARA 162


>gi|229156674|ref|ZP_04284762.1| hypothetical protein bcere0010_28590 [Bacillus cereus ATCC 4342]
 gi|228626843|gb|EEK83582.1| hypothetical protein bcere0010_28590 [Bacillus cereus ATCC 4342]
          Length = 219

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 144 EVGVENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|309379839|emb|CBX21615.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 218

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|83593886|ref|YP_427638.1| hypothetical protein Rru_A2551 [Rhodospirillum rubrum ATCC 11170]
 gi|83576800|gb|ABC23351.1| Protein of unknown function DUF218 [Rhodospirillum rubrum ATCC
           11170]
          Length = 206

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 57/160 (35%), Gaps = 18/160 (11%)

Query: 23  IRYVKQMHIPDHPSVS--AIVVL------TGEPI-----RIERAFELLENQIGEKIFISG 69
                +   P   +    A+VVL       G P      R+     L       ++ +SG
Sbjct: 12  AEETDRAFPPAGRAGEGCAVVVLGARVLGDGRPSPALERRVLHGVALARRHPAARLLLSG 71

Query: 70  VHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
                  D   ++  + +   +A   + +  +AL+T GNA+ +           VL+VT 
Sbjct: 72  GATGGPLDEAWVMATLALGAGIAAERLILEDRALDTLGNARHSLPLLRAARIGRVLLVTD 131

Query: 128 DYHMPRTFLELQRINST---VQFIPYPIISHDLEENSSIF 164
             HMPR  L  + +      ++  P P  +       +IF
Sbjct: 132 PSHMPRALLSFRAVAGDHLRLRAAPTPCPAGGWRNRRAIF 171


>gi|93007196|ref|YP_581633.1| hypothetical protein Pcryo_2372 [Psychrobacter cryohalolentis K5]
 gi|92394874|gb|ABE76149.1| protein of unknown function DUF218 [Psychrobacter cryohalolentis
           K5]
          Length = 259

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 73/201 (36%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQ---MHIPDHPSVSAIVVLTGE----------P 47
           +   WYGL++    +++ F  F+  ++Q         P V+AI+VL              
Sbjct: 62  LSRLWYGLWMVFFIWLISFGIFVYALQQQIKQSAKPIPRVAAIIVLGSGTVAGKPTPTLA 121

Query: 48  IRIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQ-DLAECCIDIGYKALNT 103
            R++ A  L+ +Q G  +  SG      + S+  ++        D+    I    ++ +T
Sbjct: 122 KRLDTAAPLINSQKGALVITSGGIGFGQTHSEAYIMATYLYDTYDIPLKHILQEGQSTST 181

Query: 104 EGNAQEASAWAEKNNFH---HVLIVTHDYHMPRTFLELQR---INSTVQFIPYPIISHDL 157
             N   +              + IVT D+H+ R     +    +  T+   P P+    +
Sbjct: 182 AENLIYSQEILAAKGISIKAPIAIVTSDFHIIRAANIARHQGYVQPTMLASPTPL---SI 238

Query: 158 EENSSIFKIKIL--RVLLIEY 176
             N+   +        L  EY
Sbjct: 239 RYNAWFREYFAFVSGWLFGEY 259


>gi|116624473|ref|YP_826629.1| hypothetical protein Acid_5395 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227635|gb|ABJ86344.1| protein of unknown function DUF218 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 195

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/177 (16%), Positives = 64/177 (36%), Gaps = 18/177 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISF-IRYVKQMHIPDHPS-VSAIVVLTGEPI----------- 48
           R  W G+ +  +  +M +++F    ++Q  + +       I+VL G              
Sbjct: 3   RLLWNGIALAAVV-VMFYVAFLSLRIEQQSVREEAQPADVILVL-GAAEYRGRPSPVLRA 60

Query: 49  RIERAFELLENQIGEKIFI---SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++ A +L   +   +I     SG     ++  + +    +  +    I +  +  +T  
Sbjct: 61  RLDHALDLYSRKFAPRILTTGGSGGDPIFTEGGVGRSYLTQHGVPSDAIIVETEGESTVE 120

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           +   A+    +   H V++V+  YH+ R    L+    T    P P  S        
Sbjct: 121 STTMAAEIMRRMELHSVIVVSDGYHIYRVKQMLEAHGMTAYGSPRPDHSQSPLHLRW 177


>gi|167894539|ref|ZP_02481941.1| hypothetical protein Bpse7_12379 [Burkholderia pseudomallei 7894]
          Length = 240

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 45/122 (36%), Gaps = 11/122 (9%)

Query: 49  RIERAFELLENQIGEKI----FISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL        +     +SG    V    +        + + +A   +    ++ 
Sbjct: 91  RIDKTAELYSACRRTALRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R      F P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFG----FAPQPVYANRRDARL 206

Query: 162 SI 163
             
Sbjct: 207 GW 208


>gi|42782182|ref|NP_979429.1| hypothetical protein BCE_3127 [Bacillus cereus ATCC 10987]
 gi|42738107|gb|AAS42037.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 210

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 135 EVGTENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 174


>gi|196228088|ref|ZP_03126955.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
 gi|196227491|gb|EDY21994.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
          Length = 265

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 55/148 (37%), Gaps = 29/148 (19%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP----------------IRIERAFELLENQIGEKIFISG- 69
             + I + P   AIV+L G                   R+  A E+        + + G 
Sbjct: 70  AGVKIDELPKADAIVMLGGGSAPSRYEALGVHLTQAGDRLVMAHEVYRLGKAPVLLLGGN 129

Query: 70  VHH--------SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           V+         S     L +   I +D     I +G +  +T   A + +A A+++ +H 
Sbjct: 130 VNKLDGVRKFESEIVRDLFKTWGIPEDAM---IPLG-ENQDTHDEALKTAALAKEHGWHR 185

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIP 149
           VL+VT   HM R    L+     V  +P
Sbjct: 186 VLLVTSASHMRRASGVLRAQGLEVIPVP 213


>gi|76811194|ref|YP_333307.1| hypothetical protein BURPS1710b_1908 [Burkholderia pseudomallei
           1710b]
 gi|126441655|ref|YP_001058770.1| hypothetical protein BURPS668_1731 [Burkholderia pseudomallei 668]
 gi|167738833|ref|ZP_02411607.1| hypothetical protein Bpse14_12248 [Burkholderia pseudomallei 14]
 gi|167911178|ref|ZP_02498269.1| hypothetical protein Bpse112_11843 [Burkholderia pseudomallei 112]
 gi|167919203|ref|ZP_02506294.1| hypothetical protein BpseBC_11665 [Burkholderia pseudomallei
           BCC215]
 gi|217423472|ref|ZP_03454973.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|254259791|ref|ZP_04950845.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|76580647|gb|ABA50122.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b]
 gi|126221148|gb|ABN84654.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|217393330|gb|EEC33351.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|254218480|gb|EET07864.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 240

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 45/122 (36%), Gaps = 11/122 (9%)

Query: 49  RIERAFELLENQIGEKI----FISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL        +     +SG    V    +        + + +A   +    ++ 
Sbjct: 91  RIDKTAELYSACRRTALRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +R      F P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFG----FAPQPVYANRRDARL 206

Query: 162 SI 163
             
Sbjct: 207 GW 208


>gi|148378651|ref|YP_001253192.1| exported protein [Clostridium botulinum A str. ATCC 3502]
 gi|153933579|ref|YP_001383034.1| putative sanA protein [Clostridium botulinum A str. ATCC 19397]
 gi|153934960|ref|YP_001386583.1| putative sanA protein [Clostridium botulinum A str. Hall]
 gi|226947902|ref|YP_002802993.1| putative SanA protein [Clostridium botulinum A2 str. Kyoto]
 gi|148288135|emb|CAL82203.1| putative exported protein [Clostridium botulinum A str. ATCC 3502]
 gi|152929623|gb|ABS35123.1| putative SanA protein [Clostridium botulinum A str. ATCC 19397]
 gi|152930874|gb|ABS36373.1| putative SanA protein [Clostridium botulinum A str. Hall]
 gi|226841482|gb|ACO84148.1| putative SanA protein [Clostridium botulinum A2 str. Kyoto]
          Length = 222

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 66/174 (37%), Gaps = 27/174 (15%)

Query: 2   RYFWYGLFVCLIF-FIMGFISFIRYVKQ----MHIPDHPSVSAIVVLTGE---------- 46
           R F   + + L+    + FI F    +     ++  D P   AI+VL G           
Sbjct: 7   RIFMVIMVIVLMGTAAIFFIDFRVRSESKKYIVNPKDVPEAEAILVL-GAYVKPNGKLCD 65

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALN 102
               R+    +L +N   +K+  SG H   + D +  ++K+  ++ + +  I + +   +
Sbjct: 66  MLEDRVAVGIDLYKNNKAKKLLFSGDHGQANYDEVNGMKKVAEKKGVKKEDIFLDHAGFS 125

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           T  +   A    +      ++IVT  YH+ R       I   +    Y + S  
Sbjct: 126 TYESMYRAKEIFKAKK---IIIVTQQYHLMRAV----YIARQLGLDAYGVNSDQ 172


>gi|237711018|ref|ZP_04541499.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|265750614|ref|ZP_06086677.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229454862|gb|EEO60583.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263237510|gb|EEZ22960.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 252

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/157 (12%), Positives = 43/157 (27%), Gaps = 14/157 (8%)

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDIL---------LQKIPIRQDLAECCIDIG 97
             R+     L ++    K+ ++     +              +++      +    + + 
Sbjct: 95  ADRLLEGIRLYKHGRIRKLVLASDGSIIESKDGKGLQGNAADMKQYLADLGMPLEDVILE 154

Query: 98  YKALNTEGNAQEASAWA-EKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFI-PYP-I 152
            +A NT  NA                L++T   HM R+                  +P I
Sbjct: 155 TRANNTWENATFTLELIGNSMKTESTLLITSATHMRRSLWTFHAAGLNPDTYITDTFPEI 214

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
                    S   +     L  E++  L   ++   S
Sbjct: 215 KGEKTNFLPSWHVLASWPELTHEWVGYLYYRLRHKPS 251


>gi|254719238|ref|ZP_05181049.1| hypothetical protein Bru83_06801 [Brucella sp. 83/13]
 gi|265984234|ref|ZP_06096969.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837987|ref|ZP_07470845.1| Hypothetical protein BROD_0794 [Brucella sp. NF 2653]
 gi|264662826|gb|EEZ33087.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306406911|gb|EFM63132.1| Hypothetical protein BROD_0794 [Brucella sp. NF 2653]
          Length = 264

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 51/170 (30%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGDRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 215


>gi|121635807|ref|YP_976052.1| putative periplasmic protein [Neisseria meningitidis FAM18]
 gi|120867513|emb|CAM11290.1| putative periplasmic protein [Neisseria meningitidis FAM18]
 gi|254672612|emb|CBA06344.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|325131248|gb|EGC53960.1| hypothetical protein NMBM6190_2077 [Neisseria meningitidis M6190]
 gi|325137422|gb|EGC60010.1| hypothetical protein NMBES14902_2053 [Neisseria meningitidis
           ES14902]
          Length = 218

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIDSVVIVSDPYHLARA 162


>gi|167746537|ref|ZP_02418664.1| hypothetical protein ANACAC_01247 [Anaerostipes caccae DSM 14662]
 gi|317471356|ref|ZP_07930711.1| DUF218 domain-containing protein [Anaerostipes sp. 3_2_56FAA]
 gi|167653497|gb|EDR97626.1| hypothetical protein ANACAC_01247 [Anaerostipes caccae DSM 14662]
 gi|316901162|gb|EFV23121.1| DUF218 domain-containing protein [Anaerostipes sp. 3_2_56FAA]
          Length = 228

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 62/172 (36%), Gaps = 30/172 (17%)

Query: 2   RYF-WYGLFVCLIFF----IMGFISFIRYVKQMHIPDHP---------SVSAIVVL---- 43
           R+  W  L + LIF       G   F+ +  +  I                A+VVL    
Sbjct: 7   RWSRWLKLLLILIFAGILTAGGINWFMIHQSKKDIETARQLALEQKGKKADAVVVLGAKV 66

Query: 44  --TGE-----PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCI 94
              G        R++   +  +  + ++I +SG H +   D +  ++   I+Q +    I
Sbjct: 67  RKDGSMCLMLKERVDLGIQAYKQGLADRIIMSGDHGAEGYDEVSTMKAYAIKQGIPSEHI 126

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
              +   +T      A    +      +++VT  YH+ R   + + +   V+
Sbjct: 127 FKDHAGFSTYETMYRARDVFKA---KSIVVVTQKYHLYRAVYDAKALGLEVK 175


>gi|225386502|ref|ZP_03756266.1| hypothetical protein CLOSTASPAR_00249 [Clostridium asparagiforme
           DSM 15981]
 gi|225047421|gb|EEG57667.1| hypothetical protein CLOSTASPAR_00249 [Clostridium asparagiforme
           DSM 15981]
          Length = 253

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 59/161 (36%), Gaps = 22/161 (13%)

Query: 26  VKQMHIPDHPSVSAIVVL------TGEPI-----RIERAFELLENQIGEKIFISGVHHSV 74
           V      +   V  I+VL       G P      R+ +   L    + +++ +SG H  V
Sbjct: 67  VTPEQAAELDKVDCILVLGCGVRDDGSPSGMLNDRLLQGIALYNAGVSDRLLMSGDHGRV 126

Query: 75  SKDI--LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
             D   L+++  I   +    I + +   +T  +   A    +      +++VT +YHM 
Sbjct: 127 DYDEVNLMKQFAIDHGVPSEDIFMDHAGFSTYESMYRARDIFQAE---RIVVVTQEYHMY 183

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
           R      ++        Y + S   +      KI+  R +L
Sbjct: 184 RALYNAGQMGMD----AYGVASDPRKYGG--QKIRDAREML 218


>gi|89096104|ref|ZP_01168997.1| hypothetical protein B14911_25445 [Bacillus sp. NRRL B-14911]
 gi|89088958|gb|EAR68066.1| hypothetical protein B14911_25445 [Bacillus sp. NRRL B-14911]
          Length = 226

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 64/175 (36%), Gaps = 17/175 (9%)

Query: 33  DHPSVSAIVVLTGEPI-----RIERAFELLENQIGEKIFISG----VHHSVSKDILLQKI 83
           D  S   I VL          R+ +A EL  +    K+  SG        + +  LL++ 
Sbjct: 49  DKKSGECIFVL--GSSKAAEYRLPKALELYNSGRAGKLLFSGGVVWAPSRLCEAELLKEK 106

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRTFLELQ 139
            +   +    I I  ++L+T+ N   +    ++    +    +L+VT   H+ R +L ++
Sbjct: 107 ALALGIPAADILIENQSLHTKENVLASLLVLDREFNLHKIKRILVVTASCHIRRAYLAMK 166

Query: 140 RINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTA 193
                 +++   P+      E +             E  K L+  ++  +   T 
Sbjct: 167 TYMPDWIEYSLCPVDDIHTIEGNWQLSEAGRLRAKREAEK-LIYYVKQGIIIDTE 220


>gi|220910044|ref|YP_002485355.1| hypothetical protein Cyan7425_4689 [Cyanothece sp. PCC 7425]
 gi|219866655|gb|ACL46994.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 262

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 72/206 (34%), Gaps = 40/206 (19%)

Query: 21  SFIRYVKQMHIPDH-PSVSAIVVLTGE----------------PIRIERAFELLENQIGE 63
             ++ ++  ++P   P+ +AIVVL G                   R+  A +L  +    
Sbjct: 59  WLLQTLETQNLPGSLPNAAAIVVLGGAIKGADPPRPWIEVAEAGDRLLYAAKLYRDGKAP 118

Query: 64  KIFISG-------VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
            + +SG          +  +   +  +     +    +     +LNT  NA       ++
Sbjct: 119 LVILSGGRISWLSTATAAPESADMAILIETMGVPASALLQDSTSLNTYQNAVNVQKILKE 178

Query: 117 NNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD-------------LEENSS 162
            N    +L+VT  +HMPR      R+   +  I  P   H              L    S
Sbjct: 179 KNITGSILLVTSAFHMPRALAIFNRL--GIPAIAAPTDFHTTQTAELSGAIGFLLSLLPS 236

Query: 163 IFKIKILRVLLIEYLKILLLSIQLSL 188
              ++   + L EY+ +++  ++  L
Sbjct: 237 AETLQNTTLALKEYVGLVVYRLRGWL 262


>gi|312892082|ref|ZP_07751582.1| protein of unknown function DUF218 [Mucilaginibacter paludis DSM
           18603]
 gi|311295454|gb|EFQ72623.1| protein of unknown function DUF218 [Mucilaginibacter paludis DSM
           18603]
          Length = 260

 Score = 62.2 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 61/188 (32%), Gaps = 30/188 (15%)

Query: 26  VKQMHIPDHPSVSAIVV-------------LTGEPIRIERAFELLENQIGEKIFISGVH- 71
           + Q   P+     AIV+               G   R  +  +L        I +SG + 
Sbjct: 64  ITQGPPPEGKYSCAIVLGGFSSADQDGNGYFNGSADRFIKTLQLKVTGRVPLILMSGGNG 123

Query: 72  -----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF-HHVLIV 125
                 ++ +   +       ++ + CI I  ++ NT  NA                L+V
Sbjct: 124 QLIKTSNLKEADYVFSQFKAFNIPDSCIMIENQSRNTLENAMFTKRILIDKKVPGPYLLV 183

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK--------IKILRVLLIEYL 177
           T  +HM R+    ++I   +   PYP      +   S+          +    + + E +
Sbjct: 184 TSAFHMRRSAYIFKKI--GINVTPYPCDFIAGKSAVSLSDFIIPDPLALAQWNIYIKEVV 241

Query: 178 KILLLSIQ 185
             +   ++
Sbjct: 242 GFVAYYLK 249


>gi|190149832|ref|YP_001968357.1| hypothetical protein APP7_0563 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307249724|ref|ZP_07531703.1| hypothetical protein appser4_5270 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307263153|ref|ZP_07544774.1| hypothetical protein appser13_5750 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914963|gb|ACE61215.1| hypothetical protein APP7_0563 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306858232|gb|EFM90309.1| hypothetical protein appser4_5270 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306871515|gb|EFN03238.1| hypothetical protein appser13_5750 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 252

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 52/144 (36%), Gaps = 17/144 (11%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGE-------PIR--IERA-------FELLENQIG 62
            I  + + +++ I D+    AIVVL G          R  I  A          L  Q G
Sbjct: 64  LIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYAIAAAPLERMRYAAYLHKQTG 123

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHH 121
             I ++G      +           D     +  +   +  TE NA  + A  ++     
Sbjct: 124 LPILVTGGSPEGREPEAKIIAQELHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDR 183

Query: 122 VLIVTHDYHMPRTFLELQRINSTV 145
           +++VT+ +HM R  +  +R    V
Sbjct: 184 IILVTNQWHMKRAKMLFEREGFNV 207


>gi|253584074|ref|ZP_04861272.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251834646|gb|EES63209.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 252

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 35/151 (23%), Positives = 62/151 (41%), Gaps = 11/151 (7%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           G   RI +  +   N+  +KI++SG        S+  + ++  I   +    I I  K+ 
Sbjct: 102 GANTRIMKTAQFY-NKYPKKIYVSGGTPLQNKESESSVYKRELIGLGVPAEDIVIEEKSR 160

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT+ NA       E+      +++T  +HMPR+     +    + F P P       E  
Sbjct: 161 NTKENAVYIKKMMEEAKEKKAVLITSAFHMPRSVKTFDKGEEGLIFYPAPCDFMAKSETE 220

Query: 162 SIFKI-------KILRVLLIEYLKILLLSIQ 185
           + F         K L +LL EY+ ++   I+
Sbjct: 221 NFFDYIPKYVNFKKLGLLLKEYIGMVYYKIR 251


>gi|229097607|ref|ZP_04228566.1| hypothetical protein bcere0020_28490 [Bacillus cereus Rock3-29]
 gi|229106282|ref|ZP_04236779.1| hypothetical protein bcere0019_52930 [Bacillus cereus Rock3-28]
 gi|229116606|ref|ZP_04245993.1| hypothetical protein bcere0017_28920 [Bacillus cereus Rock1-3]
 gi|228666916|gb|EEL22371.1| hypothetical protein bcere0017_28920 [Bacillus cereus Rock1-3]
 gi|228677137|gb|EEL31517.1| hypothetical protein bcere0019_52930 [Bacillus cereus Rock3-28]
 gi|228685877|gb|EEL39796.1| hypothetical protein bcere0020_28490 [Bacillus cereus Rock3-29]
          Length = 219

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 59/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKTDDDVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYALKQGVKEEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N  H   IV+   HM R      RI   +    Y   + 
Sbjct: 144 EVGIENGIHSYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|168178023|ref|ZP_02612687.1| putative sanA protein [Clostridium botulinum NCTC 2916]
 gi|182670781|gb|EDT82755.1| putative sanA protein [Clostridium botulinum NCTC 2916]
          Length = 222

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 66/174 (37%), Gaps = 27/174 (15%)

Query: 2   RYFWYGLFVCLIF-FIMGFISFIRYVKQ----MHIPDHPSVSAIVVLTGE---------- 46
           R F   + + L+    + FI F    +     ++  D P   AI+VL G           
Sbjct: 7   RMFMVIMVIVLMGTAAIFFIDFRVRSESKKYIVNPKDVPEAEAILVL-GAYVKPNGKLCD 65

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALN 102
               R+    +L +N   +K+  SG H   + D +  ++K+  ++ + +  I + +   +
Sbjct: 66  MLEDRVAVGIDLYKNNKAKKLLFSGDHGQANYDEVNGMKKVAEKKGVKKEDIFLDHAGFS 125

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
           T  +   A    +      ++IVT  YH+ R       I   +    Y + S  
Sbjct: 126 TYESMYRAKEIFKAKK---IIIVTQQYHLMRAV----YIARQLGLDAYGVNSDQ 172


>gi|15644422|ref|NP_229474.1| hypothetical protein TM1674 [Thermotoga maritima MSB8]
 gi|4982249|gb|AAD36741.1|AE001808_16 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 237

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 64/169 (37%), Gaps = 25/169 (14%)

Query: 2   RYFWYGLFVCLIFFI--MGFISFIRYVK-QMHIPDHPSVSA-IVVLTGEPIRIERAFELL 57
           R+F   L   +  F   +G   F+  ++  + +P      A IVVL G   R  +A + L
Sbjct: 32  RWFLLALAAIVYLFSSYVGEFLFLWPLEKNLDVPATLPNDAVIVVLGGGVERNTKAGDNL 91

Query: 58  ENQIGEKIFISGV--HHSV---------------SKDILLQKIPIRQDLAECCIDIGYKA 100
            +    ++  +GV  +                  S+ ++++   +   + E  I +  ++
Sbjct: 92  SDATLRRLL-TGVQIYQKTKMPILVTGGSLTGLRSEAMIMKDYLVSLGVPEEKITVEDRS 150

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            NT  NA        K     +++VT   HM R     +R   +V   P
Sbjct: 151 RNTYENALFTRE---KIGDVPIILVTDSIHMRRAVFTFKRFFQSVTPYP 196


>gi|325135386|gb|EGC58007.1| periplasmic protein [Neisseria meningitidis M0579]
 gi|325201201|gb|ADY96655.1| conserved hypothetical protein [Neisseria meningitidis M01-240149]
 gi|325207058|gb|ADZ02510.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33]
          Length = 214

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 58/152 (38%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F   +F F++ F   +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|307260971|ref|ZP_07542653.1| hypothetical protein appser12_5380 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306869273|gb|EFN01068.1| hypothetical protein appser12_5380 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 252

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 51/140 (36%), Gaps = 17/140 (12%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGE-------PIR--IERA-------FELLENQIGEKIF 66
           + + +++ I D+    AIVVL G          R  I  A          L  Q G  I 
Sbjct: 68  VTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYAIAAAPLERMRYAAYLHKQTGLPIL 127

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           ++G      +           D     +  +   +  TE NA  + A  ++     +++V
Sbjct: 128 VTGGSPEGREPEAKIMAQELHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDRIILV 187

Query: 126 THDYHMPRTFLELQRINSTV 145
           T+ +HM R  +  +R    V
Sbjct: 188 TNQWHMKRAKMLFEREGFNV 207


>gi|170078552|ref|YP_001735190.1| hypothetical protein SYNPCC7002_A1947 [Synechococcus sp. PCC 7002]
 gi|169886221|gb|ACA99934.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 218

 Score = 62.2 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 55/158 (34%), Gaps = 11/158 (6%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
               + LI    G I++ R    +         AI VL G   R   A +  +     K+
Sbjct: 25  RWFVLGLIGLTCGAIAYQRIQGALRP-----AKAIFVLGGHEERERFAAQFAQEHPDLKV 79

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           ++S          +     I  D  +    + Y+A +T  N        ++ N   V ++
Sbjct: 80  WVSSGSPPEYARQIFANYQIEGDRLQ----LDYQAEDTVTNFTSLVDEFKQENIDSVYLI 135

Query: 126 THDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENS 161
           T + HM R  L    +     +   P P+ S +  E +
Sbjct: 136 TSENHMNRAKLVASIVFGTRDIAIKPVPVPSDNPPETT 173


>gi|254804041|ref|YP_003082262.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           alpha14]
 gi|254667583|emb|CBA03327.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           alpha14]
          Length = 218

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 58/152 (38%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F   +F F++ F   +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKHPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|291278482|ref|YP_003495317.1| hypothetical protein DEFDS_0049 [Deferribacter desulfuricans SSM1]
 gi|290753184|dbj|BAI79561.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 237

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 67/165 (40%), Gaps = 18/165 (10%)

Query: 38  SAIVVLTGEP-----------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIP 84
            A+V+L G              R+   + L+  +  + I +SG  V  ++  + L+ +  
Sbjct: 74  DAVVILGGGVYADGELKEDSLKRLVEGY-LIAKKANKPIILSGGKVFKNLEPESLIMRNK 132

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRIN 142
           +     +  I I   + +T  NA         NNF+ VL++T  YH  R+    E   IN
Sbjct: 133 LLNLGFDGEIFIDDTSKDTNENATFVKKIIAANNFNKVLLITSGYHAMRSKMLFEKHGIN 192

Query: 143 STVQFIPYPIISHD--LEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           S V  +   I      ++       +  +  ++ EYL IL  S++
Sbjct: 193 SCVVLVDKKIDKKYNFVDFLPVASNLHTISKVIKEYLGILYYSMK 237


>gi|323493229|ref|ZP_08098358.1| hypothetical protein VIBR0546_19494 [Vibrio brasiliensis LMG 20546]
 gi|323312495|gb|EGA65630.1| hypothetical protein VIBR0546_19494 [Vibrio brasiliensis LMG 20546]
          Length = 267

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 49/118 (41%), Gaps = 9/118 (7%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     +L    G K+ +SG      VS   ++ K+ +   +A+  I +   A +T
Sbjct: 105 GLMRLSEGIRILRIYPGAKLILSGYAAGSEVSNARMMAKVALALGVAKSDIILLETAKDT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
              A++A+A+        +++VT   HM R   E           PY   ++ L  ++
Sbjct: 165 WEEARQAAAFVSTKK---LVVVTSASHMKRALNEFHSAG----LKPYAAPTNYLAHDN 215


>gi|37680486|ref|NP_935095.1| hypothetical protein VV2302 [Vibrio vulnificus YJ016]
 gi|320155855|ref|YP_004188234.1| membrane protein [Vibrio vulnificus MO6-24/O]
 gi|326423949|ref|NP_760999.2| membrane protein [Vibrio vulnificus CMCP6]
 gi|37199234|dbj|BAC95066.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319931167|gb|ADV86031.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio vulnificus MO6-24/O]
 gi|319999327|gb|AAO10526.2| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio vulnificus CMCP6]
          Length = 266

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 48/115 (41%), Gaps = 9/115 (7%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +L+   G K+ +SG       S   ++  + +   +A+  I +   A +T   
Sbjct: 108 RLTEGIRILKMYPGSKLILSGYAGGSETSHARMMANVALALGVAKSDIILLEDAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           A++A+A+  +     +++VT   HM R   E           P P  ++ L + +
Sbjct: 168 ARQAAAFVRQKQ---LVLVTSASHMARAMKEF----HDAGITPLPAPTNYLAQKN 215


>gi|167587349|ref|ZP_02379737.1| hypothetical protein BuboB_18529 [Burkholderia ubonensis Bu]
          Length = 224

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/187 (12%), Positives = 57/187 (30%), Gaps = 33/187 (17%)

Query: 6   YGLFVCLIFFIMGFISFIRYV-----KQMHIPDHPSVSAIVVL----------------- 43
                  +F+++        +       +   +HP +    VL                 
Sbjct: 10  IAAVAFALFWLLATGWLAAPLIAWSQAGVTPVEHPDMHGQTVLILLGTGTRRIDGRLEPR 69

Query: 44  TGEPIRIERAFELLEN--QIGEK--IFISGVHHS---VSKDILLQKIPIRQDLAECCIDI 96
           T    RI +   L  +  Q  E+  + +SG        ++        + + +    + +
Sbjct: 70  TDGFPRIRKTAALYRDCRQRAERCTVIVSGGDPERHGATEAATYAPYLVARGVDPRDLML 129

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
              +  T  NA+  +      +    ++VT  Y M R  L+ +      Q    P+ ++ 
Sbjct: 130 EANSRTTYENAKFTTPILRSRHVDATILVTSSYQMRRALLDFRHFGIDAQ----PVYANR 185

Query: 157 LEENSSI 163
            +  +  
Sbjct: 186 RDAQTGW 192


>gi|294507679|ref|YP_003571737.1| hypothetical protein SRM_01864 [Salinibacter ruber M8]
 gi|294344007|emb|CBH24785.1| Conserved hypothetical protein [Salinibacter ruber M8]
          Length = 180

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 37/106 (34%), Gaps = 5/106 (4%)

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
           I +  K+ NT  NA   +   ++   + VL+VT   HMPR     +         P  + 
Sbjct: 56  ILLESKSANTYENATRTAELLDRRGLNCVLLVTSALHMPRALAVFRSAGIKAVPAPTDVQ 115

Query: 154 SHD-----LEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTAS 194
             D     L+       +      + EY+  L+   +  +     S
Sbjct: 116 VGDRNYTVLDVLPDAGALAGSTAAIREYVGYLVYDWRGWIDGPAGS 161


>gi|226364924|ref|YP_002782706.1| hypothetical protein ROP_55140 [Rhodococcus opacus B4]
 gi|226243413|dbj|BAH53761.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 185

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 49/138 (35%), Gaps = 5/138 (3%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP-IRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPI 85
            + H+     V AI+VL G+   R E   EL        + +S  H     D  + +   
Sbjct: 31  SKSHVDPMRPVDAIIVLGGDRDGREEYGIELAREGFSTNVVLS--HPYWKGDRKMAEFCA 88

Query: 86  RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV 145
            QD       +  +   T G A      A ++ +  VL+++  YH+PR      +     
Sbjct: 89  IQDQRFTVTCVPPQPRTTRGEALFTRDLAAQHGWTSVLVISWRYHLPRARYIFSQCFEG- 147

Query: 146 QFIPYPIISH-DLEENSS 162
           + +  P+    D      
Sbjct: 148 EIVMRPVPRDYDFSVAHW 165


>gi|304388801|ref|ZP_07370857.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|304337253|gb|EFM03431.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
          Length = 218

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 58/152 (38%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F   +F F++ F   +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|118591094|ref|ZP_01548493.1| hypothetical protein SIAM614_15747 [Stappia aggregata IAM 12614]
 gi|118436170|gb|EAV42812.1| hypothetical protein SIAM614_15747 [Stappia aggregata IAM 12614]
          Length = 265

 Score = 61.8 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 53/171 (30%), Gaps = 23/171 (13%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIV-----------------VLTGEP 47
           + GL VC       ++      +        +   I+                  LT   
Sbjct: 47  FAGLVVCAFSPAANWLIVPLEDRFQRPATLENYDGIIILGGAVDTVVTGVRGDTALTMSA 106

Query: 48  IRIERAFELLENQIGEKIFISG-----VHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
            R+     L +     KI  +G     V    ++     ++     +A   I +  ++ N
Sbjct: 107 ERVTITARLAKALPAAKIIHTGGQGMIVSSQATEAEGAARLFRDFGIAPERIILEDQSQN 166

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
           T  NA  A    +       L+VT  YHMPR+    ++         YP+ 
Sbjct: 167 TWQNAVYAKKIVQPQPGQRWLLVTSAYHMPRSMGVFEKAG-WTGVTAYPVD 216


>gi|116073939|ref|ZP_01471201.1| hypothetical protein RS9916_35852 [Synechococcus sp. RS9916]
 gi|116069244|gb|EAU74996.1| hypothetical protein RS9916_35852 [Synechococcus sp. RS9916]
          Length = 193

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 64/177 (36%), Gaps = 15/177 (8%)

Query: 2   RYFWY-GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           R+ W  G  +  +   +    + + +     P+      I+VL G+  R     +L    
Sbjct: 4   RWGWVAGAGLLGVVCALPLRPYHQALVTAQPPER-----ILVLGGDVDRERAGLQL---- 54

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
              ++ +  V    S       +   + L E  + + Y+A +T GN         +    
Sbjct: 55  -ARRLNLPLVVSGGSNPEYAHWLMETEGLREGQVVLDYRANDTLGNFTSLVDDLREQGVQ 113

Query: 121 HVLIVTHDYHMPRTFL--ELQRINSTVQFIPYPII--SHDLEENSSIFKIKILRVLL 173
           HVL+VT + H+PR      L   +  ++    P+      ++E+        LR L 
Sbjct: 114 HVLLVTSEDHLPRALTVGSLVAGSRGIRLTGVPVSCGVDCVQESPGKRWGDGLRALA 170


>gi|121534257|ref|ZP_01666081.1| protein of unknown function DUF218 [Thermosinus carboxydivorans
           Nor1]
 gi|121307027|gb|EAX47945.1| protein of unknown function DUF218 [Thermosinus carboxydivorans
           Nor1]
          Length = 192

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 56/144 (38%), Gaps = 15/144 (10%)

Query: 26  VKQMHIPDHPSVSAIVVL----------TGEPIRIERAFELLENQIGEKIFISGV---HH 72
           V Q+  P+      I+VL          T   +R++ A +L +      I +SG      
Sbjct: 29  VGQLAKPEP--GDVIIVLGAKLIGHEPSTMLRLRLDEAAKLYQAGYAPFIIVSGAQGCDE 86

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
            +S+   ++   I   +    I +  K+ NT+ N   + A   ++     +IV++  H+ 
Sbjct: 87  VISEAAAMRNYLIAHGVPADRILLEDKSFNTQQNLANSLAIMREHGLQRAIIVSNASHIR 146

Query: 133 RTFLELQRINSTVQFIPYPIISHD 156
           R  +    +       P P+ ++ 
Sbjct: 147 RALVIAHNLGMEASGAPAPMANNA 170


>gi|303252155|ref|ZP_07338323.1| hypothetical protein APP2_1129 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247491|ref|ZP_07529536.1| hypothetical protein appser2_4870 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648938|gb|EFL79126.1| hypothetical protein APP2_1129 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855994|gb|EFM88152.1| hypothetical protein appser2_4870 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 252

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 53/144 (36%), Gaps = 17/144 (11%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGE-------PIR--IERA-------FELLENQIG 62
            I  + + +++ I D+    AIVVL G          R  I  A          L  Q G
Sbjct: 64  LIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYAIAAAPLERMRYAAYLHKQTG 123

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHH 121
             I ++G      +           D     +  +   +  TE NA  + A  ++     
Sbjct: 124 LPILVTGGSPEGREPEAKIMAQELHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDR 183

Query: 122 VLIVTHDYHMPRTFLELQRINSTV 145
           +++VT+ +HM RT +  +R    V
Sbjct: 184 IILVTNQWHMKRTKMLFEREGFNV 207


>gi|218767273|ref|YP_002341785.1| putative periplasmic protein [Neisseria meningitidis Z2491]
 gi|121051281|emb|CAM07557.1| putative periplasmic protein [Neisseria meningitidis Z2491]
 gi|319409538|emb|CBY89825.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           WUE 2594]
          Length = 218

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 58/152 (38%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F   +F F++ F   +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKHPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|221197747|ref|ZP_03570793.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221204695|ref|ZP_03577712.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221214890|ref|ZP_03587858.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221165117|gb|EED97595.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221175552|gb|EEE07982.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221181679|gb|EEE14080.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 238

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/189 (13%), Positives = 57/189 (30%), Gaps = 31/189 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFIS--FIRYVK-QMHIPDHPSVSA---IVVLTGEPIRIERAFE 55
           R               G+++  F+ + +  +   +HP +     ++VL     R +    
Sbjct: 22  RRIALAAVALFWLIASGWLAAPFVAWAEAGVEPVEHPDMHGQTVLIVLGAGTQRADDGLR 81

Query: 56  LLENQIGEK------------------IFISGVHHSVSKDILLQKIP---IRQDLAECCI 94
              +                       + +SG       D          +   +    +
Sbjct: 82  PPRDGAARIRKAAELYRTCRRQAERCTVVMSGGDPQHHGDTEAAVYGRGLVAAGIDPGDL 141

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  K+  T  NAQ  ++          +++T  Y M R  L+ +R        P P+ +
Sbjct: 142 VLEPKSRTTYENAQFTTSILRSRRDDARILITSSYQMRRALLDFRRFGID----PQPVFA 197

Query: 155 HDLEENSSI 163
           +  E ++  
Sbjct: 198 NRREAHTGW 206


>gi|294085382|ref|YP_003552142.1| hypothetical protein SAR116_1815 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664957|gb|ADE40058.1| DUF218 [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 264

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 68/223 (30%), Gaps = 44/223 (19%)

Query: 2   RYFWYGLFVCLIF-FIMGFI-------SFIRYVKQMHIPDHPSVSAIVVL---TG----- 45
           R+      V +I   + GFI        F+     + I +   +  I++L   TG     
Sbjct: 36  RWARMFTIVAVILPLLYGFIPLSHIPLQFLENRFDVPILEGRPLDGIIILGGHTGNGEIS 95

Query: 46  ----------EPIRIERAFEL---------LENQIGEKIFISGVHHSVSKDILLQKIPIR 86
                        R   A  L         L +    ++   G   + +   LL ++ + 
Sbjct: 96  EGRGQPQLSAAAERFTTALHLHRQFPDLPILFSGFSGELMPKGWSETQTIKRLLDELGMA 155

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
           +      I     + NT  NA  +            ++VT   HMPR     +       
Sbjct: 156 ESP---NILFESTSRNTYENALYSETVLSPQPGSFWVLVTSASHMPRAVGSFRNAGWG-G 211

Query: 147 FIPYPIISHDLEEN-----SSIFKIKILRVLLIEYLKILLLSI 184
            IPYP+    L        +    +  + ++  EY  +    +
Sbjct: 212 VIPYPVDYQTLPSGFPYIWNLPRGLHTMTIVFHEYAGLFAYWL 254


>gi|308388228|gb|ADO30548.1| putative periplasmic protein [Neisseria meningitidis alpha710]
          Length = 214

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKHPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|289209654|ref|YP_003461720.1| hypothetical protein TK90_2494 [Thioalkalivibrio sp. K90mix]
 gi|288945285|gb|ADC72984.1| protein of unknown function DUF218 [Thioalkalivibrio sp. K90mix]
          Length = 215

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 59/192 (30%), Gaps = 43/192 (22%)

Query: 27  KQMHIPDHPS---VSAIVVLTGE--------PIRIERAFELLENQIGEKI--------FI 67
           +    PD        AIVVL                    L+  +    +         +
Sbjct: 28  EGFAPPDDNQLADAQAIVVLGAGYRSGAEEFSGETVHDLALVRLRYAAYLHHRTGLPVMV 87

Query: 68  SGVHHSVSK------DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           SG               +L++  +   L E        A +T GNA+ ++          
Sbjct: 88  SGGGPEERVPEADYMAEVLKEYGVHPILRE------PNARDTWGNARHSAEQLHAEGIER 141

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK--------ILRVLL 173
           V +V+H +HMPR     +R    ++ IP P  ++   +N    +             + L
Sbjct: 142 VALVSHAHHMPRATWSFERA--GLEIIPAPTGAYVPRDNGWSLEGFRPQASAVWASWLAL 199

Query: 174 IEYLKILLLSIQ 185
            EY    +   +
Sbjct: 200 HEY--WGMAWYR 209


>gi|307151691|ref|YP_003887075.1| hypothetical protein Cyan7822_1814 [Cyanothece sp. PCC 7822]
 gi|306981919|gb|ADN13800.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7822]
          Length = 200

 Score = 61.8 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 61/175 (34%), Gaps = 11/175 (6%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +      +++  +  + G+ S+      +  P+     AIVVL G   R   A  L    
Sbjct: 14  LTLLRQIIYLLPVVSVGGWWSYNEIQSYLVKPE-----AIVVLGGHEERERYAAHLASKN 68

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               I++S    S     +  K  +          + YKA +T  N        +     
Sbjct: 69  PTLPIWVSSGSPSNYVKRIFAKAGVNSTRLH----LDYKAKDTVTNFTTLVDQLKAQGID 124

Query: 121 HVLIVTHDYHMPRTFL--ELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
            V ++T + HM R ++  E+   +  +   P  + SH   E+         R LL
Sbjct: 125 SVYLITSENHMRRAWIVGEIVFGSRGIVIKPLAVPSHARPESFKKCLRDGARALL 179


>gi|315283550|ref|ZP_07871714.1| putative cytoplasmic protein [Listeria marthii FSL S4-120]
 gi|313612811|gb|EFR86789.1| putative cytoplasmic protein [Listeria marthii FSL S4-120]
          Length = 183

 Score = 61.4 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 63/157 (40%), Gaps = 18/157 (11%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL----TGEP--------IRIERAFE 55
           L + +I FI   I             + +   ++VL     G+P         R++ A  
Sbjct: 3   LILIVIGFIYLLIVAAFMFSGARAKPNGNADTVLVLGARVNGDPAEPSSVLKERLDTAVA 62

Query: 56  LLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L      K+ +SG      S S+  ++++  + Q +A   I++  K+  TE N + +  
Sbjct: 63  YLNENPTLKVIVSGGQGEDESASEASVMEEYLVNQGIARNRINVEDKSTRTEENLKYSK- 121

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
              K N    +IVT DYHM R  +  +R       +P
Sbjct: 122 --GKFNLGKTVIVTSDYHMYRALMLAKRQGVDASGLP 156


>gi|325143566|gb|EGC65887.1| hypothetical protein NMBM01240013_2108 [Neisseria meningitidis
           M01-240013]
 gi|325205110|gb|ADZ00563.1| conserved hypothetical protein [Neisseria meningitidis M04-240196]
          Length = 218

 Score = 61.4 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 58/152 (38%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F   +F F++ F   +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|228986175|ref|ZP_04146317.1| hypothetical protein bthur0001_28620 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228773556|gb|EEM21980.1| hypothetical protein bthur0001_28620 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 219

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 144 EVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|229139714|ref|ZP_04268284.1| hypothetical protein bcere0013_28240 [Bacillus cereus BDRD-ST26]
 gi|228643845|gb|EEL00107.1| hypothetical protein bcere0013_28240 [Bacillus cereus BDRD-ST26]
          Length = 219

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 144 EVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|217960516|ref|YP_002339078.1| hypothetical protein BCAH187_A3129 [Bacillus cereus AH187]
 gi|217066516|gb|ACJ80766.1| conserved hypothetical protein [Bacillus cereus AH187]
          Length = 210

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 135 EVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 174


>gi|52142423|ref|YP_084406.1| hypothetical protein BCZK2819 [Bacillus cereus E33L]
 gi|206974549|ref|ZP_03235465.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|222096575|ref|YP_002530632.1| epih/gdmh-related protein [Bacillus cereus Q1]
 gi|51975892|gb|AAU17442.1| conserved hypothetical protein [Bacillus cereus E33L]
 gi|206747192|gb|EDZ58583.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|221240633|gb|ACM13343.1| EpiH/GdmH-related protein [Bacillus cereus Q1]
          Length = 210

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 135 EVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 174


>gi|47564233|ref|ZP_00235278.1| EpiH/GdmH-related protein [Bacillus cereus G9241]
 gi|47558385|gb|EAL16708.1| EpiH/GdmH-related protein [Bacillus cereus G9241]
          Length = 210

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 135 EVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 174


>gi|229197269|ref|ZP_04324000.1| hypothetical protein bcere0001_28180 [Bacillus cereus m1293]
 gi|228586228|gb|EEK44315.1| hypothetical protein bcere0001_28180 [Bacillus cereus m1293]
          Length = 219

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + +  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKDEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 144 EVGVENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|15675952|ref|NP_273070.1| EpiH/GdmH-related protein [Neisseria meningitidis MC58]
 gi|7225229|gb|AAF40483.1| EpiH/GdmH-related protein [Neisseria meningitidis MC58]
 gi|316984529|gb|EFV63495.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325129274|gb|EGC52113.1| hypothetical protein NMBOX9930304_1979 [Neisseria meningitidis
           OX99.30304]
 gi|325139474|gb|EGC62014.1| periplasmic protein [Neisseria meningitidis CU385]
 gi|325199239|gb|ADY94694.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
          Length = 214

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|239787465|emb|CAX83936.1| conserved uncharacterized protein [uncultured bacterium]
          Length = 258

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 55/174 (31%), Gaps = 19/174 (10%)

Query: 26  VKQMHIPDHPSVSAI-VVLTGEPIRIERAFELLENQIGEKIFISGVHH---SVSKDILLQ 81
           +     P  P       V TG   RI      L  + G  I  SG        S+  L++
Sbjct: 86  LGHGRYPAAPEYDGADTVNTGGLARIRYG-AWLHRRTGLPILTSGGKPFQEKESEAQLMK 144

Query: 82  -----KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
                +  +     E        + NT  NA+            HVL+VTH  HM R   
Sbjct: 145 RALEKEFGVPVRWTED------SSDNTLENARNTQKILAAQGIDHVLLVTHGNHMVRALQ 198

Query: 137 ELQRINSTVQFIP--YPIISHDLEENSSIF-KIKILRVLLIEYLKILLLSIQLS 187
              +    +   P  +   + +      +    + + V L EY+  L   ++  
Sbjct: 199 TFHQAGLKITPAPTLFQTPTPNAGILDWLPLSCRGVWVPLHEYVGRLWYQLRCG 252


>gi|229488511|ref|ZP_04382377.1| integral membrane protein [Rhodococcus erythropolis SK121]
 gi|229324015|gb|EEN89770.1| integral membrane protein [Rhodococcus erythropolis SK121]
          Length = 235

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 49/168 (29%), Gaps = 21/168 (12%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------IR 49
           R+      +  + +    +               +  A VV+                 R
Sbjct: 25  RWVAGIAVLGAVVYAGSIVWISVASAGHTSDAADAPDAPVVIVLGAQIKDGKPMAFLKGR 84

Query: 50  IERAFELLENQIGEKIFISGVHHSVSKDILLQKIP--IRQDLAECCIDIGYKALNTEGNA 107
           ++ A EL+E    + + +SG  +  S D +       + Q +    I      L+T    
Sbjct: 85  LDAAVELVEAGKAKAVLVSGDANGGSGDEIAAMTNYLVEQGIDARRIVGDPYGLDTYDTC 144

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
             A            LIVT  YH+PR       +   V      + S 
Sbjct: 145 FRA---IHTYGVTKALIVTQGYHVPRAV----ALCRDVGIDADGVNSD 185


>gi|254197234|ref|ZP_04903656.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|169653975|gb|EDS86668.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 240

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 47/122 (38%), Gaps = 11/122 (9%)

Query: 49  RIERAFELLEN--QIGEK--IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI++  EL     +  ++  + +SG    V    +        + + +A   +    ++ 
Sbjct: 91  RIDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSH 150

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+  +      ++  +++VT  Y M R  L+ +       F P P+ ++  +   
Sbjct: 151 TTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFEWFG----FAPQPVYANRRDARL 206

Query: 162 SI 163
             
Sbjct: 207 GW 208


>gi|110633611|ref|YP_673819.1| hypothetical protein Meso_1258 [Mesorhizobium sp. BNC1]
 gi|110284595|gb|ABG62654.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 268

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 53/135 (39%), Gaps = 8/135 (5%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISG------VHHSVSKDILLQKIPIRQDLAECCI 94
           + LT    R+ +  E        +I +SG      + H  ++  L +++ ++  +    I
Sbjct: 102 IALTDAAERLTKTAEFNRLYPNARILLSGGINDLLITHDRTEAALARELLVKIGVPADRI 161

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
           ++  ++ NT  NA E+ A A        L+VT  +HMPR     +        +PYP+  
Sbjct: 162 ELEERSRNTCENAIESKAVAAPKPGETWLLVTSAFHMPRAVGCFRAA--GFPVLPYPVDY 219

Query: 155 HDLEENSSIFKIKIL 169
                  S     + 
Sbjct: 220 LARRSALSSLAPSVA 234


>gi|325203138|gb|ADY98591.1| conserved hypothetical protein [Neisseria meningitidis M01-240355]
          Length = 218

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKHPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|189350313|ref|YP_001945941.1| hypothetical protein BMULJ_01475 [Burkholderia multivorans ATCC
           17616]
 gi|189334335|dbj|BAG43405.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 238

 Score = 61.4 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 61/203 (30%), Gaps = 32/203 (15%)

Query: 2   RYFWYGLFVCLIFFIMGFIS--FIRYVK-QMHIPDHPSVSA---IVVLTGEPIRIERAFE 55
           R               G+++  FI + +  +   +HP +     ++VL     R +    
Sbjct: 22  RRIALAAVALFWLIASGWLAAPFIAWAEAGVEPVEHPDMHGQTVLIVLGAGTQRADDGLR 81

Query: 56  LLENQIGEK------------------IFISGVHHSVSKDILLQKIP---IRQDLAECCI 94
              +                       + +SG       D          +   +    +
Sbjct: 82  PPRDGAARIRKAAELYRSCRRQAERCTVVMSGGDPQHHGDTEAAVYGRGLVAAGVDPGDL 141

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  K+  T  NAQ  ++          +++T  Y M R  L+ +R        P P+ +
Sbjct: 142 VLEPKSRTTYENAQFTTSILRSRRDDARILITSSYQMRRALLDFRRFGID----PQPVFA 197

Query: 155 HDLEENSSIFKIKILRVLLIEYL 177
           +  E  +     +   V+  E+ 
Sbjct: 198 NRREAQTGWL-PRWSNVVATEFA 219


>gi|148560243|ref|YP_001259097.1| hypothetical protein BOV_1136 [Brucella ovis ATCC 25840]
 gi|148371500|gb|ABQ61479.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 268

 Score = 61.4 bits (148), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 50/170 (29%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 52  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 111

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K  NT
Sbjct: 112 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKLRNT 171

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 172 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 219


>gi|312963224|ref|ZP_07777708.1| protein of unknown function DUF218 [Pseudomonas fluorescens WH6]
 gi|311282490|gb|EFQ61087.1| protein of unknown function DUF218 [Pseudomonas fluorescens WH6]
          Length = 253

 Score = 61.4 bits (148), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 47/157 (29%), Gaps = 24/157 (15%)

Query: 36  SVSAIVVLTGEPIRIE--------RAFELLENQIGEKI--------FISGV-HHSVSKDI 78
              AIVVL     R +            L   +   ++          SG  H+      
Sbjct: 79  RADAIVVLGSGRERGDPAWGADQPTGIGLERQRYAARLAKASGLPVLTSGGLHYGTPPSE 138

Query: 79  LLQKIPIRQDLAECCIDI-GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
                   QD     +     ++  T  NA+ ++          V++VT  +HM R    
Sbjct: 139 AQLMAVSMQDDFGVTVRWKEERSRTTWENARMSAEILLPEGIKRVVVVTQAWHMSRAVWS 198

Query: 138 LQRINSTVQFIPYPI----ISHDLEENSSIFKIKILR 170
            ++       +P P+    + +       + + K + 
Sbjct: 199 FEKA--GFTVVPAPVGFLGVDNARPLGGWMPEFKSVW 233


>gi|325519750|gb|EGC99059.1| hypothetical protein B1M_38501 [Burkholderia sp. TJI49]
          Length = 210

 Score = 61.4 bits (148), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 69/216 (31%), Gaps = 28/216 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIV-------------VLTGEP 47
           M      L V    +I   ++ +     M +PD P+  A++             VL    
Sbjct: 1   MARTGRLLAVLACLWIGAAVALV--ASGMRMPDGPADLAVIFGNALDDNGAPKPVL---A 55

Query: 48  IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
            R++             + +SG      +++   ++   + + +    I +     NT  
Sbjct: 56  ARLDVGVRCYHAGRCPTLLVSGAIDGPGLNEAAAMRDYLVARGVPAERIVVDELGDNTLA 115

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
            AQ   A+        VLIV+  YH+ R  L  +R+      I    +            
Sbjct: 116 TAQHTLAYMRAQRLSSVLIVSQSYHLARARLAFERVG-----IARADLRAAYPRGFQWRD 170

Query: 166 IKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
           +        E     + +++L L+       F  ++
Sbjct: 171 LYSSW---REVPAYAVYAVRLWLNPDARPVSFRPML 203


>gi|317506975|ref|ZP_07964744.1| DUF218 domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
 gi|316254733|gb|EFV14034.1| DUF218 domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
          Length = 184

 Score = 61.4 bits (148), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 50/136 (36%), Gaps = 11/136 (8%)

Query: 33  DHPSVSAIVVLTGEP-IRIERAFELLENQIGEKIFIS---GVHHSVSKDILLQKIPIRQD 88
                 A+VVL G P  R      L E  +  ++ IS   G    V + I      +R  
Sbjct: 39  PLRPADAVVVLGGAPYERFRYGIGLGERGLAPQVVISNSIGPDDPVMRQICAAPTHVR-- 96

Query: 89  LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQF 147
              C + + +   +T G AQE    A   ++  +++VT   H+ R    ++R     +Q 
Sbjct: 97  -LTCFLPVPW---STRGEAQEIRRLAASRHWRSIIVVTTTAHIERARYIVRRCFAGDIQM 152

Query: 148 IPYPIISHDLEENSSI 163
             YP      E     
Sbjct: 153 TDYPERRGAWESVYGW 168


>gi|119493570|ref|ZP_01624235.1| hypothetical protein L8106_26002 [Lyngbya sp. PCC 8106]
 gi|119452624|gb|EAW33806.1| hypothetical protein L8106_26002 [Lyngbya sp. PCC 8106]
          Length = 216

 Score = 61.4 bits (148), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 56/138 (40%), Gaps = 8/138 (5%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS-GVHHSVSKDILLQKIPI 85
             + +   P   AI++L G P R E   E  +     ++++S GV        + Q+  +
Sbjct: 38  STLALQQTPEPQAILMLGGNPNREEFTAEFAKKHDHLEVWVSSGVDRRT-ATEIFQQAGV 96

Query: 86  RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI--NS 143
                   + + Y+A++T  N        +K +  HV ++T D+HM R       +  + 
Sbjct: 97  DLG----RVHLDYRAVDTVTNFSTLVEDLKKRDISHVYLITSDFHMSRAMAIASIVFGSQ 152

Query: 144 TVQFIPYPIISHDLEENS 161
            + F P PI +      S
Sbjct: 153 GIAFTPVPIPTQGYPSES 170


>gi|113475490|ref|YP_721551.1| hypothetical protein Tery_1821 [Trichodesmium erythraeum IMS101]
 gi|110166538|gb|ABG51078.1| protein of unknown function DUF218 [Trichodesmium erythraeum
           IMS101]
          Length = 191

 Score = 61.4 bits (148), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 57/163 (34%), Gaps = 21/163 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
             W+ L +    +I       + +     P      A++VL G   R   A E       
Sbjct: 19  ISWFLLGLLATLWIS-----YQQISGTIKPPQ----ALLVLGGAIEREAFAAEFARQH-- 67

Query: 63  EKIFI---SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             + I   SG +         + +  +  +++  + + Y A++T  N        +    
Sbjct: 68  PNLDIWVSSGSNP-----EYAEWLFSQAGISQTRLHLDYDAVDTVTNFTTTVDKLKSQGI 122

Query: 120 HHVLIVTHDYHMPRTFL--ELQRINSTVQFIPYPIISHDLEEN 160
             V +VT D HM R  +  ++   +  + F P P+ S    E 
Sbjct: 123 TSVYLVTSDDHMRRAIVIGKIVLSSRGIAFKPLPVPSGRSPEP 165


>gi|254506071|ref|ZP_05118215.1| integral membrane protein [Vibrio parahaemolyticus 16]
 gi|219550889|gb|EED27870.1| integral membrane protein [Vibrio parahaemolyticus 16]
          Length = 268

 Score = 61.4 bits (148), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 51/118 (43%), Gaps = 9/118 (7%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     ++    G K+ +SG      +S   ++ K+ +   +++  I +   A +T
Sbjct: 105 GLMRLAEGIRVMRIYPGSKLILSGYSGGSDISNARMMAKVALALGVSKSDIILLETAKDT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
              A++A+A+ +      +++VT   HM R   E           PYP  ++ L  ++
Sbjct: 165 WEEARQAAAFVK---HKKMVVVTSASHMKRALNEFHSAG----LKPYPAPTNYLAHDN 215


>gi|254254401|ref|ZP_04947718.1| hypothetical protein BDAG_03699 [Burkholderia dolosa AUO158]
 gi|124899046|gb|EAY70889.1| hypothetical protein BDAG_03699 [Burkholderia dolosa AUO158]
          Length = 204

 Score = 61.0 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 75/211 (35%), Gaps = 32/211 (15%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIV-------------VLTGEPIRIERAF 54
           L      +I+  ++   Y  +M     P+  A++             VLT    R++   
Sbjct: 2   LAAVACIWIVAAVALAAYGMRMR--SEPADVAVIFGSALDDDGAPKPVLT---ARLDVGV 56

Query: 55  ELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
               +     I +SG      +++   ++   + + +    I +  +  NT   AQ   A
Sbjct: 57  HCYRSGRCPVILVSGGIDGPGLNEATAMRDYLVARGVPADRIAVDDQGDNTLATAQHTLA 116

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEENSSIFKIKILR 170
           +   +    VLIV+  YH+ R  L  +R+    +  ++ YP      +  SS  ++    
Sbjct: 117 YMRAHRMSRVLIVSQYYHLARARLAFERVGIEPSNIYVAYPRAFQLRDVYSSWREVPA-- 174

Query: 171 VLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                     + +++L L        F  ++
Sbjct: 175 --------YAVYAVRLWLDPDARPMSFRPML 197


>gi|307261514|ref|ZP_07543183.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868797|gb|EFN00605.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 246

 Score = 61.0 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 45/136 (33%), Gaps = 28/136 (20%)

Query: 27  KQMHIPDHPSVSAIVVLTGE-------PIRIERA---------FELLENQIGEKIFISGV 70
             + + D+    AIVVL G           I               L+ +    + I+G 
Sbjct: 68  DNLTLEDYKKAQAIVVLGGGVRDSKEIYNPIAVGNQALERMRYAAYLQKETQLPLLITGS 127

Query: 71  HHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
             +         +       +          +  KA  T+ NAQ +     K   + +++
Sbjct: 128 SPNGTSEAKTMANEFQYFFSVPTQW------LEEKAKTTKENAQFSRELLAKEGINKIIL 181

Query: 125 VTHDYHMPRTFLELQR 140
           VT+ +HM R  +  ++
Sbjct: 182 VTNQWHMKRAKMLFEK 197


>gi|315445625|ref|YP_004078504.1| hypothetical protein Mspyr1_40830 [Mycobacterium sp. Spyr1]
 gi|315263928|gb|ADU00670.1| uncharacterized conserved protein [Mycobacterium sp. Spyr1]
          Length = 188

 Score = 61.0 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 52/133 (39%), Gaps = 16/133 (12%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--IRIERAFELLENQIGEK 64
            + +  +    G + F     +        V AIVVL G     R      L E    + 
Sbjct: 15  LVVILFLNGASGTLLFA----RAQADPLAKVDAIVVL-GGEHDGREAYGVGLAEQGYADT 69

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKAL---NTEGNAQEASAWAEKNNFHH 121
           + +S  +H     ++ +    R D+   C     KA     T G A  A A AE  +++ 
Sbjct: 70  VLLSNPYHGTD-AVMAEACQPRSDIEVIC-----KAPVPGTTRGEALMARALAEARDWNS 123

Query: 122 VLIVTHDYHMPRT 134
           +++V+  YH+PR 
Sbjct: 124 IIVVSWRYHLPRA 136


>gi|312881496|ref|ZP_07741288.1| hypothetical protein VIBC2010_02326 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370862|gb|EFP98322.1| hypothetical protein VIBC2010_02326 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 254

 Score = 61.0 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 52/118 (44%), Gaps = 9/118 (7%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     +L    G K+ +SG      VS   ++ K+ +   +A+  I +   A +T
Sbjct: 93  GLMRLAEGIRILRMYPGSKLILSGYAAGSDVSNARMMAKVALALGVAKPDIILLETAKDT 152

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
              A++A+A+    N  ++++VT   +M R   E           PYP  ++ L + +
Sbjct: 153 WEEARQAAAFV---NNKNLIVVTSASNMKRALNEFYSAG----LKPYPAPTNYLAQKN 203


>gi|293611000|ref|ZP_06693299.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826652|gb|EFF85018.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 261

 Score = 61.0 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 79/198 (39%), Gaps = 23/198 (11%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH--PSVSAIVVLTGE----------PI 48
           +   W   ++C   +++G   F  ++K+     +  P V AI+VL               
Sbjct: 65  LHTLWRFGWLCFWIWLIGLGYFFSFIKENKDTSNNIPPVKAIIVLGSGVENGQPSTILAK 124

Query: 49  RIERAFEL-LENQIGEKIFISGVHHSVSKDI---LLQKIPIRQDLAECCIDIGYKALNTE 104
           R++ A  L L+ Q  + +   G+  S  +     + + +  +  +A   + +  K+ +TE
Sbjct: 125 RLDTAAALALKQQQAQIVLTGGLDFSEKESEALVMSRYLEQKYHIARDQMILEDKSTSTE 184

Query: 105 GNAQEASAWAEKNNFH---HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH-DLEEN 160
            N + +    E+++      + IVT D+H+PR    + +    +Q       +      N
Sbjct: 185 LNLKNSKPLLEQHHITLDQPIAIVTSDFHIPRAIA-IAKKQGYIQVYGVAAETPLATRYN 243

Query: 161 SSIFKI--KILRVLLIEY 176
           + + +        LL EY
Sbjct: 244 AWLREYFAYASGWLLNEY 261


>gi|269792163|ref|YP_003317067.1| hypothetical protein Taci_0549 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269099798|gb|ACZ18785.1| protein of unknown function DUF218 [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 262

 Score = 61.0 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 49/140 (35%), Gaps = 24/140 (17%)

Query: 33  DHPSVSAIVVLTGEPIRIE-----------RAFELLENQIGEK-----IFISGVHH---- 72
             P+   ++VL G  +R +            +  +L+     +     I   G +     
Sbjct: 76  PLPTDDGVIVLLGGGVRYDRDLKPYQLGNYTSVRVLKALQLHRDTGWPIVCCGGNPRLDP 135

Query: 73  --SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
               S+  L+ +  +     +  +    ++  T  N   A     + N  +V+IVT  +H
Sbjct: 136 DPEASEANLMAQTLMDMGATQ--VYREGRSRTTWENLVNALPILRRLNRRNVVIVTSSFH 193

Query: 131 MPRTFLELQRINSTVQFIPY 150
           MPR  +  + +       P+
Sbjct: 194 MPRAIMTARAVLKGFDVYPH 213


>gi|59802238|ref|YP_208950.1| hypothetical protein NGO1925 [Neisseria gonorrhoeae FA 1090]
 gi|161869022|ref|YP_001598188.1| periplasmic protein [Neisseria meningitidis 053442]
 gi|194099817|ref|YP_002002952.1| Periplasmic protein [Neisseria gonorrhoeae NCCP11945]
 gi|239999990|ref|ZP_04719914.1| Periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|240013062|ref|ZP_04719975.1| Periplasmic protein [Neisseria gonorrhoeae DGI18]
 gi|240017631|ref|ZP_04724171.1| Periplasmic protein [Neisseria gonorrhoeae FA6140]
 gi|240081888|ref|ZP_04726431.1| Periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|240114167|ref|ZP_04728657.1| Periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|240116805|ref|ZP_04730867.1| Periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|240119033|ref|ZP_04733095.1| Periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|240122252|ref|ZP_04735214.1| Periplasmic protein [Neisseria gonorrhoeae PID24-1]
 gi|240122429|ref|ZP_04735385.1| Periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|240126722|ref|ZP_04739608.1| Periplasmic protein [Neisseria gonorrhoeae SK-92-679]
 gi|240127142|ref|ZP_04739803.1| Periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
 gi|254493442|ref|ZP_05106613.1| periplasmic protein [Neisseria gonorrhoeae 1291]
 gi|260441598|ref|ZP_05795414.1| Periplasmic protein [Neisseria gonorrhoeae DGI2]
 gi|268595796|ref|ZP_06129963.1| periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|268597985|ref|ZP_06132152.1| periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|268600240|ref|ZP_06134407.1| periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|268602480|ref|ZP_06136647.1| periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|268604748|ref|ZP_06138915.1| periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|268681017|ref|ZP_06147879.1| periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|268685301|ref|ZP_06152163.1| periplasmic protein [Neisseria gonorrhoeae SK-92-679]
 gi|268685499|ref|ZP_06152361.1| periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291044968|ref|ZP_06570677.1| periplasmic protein [Neisseria gonorrhoeae DGI2]
 gi|293398039|ref|ZP_06642245.1| periplasmic protein [Neisseria gonorrhoeae F62]
 gi|296313265|ref|ZP_06863206.1| putative periplasmic protein [Neisseria polysaccharea ATCC 43768]
 gi|59719133|gb|AAW90538.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|161594575|gb|ABX72235.1| periplasmic protein [Neisseria meningitidis 053442]
 gi|193935107|gb|ACF30931.1| Periplasmic protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512482|gb|EEH61827.1| periplasmic protein [Neisseria gonorrhoeae 1291]
 gi|268549185|gb|EEZ44603.1| periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|268551773|gb|EEZ46792.1| periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|268584371|gb|EEZ49047.1| periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|268586611|gb|EEZ51287.1| periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|268588879|gb|EEZ53555.1| periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|268621301|gb|EEZ53701.1| periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|268625585|gb|EEZ57985.1| periplasmic protein [Neisseria gonorrhoeae SK-92-679]
 gi|268625783|gb|EEZ58183.1| periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291011862|gb|EFE03858.1| periplasmic protein [Neisseria gonorrhoeae DGI2]
 gi|291611985|gb|EFF41054.1| periplasmic protein [Neisseria gonorrhoeae F62]
 gi|296840237|gb|EFH24175.1| putative periplasmic protein [Neisseria polysaccharea ATCC 43768]
 gi|317165286|gb|ADV08827.1| hypothetical protein NGTW08_1872 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 218

 Score = 61.0 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 54/152 (35%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F      L+      +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|46143765|ref|ZP_00134210.2| COG1434: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208505|ref|YP_001053730.1| hypothetical protein APL_1031 [Actinobacillus pleuropneumoniae L20]
 gi|303251036|ref|ZP_07337222.1| hypothetical protein APP6_0335 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307245941|ref|ZP_07528024.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307250279|ref|ZP_07532233.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307252669|ref|ZP_07534561.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|126097297|gb|ABN74125.1| hypothetical protein APL_1031 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|302650046|gb|EFL80216.1| hypothetical protein APP6_0335 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853160|gb|EFM85382.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306857720|gb|EFM89822.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306859845|gb|EFM91866.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 246

 Score = 61.0 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 45/136 (33%), Gaps = 28/136 (20%)

Query: 27  KQMHIPDHPSVSAIVVLTGE-------PIRIERA---------FELLENQIGEKIFISGV 70
             + + D+    AIVVL G           I               L+ +    + I+G 
Sbjct: 68  DNLTLEDYKKAQAIVVLGGGVRDSKEIYNPIAVGNQALERMRYAAYLQKETQLPLLITGS 127

Query: 71  HHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
             +         +       +          +  KA  T+ NAQ +     K   + +++
Sbjct: 128 SPNGTSEAKTMANEFQYFFSVPTQW------LEEKAKTTKENAQFSRELLAKEGINKIIL 181

Query: 125 VTHDYHMPRTFLELQR 140
           VT+ +HM R  +  ++
Sbjct: 182 VTNQWHMKRAKMLFEK 197


>gi|262368832|ref|ZP_06062161.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316510|gb|EEY97548.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 259

 Score = 61.0 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 71/194 (36%), Gaps = 21/194 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
           R+ W  +F   +F ++ F  F+ +  Q + P H +  AIVVL               R++
Sbjct: 68  RWAW-AIFFVWVFSLVIFFVFLGFSNQQNTP-HVAAPAIVVLGSGLKHGKPSPTLASRLD 125

Query: 52  RAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIR-QDLAECCIDIGYKALNTEGNA 107
           +A    +      + +SG        S+   +++  I    +    I    ++ +TE N 
Sbjct: 126 QAANYAKLHPNSIVVVSGGLSFQQKNSEAEAMRQYLIDVHHIPAQRIYTEDQSTSTELNL 185

Query: 108 QEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
             +     K +      + IVT D+H+PR+     R       +           N+ + 
Sbjct: 186 INSKKILAKQHISLQQPIAIVTSDFHIPRSRAIAIRQGYQTPIMISAQTPLATRYNAWLR 245

Query: 165 KIKILRV--LLIEY 176
           +        LL EY
Sbjct: 246 EYFAYWSGWLLNEY 259


>gi|306844040|ref|ZP_07476635.1| Hypothetical protein BIBO1_0705 [Brucella sp. BO1]
 gi|306275795|gb|EFM57519.1| Hypothetical protein BIBO1_0705 [Brucella sp. BO1]
          Length = 264

 Score = 61.0 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 50/170 (29%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I+VL G                    
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIGAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + +      +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKIIVSGGEGTFFEKSAREAETTRALLSDLGFSGDRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 215


>gi|167757031|ref|ZP_02429158.1| hypothetical protein CLORAM_02580 [Clostridium ramosum DSM 1402]
 gi|237735899|ref|ZP_04566380.1| membrane associated protein [Mollicutes bacterium D7]
 gi|167703206|gb|EDS17785.1| hypothetical protein CLORAM_02580 [Clostridium ramosum DSM 1402]
 gi|229381644|gb|EEO31735.1| membrane associated protein [Coprobacillus sp. D7]
          Length = 190

 Score = 61.0 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 38/90 (42%), Gaps = 2/90 (2%)

Query: 47  PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
             R+E    L +    + + +SG  V +   +  ++    I   + +  I I  ++ +T 
Sbjct: 54  KSRVEMGVTLYKKDKIKFLILSGGAVKNEYQEAKIMASYAISLGVKKEDILIEGQSRSTY 113

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
            N   +    + N   + L+VT+ +H+ + 
Sbjct: 114 HNLMYSRDIMQINGLKNALVVTNSWHLRKA 143


>gi|171910674|ref|ZP_02926144.1| hypothetical protein VspiD_05860 [Verrucomicrobium spinosum DSM
           4136]
          Length = 211

 Score = 61.0 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 63/209 (30%), Gaps = 32/209 (15%)

Query: 2   RYFWYGL-FVCLIFFIMGFIS-----FIRYVKQMHIPDHP--SVSAIVVLTGEPI-RIER 52
           R  +  +  + ++  ++G         +R   +  + D P     AIVVL G    R   
Sbjct: 7   RLAFRLVKLILVVAVLLGVAWIFRESLLRTAARTWVVDDPVLKADAIVVLGGGRDWRPFT 66

Query: 53  AFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID-----------IGYKAL 101
           A ++        + ++      S    L + P   ++    +            +G    
Sbjct: 67  AADMYLAGQSTVVLVT--QPEKSPSQNLLQQPSEAEINTTVLTKKGVPSTAIRPLGQNVT 124

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST------VQFIPYPIISH 155
           +T   A     W   +    +LI T  +H  R     QR          V+ IP+P  S 
Sbjct: 125 STRDEALALRDWVIAHQAKDILIPTDPFHTRRARWIFQRALEGTGATVHVRAIPHPRYS- 183

Query: 156 DLEENSSIFKIKILRVLLIEYLKILLLSI 184
              E               E  K L   +
Sbjct: 184 ---ETDWWRHEDGFIAFQTELAKSLYYLL 209


>gi|119512189|ref|ZP_01631279.1| hypothetical protein N9414_13600 [Nodularia spumigena CCY9414]
 gi|119463155|gb|EAW44102.1| hypothetical protein N9414_13600 [Nodularia spumigena CCY9414]
          Length = 175

 Score = 61.0 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/151 (18%), Positives = 53/151 (35%), Gaps = 9/151 (5%)

Query: 28  QMHIPDHPSVSAIVVLTGEPIRIER---AFELLENQIGEKIFISGVHHSVSKDILLQKIP 84
           Q    +     A++VL G    +ER               I+ISG       + +  K  
Sbjct: 14  QESKIEELPPQAVLVLGGSTSHLEREKFTANFARQHPSLPIWISGGSPPTFTEKVFAKAG 73

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL--ELQRIN 142
           +          + Y+A++T  N        +      V ++T ++HM R  +  E+   +
Sbjct: 74  VDPKRLR----LDYEAVDTVTNFTTLVDELQAQGIKSVYLITSEFHMRRARVIGEIVLGS 129

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
             +Q  P  + S ++ E          R L+
Sbjct: 130 RGIQLKPVAVPSENMREPVDKSIRDGARALI 160


>gi|319783692|ref|YP_004143168.1| hypothetical protein Mesci_4004 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169580|gb|ADV13118.1| protein of unknown function DUF218 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 263

 Score = 61.0 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 65/222 (29%), Gaps = 47/222 (21%)

Query: 8   LFVCLIFFIMGFISFIRYVKQM--HIPDHPSVSAIVVLTGEPIRIERAFELLENQI---- 61
           L + L  +       +  +++     P    V  IVVL G     E A  L         
Sbjct: 47  LILALSAWTSLGAMMLNPLEERFQRPPLPEKVDGIVVLGGGF---EGAINLARGGYELNS 103

Query: 62  -----------GEK--------------IFISGVHHSVSKDILLQKIPIRQDLAECCIDI 96
                        +              +F+ G   + +   LL  + +  D       +
Sbjct: 104 SGDRMVETAILARRFPTAKVVVSGGTGALFLDGEGDAATAPRLLTALGVAADRM----IL 159

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--- 153
             K+ NT  NA               L+VT  +HMPR      +       +P+P+    
Sbjct: 160 ENKSRNTYENAVFTKELVTPKPGETWLLVTSAFHMPRAKALFDKA--GFATVPWPVDYRT 217

Query: 154 ----SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQ 191
                  L  ++    ++   + + E++ +    +   +   
Sbjct: 218 SGREGVGLFRDNPADSLQATTMAIREWIGLFAYWLSGRIDQP 259


>gi|17547179|ref|NP_520581.1| transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|17429481|emb|CAD16167.1| putative transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 185

 Score = 61.0 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 63/154 (40%), Gaps = 12/154 (7%)

Query: 36  SVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCI 94
               IVVL GE   R+  A EL    +  ++F+SG        ++++++ +    AE   
Sbjct: 39  RADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSG---EGDCLLIVRRLEMAGVPAER-- 93

Query: 95  DIGYK--ALNTEGNAQEASA-WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
            IG++  + +T  NA+      A +      ++VT  YH  R     +R+   V +    
Sbjct: 94  -IGHECESGSTMENARMTRRTLAGQPPVRSAVLVTSWYHTGRALHVFRRVWPEVAWGARG 152

Query: 152 IISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           +   D    S          +L EY+K    +++
Sbjct: 153 VFPGDTLAKSFPIYESGS--ILAEYIKRAWYAVR 184


>gi|330984301|gb|EGH82404.1| hypothetical protein PLA107_04649 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 244

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 61/144 (42%), Gaps = 11/144 (7%)

Query: 41  VVLTGEPIRIERAFELLENQI---GEKIFISGV---HHSVSKDILL--QKIPIRQDLAEC 92
           VV T    R+ +A E+  +        + ISG      ++++  +   + +    DL   
Sbjct: 80  VVPTYALPRLLKAIEVYRDCQTVSQCTLLISGGPTGETTLTEAEVYQDRILHSAPDL-AG 138

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN-STVQFIPYP 151
            I++  K+ NT  NA+ +S+WA+ + +    +VT   HM R+       +  T       
Sbjct: 139 HIELEAKSRNTWENARFSSSWAKAHGYGQARLVTSLLHMRRSQSYFAHFDFPTSPEYSEQ 198

Query: 152 IISHDLEENSSIFKIKILRVLLIE 175
           ++       S+   + ++ VL+ E
Sbjct: 199 VVGPTSWLPSAW-NLAMVEVLIHE 221


>gi|302185148|ref|ZP_07261821.1| hypothetical protein Psyrps6_02354 [Pseudomonas syringae pv.
           syringae 642]
          Length = 256

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 54/189 (28%), Gaps = 41/189 (21%)

Query: 1   MRYFWYGLFVCLIFFIMGFIS----------FIRYVKQMHIPDHPS-------VSAIVVL 43
           +R     L        +G +             R ++Q+                AIVVL
Sbjct: 27  LRRSRPRLATAFFAVGLGGLWLMSLPVVVEFAARKLEQIPPLPQQQWATLAQQADAIVVL 86

Query: 44  TGEPIR--------IERAFEL--------LENQIGEKIFISGV-HHSVSKDILLQKIPIR 86
                R              L        L  + G  I  SG  H               
Sbjct: 87  GNGRERNSPTWGTDTPTGLGLERLRLAARLAKESGLPILTSGGLHFDQPPSEAAIMAQSL 146

Query: 87  QDLAECCIDIGYK---ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
           QD     + + ++   +  T  NA  ++A  +      V++VT  +HMPR     ++   
Sbjct: 147 QDDFA--VTVRWQEGLSRTTWENATMSAAILQPQGIKRVVLVTQAWHMPRARWSFEQA-- 202

Query: 144 TVQFIPYPI 152
               +  P+
Sbjct: 203 GFTVVGAPV 211


>gi|190150356|ref|YP_001968881.1| hypothetical protein APP7_1087 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307254915|ref|ZP_07536737.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259356|ref|ZP_07541083.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307263699|ref|ZP_07545307.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915487|gb|ACE61739.1| hypothetical protein APP7_1087 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306862156|gb|EFM94128.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866592|gb|EFM98453.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306870953|gb|EFN02689.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 246

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 45/136 (33%), Gaps = 28/136 (20%)

Query: 27  KQMHIPDHPSVSAIVVLTGE-------PIRIERA---------FELLENQIGEKIFISGV 70
             + + D+    AIVVL G           I               L+ +    + I+G 
Sbjct: 68  DNLALEDYKKAQAIVVLGGGVRDSKEIYNPIAVGNQALERMRYAAYLQKETQLPLLITGS 127

Query: 71  HHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
             +         +       +          +  KA  T+ NAQ +     K   + +++
Sbjct: 128 SPNGTSEAKTMANEFQYFFSVPTQW------LEEKAKTTKENAQFSRELLAKEGINKIIL 181

Query: 125 VTHDYHMPRTFLELQR 140
           VT+ +HM R  +  ++
Sbjct: 182 VTNQWHMKRAKMLFEK 197


>gi|315646581|ref|ZP_07899699.1| hypothetical protein PVOR_14364 [Paenibacillus vortex V453]
 gi|315278224|gb|EFU41544.1| hypothetical protein PVOR_14364 [Paenibacillus vortex V453]
          Length = 217

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/139 (19%), Positives = 55/139 (39%), Gaps = 10/139 (7%)

Query: 45  GEPIRIERAFELLENQIGEKIFISGV----HHSVSKDILLQKIPIRQDLAECCIDIGYKA 100
           G   R+E+A         +   +SG      ++ ++   ++   +   + E  I +  +A
Sbjct: 74  GLRERLEQALVEYNAGRFDTFIVSGGLDKPGYTYTEAEGMRNFLVEAGVPEERIYLENEA 133

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF---LELQRINSTVQFIP---YPIIS 154
            +T  N   +    E N +   +I+THDYH  R+      L   + ++        P++ 
Sbjct: 134 TSTYENLLYSQDIMENNGWKTAIIITHDYHGTRSMEVATTLGYDHPSMSLTESTVLPMVK 193

Query: 155 HDLEENSSIFKIKILRVLL 173
           H   E  +  K    R+L+
Sbjct: 194 HKSREVLAYTKWTADRLLI 212


>gi|266620475|ref|ZP_06113410.1| putative SanA protein [Clostridium hathewayi DSM 13479]
 gi|288867927|gb|EFD00226.1| putative SanA protein [Clostridium hathewayi DSM 13479]
          Length = 249

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 47/133 (35%), Gaps = 20/133 (15%)

Query: 37  VSAIVVLTGE-----------PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKI 83
              I+VL                R+ R  EL E    EK+ +SG H   + D +  +++ 
Sbjct: 76  ADCILVLGAGVHPDGKPSNMLEDRLLRGIELYEAGASEKLLMSGDHGRKNYDEVNAMKQF 135

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
            + + +    + + +   +T  +   A    E      ++IVT  YH+ R          
Sbjct: 136 AVDRGVPSEDVFMDHAGFSTYESMYRARDVFEAEK---IIIVTQQYHLYRAL----YAAK 188

Query: 144 TVQFIPYPIISHD 156
            +    Y + S  
Sbjct: 189 QLGLDAYGVASDQ 201


>gi|303253664|ref|ZP_07339802.1| hypothetical protein APP2_0852 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248075|ref|ZP_07530104.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|302647584|gb|EFL77802.1| hypothetical protein APP2_0852 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855473|gb|EFM87647.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 246

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 45/136 (33%), Gaps = 28/136 (20%)

Query: 27  KQMHIPDHPSVSAIVVLTGE-------PIRIERA---------FELLENQIGEKIFISGV 70
             + + D+    AIVVL G           I               L+ +    + I+G 
Sbjct: 68  DNLALEDYKKAQAIVVLGGGVRDSKEIYNPIAVGNQALERMRYAAYLQKETQLPLLITGS 127

Query: 71  HHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
             +         +       +          +  KA  T+ NAQ +     K   + +++
Sbjct: 128 SPNGTSEAKTMANEFQYFFSVSTQW------LEEKAKTTKENAQFSRELLAKEGINKIIL 181

Query: 125 VTHDYHMPRTFLELQR 140
           VT+ +HM R  +  ++
Sbjct: 182 VTNQWHMKRAKMLFEK 197


>gi|148240589|ref|YP_001225976.1| hypothetical protein SynWH7803_2253 [Synechococcus sp. WH 7803]
 gi|147849128|emb|CAK24679.1| Uncharacterized conserved secreted protein [Synechococcus sp. WH
           7803]
          Length = 195

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 55/147 (37%), Gaps = 9/147 (6%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGEPIRIERAFELLENQIGEKIFI 67
             L+  ++G  +    ++              I+VL G+  R      L   ++   + +
Sbjct: 8   FLLVSALIGGAAMATPLRPFAKAALTRQDPQRILVLGGDAERERIGLRL-ARRLALPLVV 66

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SG     +     + +   + L    + + Y+A +T GN        +     HVL+VT 
Sbjct: 67  SGG----TNPEYARWLMEHEGLGTNEVRLDYRAQDTLGNFTSLVDELQAEGVEHVLLVTS 122

Query: 128 DYHMPRTFLE--LQRINSTVQFIPYPI 152
           + H+PR  L   +   +  ++    P+
Sbjct: 123 EDHLPRALLVGGVVAGSRGIRLTGVPV 149


>gi|253577135|ref|ZP_04854456.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251843517|gb|EES71544.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 228

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 76/211 (36%), Gaps = 34/211 (16%)

Query: 2   RYFWYGLFVCL--IFFIMGFISFIRYVKQMHIPDHPSVS----AIV---VLTGE------ 46
           R F +GL V    I +++  ++ I  +++    +          IV    L G+      
Sbjct: 26  RIFRWGLVVISLGIGWMLYVLAQIGSIERNPAANSDLSDPAEVGIVLGAALWGDEPSPGL 85

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVS----KDILLQKIPIRQDLAECCIDIGYKALN 102
             R++++ +  +    +   ++G   + +    +   +     +  +    + +  KA +
Sbjct: 86  RERLDQSLKDYKAGKFQWFLLTGGLDTATSQYTEAEGMANYLEQHGVPREKMLLENKATS 145

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN----STVQFIPYPIISHDLE 158
           T  N + +    ++  F  VLIVTH +H  R   E+ +        +      ++     
Sbjct: 146 TYENLKFSQEILKERGFTSVLIVTHTFHGNRA-YEIAQALNYEQPRLSLTSSKVLKPL-- 202

Query: 159 ENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
                      R +L  Y K  L  + L++ 
Sbjct: 203 -------PNTFREILA-YTKWKLDQLGLAIG 225


>gi|84388504|ref|ZP_00991051.1| hypothetical protein V12B01_06906 [Vibrio splendidus 12B01]
 gi|84377053|gb|EAP93924.1| hypothetical protein V12B01_06906 [Vibrio splendidus 12B01]
          Length = 284

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 63/168 (37%), Gaps = 11/168 (6%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     +L    G K+ +SG      VS   ++ K+ +   +A+  I +   A +T
Sbjct: 105 GLMRLSEGIRILRLYPGAKLILSGYGAGTEVSNARMMAKVALALGVAKPDIILLETAKDT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI------NSTVQFIPYPIISHDL 157
              A++A+A+ +      +++VT   HM R   E            T       I+    
Sbjct: 165 WEEARQAAAFVKN---KRMVLVTSASHMTRALNEFHAAGMKPLPAPTNYLAQEGIVEPWN 221

Query: 158 EENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEIT 205
           +       ++       E + ++  S++  L T   +     ++ E +
Sbjct: 222 KYMPKALYLEQTERYWHETMGLMWQSLRDWLDTSNDTVEEPIVVPETS 269


>gi|332710355|ref|ZP_08430303.1| hypothetical protein LYNGBM3L_50550 [Lyngbya majuscula 3L]
 gi|332350904|gb|EGJ30496.1| hypothetical protein LYNGBM3L_50550 [Lyngbya majuscula 3L]
          Length = 208

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 63/166 (37%), Gaps = 10/166 (6%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R       V ++   + FI     +  +     P+   I+ L G+  R +   E  +  
Sbjct: 24  LRKMRVVFTVTILLIALSFIPIRLGLAHLQ---SPTPEVILTLGGDITREKFTAEFAQQH 80

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               I++S    +     + ++  I     +  + I  +A++T  N        + ++ H
Sbjct: 81  PNLDIWVSSGQPTPQAQKVFREAGIP----DQQVHIDRRAIDTVTNFTSLVQDFQTHDIH 136

Query: 121 HVLIVTHDYHMPRT--FLELQRINSTVQFIPYPIISHDLEENSSIF 164
           HV ++T D+HM R+         +  + F P  I S    E S + 
Sbjct: 137 HVYLITSDFHMRRSIAIAFFVFGSHGIAFTPVAIPSQR-PEESWLR 181


>gi|170288947|ref|YP_001739185.1| hypothetical protein TRQ2_1158 [Thermotoga sp. RQ2]
 gi|170176450|gb|ACB09502.1| protein of unknown function DUF218 [Thermotoga sp. RQ2]
          Length = 237

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 61/169 (36%), Gaps = 25/169 (14%)

Query: 2   RYFWYGLFVCLIFFI--MGFISFIRYVK-QMHIPDHPSVSA-IVVLTGEPIRIERAFELL 57
           R+F   L V    F   +G   F+  ++  + +P      A IVVL G   R  +A + L
Sbjct: 32  RWFLLALAVTAYLFSSYVGEFLFLWSLEKNLDVPATLPNDAVIVVLGGGVERNTKAGDNL 91

Query: 58  ENQIGEKIFISGVH----------------HSVSKDI-LLQKIPIRQDLAECCIDIGYKA 100
            +    ++  +GV                   +  +  +++   +   + E  I +  ++
Sbjct: 92  SDATLRRLL-TGVQIYQKTKMPILVTGGSLTGLRPEAMIMKDYLVSLGVPEEKITVEDRS 150

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            NT  NA        K     +++VT   HM R     +    +V   P
Sbjct: 151 RNTYENAFFTRE---KIGDVPIILVTDSIHMRRAVFTFKSFFQSVTPYP 196


>gi|149914159|ref|ZP_01902690.1| hypothetical protein RAZWK3B_19201 [Roseobacter sp. AzwK-3b]
 gi|149811678|gb|EDM71511.1| hypothetical protein RAZWK3B_19201 [Roseobacter sp. AzwK-3b]
          Length = 260

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 44/131 (33%), Gaps = 17/131 (12%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQK 82
              +            A +V  G   R+  AF       G ++         ++  + Q 
Sbjct: 108 AERLTATLELARRFPDAKIVYAGGSGRVRDAF-------GAQL---------TEADIAQH 151

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
             +   LA   +     + NT  NA  A   A        ++VT  +HMPR     +   
Sbjct: 152 FLLNMGLAPERLLTDPTSRNTAENAARAMELATPEVGQTWVLVTSAFHMPRAIRSFEAAG 211

Query: 143 STVQFIPYPII 153
            + + +PYP+ 
Sbjct: 212 WS-ELVPYPVD 221


>gi|66047577|ref|YP_237418.1| hypothetical protein Psyr_4350 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258284|gb|AAY39380.1| Protein of unknown function DUF218 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 256

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 54/189 (28%), Gaps = 41/189 (21%)

Query: 1   MRYFWYGLFVCLIFFIMGFIS----------FIRYVKQMHIPDHPS-------VSAIVVL 43
           +R     L        +G +             R ++Q+                AIVVL
Sbjct: 27  LRRSRPRLATAFFAVGLGGLWLMSLPVAVEFAARRLEQIPPLPQQRWAMLAQQADAIVVL 86

Query: 44  TGEPIR--------IERAFEL--------LENQIGEKIFISGV-HHSVSKDILLQKIPIR 86
                R              L        L  + G  I  SG  H               
Sbjct: 87  GNGRERNSPTWGTDTPTGLGLERLRLAARLAKESGLPILTSGGLHFDQPPSEAAIMAQSL 146

Query: 87  QDLAECCIDIGYK---ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
           QD     + + ++   +  T  NA  ++A  +      V++VT  +HMPR     ++   
Sbjct: 147 QDDFA--VTVRWQEGLSRTTWENATMSAAILQPQGIKRVVLVTQAWHMPRARWSFEQA-- 202

Query: 144 TVQFIPYPI 152
               +  P+
Sbjct: 203 GFTVVGAPV 211


>gi|228921749|ref|ZP_04085066.1| hypothetical protein bthur0011_27460 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228953412|ref|ZP_04115458.1| hypothetical protein bthur0006_27920 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|229070559|ref|ZP_04203799.1| hypothetical protein bcere0025_27430 [Bacillus cereus F65185]
 gi|229080263|ref|ZP_04212790.1| hypothetical protein bcere0023_29110 [Bacillus cereus Rock4-2]
 gi|229179370|ref|ZP_04306724.1| hypothetical protein bcere0005_27200 [Bacillus cereus 172560W]
 gi|229191184|ref|ZP_04318173.1| hypothetical protein bcere0002_28480 [Bacillus cereus ATCC 10876]
 gi|228592334|gb|EEK50164.1| hypothetical protein bcere0002_28480 [Bacillus cereus ATCC 10876]
 gi|228604268|gb|EEK61735.1| hypothetical protein bcere0005_27200 [Bacillus cereus 172560W]
 gi|228703158|gb|EEL55617.1| hypothetical protein bcere0023_29110 [Bacillus cereus Rock4-2]
 gi|228712574|gb|EEL64509.1| hypothetical protein bcere0025_27430 [Bacillus cereus F65185]
 gi|228806309|gb|EEM52882.1| hypothetical protein bthur0006_27920 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228837961|gb|EEM83285.1| hypothetical protein bthur0011_27460 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 219

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 144 QVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|206969158|ref|ZP_03230113.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|206736199|gb|EDZ53357.1| conserved hypothetical protein [Bacillus cereus AH1134]
          Length = 210

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 135 QVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 174


>gi|126654814|ref|ZP_01726348.1| hypothetical protein CY0110_10272 [Cyanothece sp. CCY0110]
 gi|126623549|gb|EAZ94253.1| hypothetical protein CY0110_10272 [Cyanothece sp. CCY0110]
          Length = 198

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 52/161 (32%), Gaps = 14/161 (8%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           + F+  L +  +   +G+     Y  Q          AI VL G   R   A +L     
Sbjct: 22  KRFFPLLCLATLGLWLGYKQLQSYFAQPE--------AIFVLGGHEDRERFAAKLALEHP 73

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
              I++S          +     I  D       + Y+A +T  N        +      
Sbjct: 74  NLPIWVSSGSPENYVTKIFTNAGISGDRLH----LDYQAKDTVTNFTTLVKELKDQGIDS 129

Query: 122 VLIVTHDYHMPRTFL--ELQRINSTVQFIPYPIISHDLEEN 160
           V ++T D HM R  +  E+      +   P  + S D  E 
Sbjct: 130 VYLITSDNHMNRARIIGEIVFGTQGITLKPLSVPSDDSPEP 170


>gi|59713611|ref|YP_206386.1| inner membrane protein [Vibrio fischeri ES114]
 gi|197337496|ref|YP_002158026.1| integral membrane protein [Vibrio fischeri MJ11]
 gi|59481859|gb|AAW87498.1| conserved inner membrane protein [Vibrio fischeri ES114]
 gi|197314748|gb|ACH64197.1| integral membrane protein [Vibrio fischeri MJ11]
          Length = 287

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 47/126 (37%), Gaps = 5/126 (3%)

Query: 49  RIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +     G K+ +SG +   +VS   ++ ++ +   + +  I +   A +T   
Sbjct: 108 RLTEGIRIYRMYPGSKMILSGYNGGTTVSHARMMARVALSLGVQKSDILLLESARDTHEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           A +      K     +++VT   HMPR   E  ++       P   ++H   +       
Sbjct: 168 AIQTFNSVGK---STLVLVTSASHMPRAMSEFHQLGMDPVPAPTNYLAHSEVKQPWDKYA 224

Query: 167 KILRVL 172
              + L
Sbjct: 225 PKAKYL 230


>gi|323704444|ref|ZP_08116023.1| protein of unknown function DUF218 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323536510|gb|EGB26282.1| protein of unknown function DUF218 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 194

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 57/148 (38%), Gaps = 23/148 (15%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHI------PDHPSVSAIVVLTGE------------PIR 49
           L + +   ++ F+  +  + ++ +             AI++L                 R
Sbjct: 3   LLIKITASLITFVVLLNIIAELQVIIFAYNAKPVKSDAIIIL--GCAVYGKNPSPFFKER 60

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           +  A  L +  +G+ I +SG       VS+    ++  ++  +    I    K+ +T  N
Sbjct: 61  LNEAIRLYKKGLGKYIIVSGGKGPGEDVSEAEAGKEYLLKNGIPYNTILKDDKSYSTLQN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRT 134
            + +    ++ +    +IV++ +H+ R 
Sbjct: 121 LENSKKIMDEKSLKTAIIVSNKFHLKRA 148


>gi|319936939|ref|ZP_08011349.1| exported protein [Coprobacillus sp. 29_1]
 gi|319807875|gb|EFW04454.1| exported protein [Coprobacillus sp. 29_1]
          Length = 219

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 42/112 (37%), Gaps = 15/112 (13%)

Query: 37  VSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIP 84
              I+VL               R+E A +L ++    KI +SG H     +   +++   
Sbjct: 44  ADCILVLGAGVRNNKPTPMLNDRLEVAIQLYKDGKASKIIMSGDHGQEDYNEVGIMKTFA 103

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
           I   +    I + +   +T  +   A    +      V+IVT DYH+ R   
Sbjct: 104 IENGVPSSAIFMDHAGFSTYESLYRAKEIFKAKK---VIIVTQDYHLYRALY 152


>gi|148652828|ref|YP_001279921.1| hypothetical protein PsycPRwf_1021 [Psychrobacter sp. PRwf-1]
 gi|148571912|gb|ABQ93971.1| protein of unknown function DUF218 [Psychrobacter sp. PRwf-1]
          Length = 267

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/208 (17%), Positives = 68/208 (32%), Gaps = 40/208 (19%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYV-KQMHIPDHP--SVSAIVVLTGE----------PI 48
           R  W  L+   + +++ FI F   + K +   D P  +V+AI+VL G             
Sbjct: 71  RMVWKLLWAIFVLWLISFIVFAFSLHKNIKQVDQPYETVAAIIVLGGGIQDGLPTPTLAS 130

Query: 49  RIERAFELLENQIGEKIFISGV--------HHSVSKDILLQKIPIRQDLAECCIDIGYKA 100
           R++ A  L++ Q    +  SG                 L     I  +  +        +
Sbjct: 131 RLDAAAPLIKEQPQAVVITSGGIGMGEIRSEGEAMARYLYALYGIPLEHIQQ----EKNS 186

Query: 101 LNTEGNAQEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH-D 156
            +TE N   +     +        + +VT D+H+PR+    +        +     +   
Sbjct: 187 TSTEENFLFSQQILTEQGISLNDPIAVVTSDFHIPRSLAIAEHQG-YTNLVALASTTPLS 245

Query: 157 LEENSSIFKIKILRVLLIEYLKILLLSI 184
           +  NS             EY   +   +
Sbjct: 246 IRYNSW----------FREYFAYISGWL 263


>gi|119512125|ref|ZP_01631217.1| hypothetical protein N9414_08053 [Nodularia spumigena CCY9414]
 gi|119463215|gb|EAW44160.1| hypothetical protein N9414_08053 [Nodularia spumigena CCY9414]
          Length = 187

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 10/155 (6%)

Query: 12  LIFFIMGFISFIRYVKQMHIP----DHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           +   + GFI  +  +  + +       P   AI+ L G P R E   E  +      I++
Sbjct: 1   MFLILAGFILALLSIIPIRLAIASYQSPHPQAILTLGGSPEREEFTAEFAKKHPHLDIWV 60

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           S          + Q   I          + Y A++T  N        + N+  H+ ++T 
Sbjct: 61  SSGIPPKQAQAIFQNANISNHRLH----LDYLAVDTVTNFTSLVDDFKHNHIQHIYLITS 116

Query: 128 DYHMPR--TFLELQRINSTVQFIPYPIISHDLEEN 160
            YH+PR      L   +  + F P PI S    E+
Sbjct: 117 AYHLPRAKAIATLVLGSQGITFTPVPIPSQKPRES 151


>gi|229173740|ref|ZP_04301282.1| hypothetical protein bcere0006_28400 [Bacillus cereus MM3]
 gi|228609839|gb|EEK67119.1| hypothetical protein bcere0006_28400 [Bacillus cereus MM3]
          Length = 219

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKTNDGVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 144 EVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|160902984|ref|YP_001568565.1| hypothetical protein Pmob_1541 [Petrotoga mobilis SJ95]
 gi|160360628|gb|ABX32242.1| protein of unknown function DUF218 [Petrotoga mobilis SJ95]
          Length = 214

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 70/209 (33%), Gaps = 40/209 (19%)

Query: 10  VCLIFFIMGFISFI----RYVKQMHIP-------DHPSVSAIVVLTGE------------ 46
           VC++ +I     F       ++  + P       D      IVVL G             
Sbjct: 2   VCIVIYIFSSGWFAKIIVLPLENRYPPVNVSQLDDTQEKGVIVVLGGGIIPETPREGSGE 61

Query: 47  -----PIRIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  R+   F LL   +   I ++G       + +  ++++  ++  +    I +  
Sbjct: 62  LSDSAMKRVYEGF-LLYKNLQIPIVVTGGKLLGTEIPEAQIMKEELLKMGVKPNDIYVEP 120

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A NT+ NA+      E +    + ++T   H+PR     +     +  +P P       
Sbjct: 121 LAKNTKQNAEFTLTLLESDEVQKIYLITSAIHLPRAMNYFKSYT-NIDVVPVPTDYKISR 179

Query: 159 EN-SSIFKIKILRVL------LIEYLKIL 180
           E       +  +R L        EYL ++
Sbjct: 180 EELKWYDFLPDMRFLEATSSAWHEYLGLV 208


>gi|288921304|ref|ZP_06415586.1| protein of unknown function DUF218 [Frankia sp. EUN1f]
 gi|288347278|gb|EFC81573.1| protein of unknown function DUF218 [Frankia sp. EUN1f]
          Length = 225

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 55/154 (35%), Gaps = 12/154 (7%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSV-SAIVVLTGEPIRIERAFELLENQIGEKIFI 67
            V L    + F+     +  +   D P+   AIV+  G P R E+A  L        + +
Sbjct: 62  IVTLGVASLLFLGATVRLFVLPRRDDPAPVDAIVMFAGSPGRFEQAVSLARAGYAPTLAV 121

Query: 68  SGVHHSVSKDILLQKIPIRQDLAEC-CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           S         +   + P    +     I      L T+G ++  +  A +  +  +++VT
Sbjct: 122 S---------VPTAEDPCPPPIPNVEVICFAPDPLTTQGESRWTADAAARYGWQSIIVVT 172

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
               + R  L L+R  S    +  P+    L   
Sbjct: 173 STTQVTRARLRLERCYSGQILMS-PVPPPRLMWP 205


>gi|256061258|ref|ZP_05451408.1| hypothetical protein Bneo5_12948 [Brucella neotomae 5K33]
 gi|261325265|ref|ZP_05964462.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301245|gb|EEY04742.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 264

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 51/170 (30%), Gaps = 27/170 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTG-----------------EPI 48
            +    F  G    +  ++            V  I++L G                    
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIMLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG        S  +    + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             NA  + A A+       L+VT  YHMPR     ++    V    +P+ 
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVT--AWPVD 215


>gi|301061545|ref|ZP_07202307.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300444353|gb|EFK08356.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 183

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/182 (18%), Positives = 59/182 (32%), Gaps = 34/182 (18%)

Query: 36  SVSAIVVL-TG--EPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
              A+VVL TG     R+  A  L       K  I+G      K+  L+     Q    C
Sbjct: 8   PSDAVVVLYTGVEYYPRLMEAASLYVKGSVGKAVING----NRKNDALR-WIETQGFKRC 62

Query: 93  C--------------------IDIGYK-ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHM 131
           C                    + IG + A +T   AQ       +  +  +++ T  +H 
Sbjct: 63  CPWYEDKFRILGVLGVPREDIVHIGAEDAYDTVSEAQIVGDALIRKGYRTIILTTSKFHT 122

Query: 132 PRTFLELQRINST---VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
            R     + +      VQ +  P  +   +        + +R +L EY   +    +  L
Sbjct: 123 RRAAFIWKNMYKDRLSVQIV--PARTDPYDPAGWWKHGRQIRWVLAEYGAWVYYWWKHML 180

Query: 189 ST 190
            +
Sbjct: 181 GS 182


>gi|187777765|ref|ZP_02994238.1| hypothetical protein CLOSPO_01357 [Clostridium sporogenes ATCC
           15579]
 gi|187774693|gb|EDU38495.1| hypothetical protein CLOSPO_01357 [Clostridium sporogenes ATCC
           15579]
          Length = 242

 Score = 60.6 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 61/160 (38%), Gaps = 26/160 (16%)

Query: 15  FIMGFISFIRYVKQ----MHIPDHPSVSAIVVLTGE------------PIRIERAFELLE 58
             + FI F    +     ++  D P   AI+VL G               R+    +L +
Sbjct: 41  AAIFFIDFRVRSESKKYIVNPKDVPEAEAILVL-GAYVKPNGKLCDMLEDRVAVGIDLYK 99

Query: 59  NQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
           N   +K+  SG H  V+ D +  ++K+  ++ + +  I + +   +T  +   A    + 
Sbjct: 100 NNKAKKLLFSGDHGQVNYDEVNGMKKVAEKKGVKKEDIFLDHAGFSTYESMYRAKEIFKA 159

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
                ++IVT  YH+ R       I   +    Y + S  
Sbjct: 160 KK---IIIVTQQYHLMRAV----YIARQLGLDAYGVNSDQ 192


>gi|217969248|ref|YP_002354482.1| hypothetical protein Tmz1t_0817 [Thauera sp. MZ1T]
 gi|217506575|gb|ACK53586.1| protein of unknown function DUF218 [Thauera sp. MZ1T]
          Length = 259

 Score = 60.3 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 56/179 (31%), Gaps = 35/179 (19%)

Query: 1   MRYFWYGLFVCLIFFI---MGFISF-IRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           + + W G+ + L+      +G++   + Y + +         AIVVL             
Sbjct: 45  LAFAWAGVALNLLLIFPPSVGWLVARVEYPQMLDRARAREAQAIVVLGAGKRTHAPEFGG 104

Query: 48  --------IRIERAFELLENQIGEKIFISGVHHSVSKDI-------LLQKIPIRQDLAEC 92
                    R+  A  L        + +SG   +            L  +  +     E 
Sbjct: 105 ETVNRLALERLRYAAALARETRLP-VLVSGGAPAGDTPEAYLMEALLRDEYGVPPRWVE- 162

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
                  + +T  NA+ ++   +      +L+VTH  HM R   E +     V   P  
Sbjct: 163 -----SASRDTRENARFSAVHLQAAGVKRILLVTHAMHMERARPEFEAAGLDVIPAPTA 216


>gi|194334031|ref|YP_002015891.1| hypothetical protein Paes_1216 [Prosthecochloris aestuarii DSM 271]
 gi|194311849|gb|ACF46244.1| protein of unknown function DUF218 [Prosthecochloris aestuarii DSM
           271]
          Length = 196

 Score = 60.3 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 63/190 (33%), Gaps = 11/190 (5%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLEN 59
           +       F+  + F+      + Y+             I+VL G+   R+ +  EL   
Sbjct: 9   LALLATSAFLTAMIFLG-----LGYIVSWPAASPEKADVIIVLGGDDGLRVSKGAELYHA 63

Query: 60  QIGEKIFISGVHHS-VSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
              + + ++G+         L   ++  I   +    I +   + +T   A    +   K
Sbjct: 64  GFADDLLLTGLDSRYYRPGKLNWRERKLISLGIPGEAIHVDIVSTSTWEEAANTLSAMNK 123

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
           N +   L+++   HM R      ++   S+ +F+                     R +L 
Sbjct: 124 NGWQRALVISDPPHMLRLQHTWTKVFTGSSKRFVLIATKPEWWHPLLWWNNETGSRFVLS 183

Query: 175 EYLKILLLSI 184
           E  K L  ++
Sbjct: 184 EIKKNLYYAV 193


>gi|169628110|ref|YP_001701759.1| hypothetical protein MAB_1015c [Mycobacterium abscessus ATCC 19977]
 gi|169240077|emb|CAM61105.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 204

 Score = 60.3 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/139 (21%), Positives = 51/139 (36%), Gaps = 13/139 (9%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYV-KQMHIPDHPSVSAIVVLTGEP-IRIERAFELLEN 59
           R     + + +   + GFI+    V             AIVVL G P  R +   +L + 
Sbjct: 27  RRRILLVCITVTVLLAGFITAGWRVYMNPQTDPLRPADAIVVLGGTPYERFDVGLDLAKR 86

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLA----ECCIDIGYKALNTEGNAQEASAWAE 115
                + IS      +           +        C I   +    TEG AQE  + A+
Sbjct: 87  GYAPYLLIS----QSTGADDRNMDKYCKGHFTFTVSCFIPDPW---TTEGEAQEIRSKAQ 139

Query: 116 KNNFHHVLIVTHDYHMPRT 134
           +  +HH++++T   H+ R 
Sbjct: 140 ELGWHHIIVITFTPHVSRA 158


>gi|167570139|ref|ZP_02363013.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           oklahomensis C6786]
          Length = 240

 Score = 60.3 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 50/134 (37%), Gaps = 12/134 (8%)

Query: 38  SAIVVLTGEP-IRIERAFELLEN--QIGEK--IFISGVHH---SVSKDILLQKIPIRQDL 89
             +   T +   RI++  EL     +   +  + +SG       +++     +  + + +
Sbjct: 79  DGVAAPTHDALARIDKTAELYSACQRTAARCTVVVSGGDPQFRGITEADTYARYLLARGV 138

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           A   +    ++  T  NA+  +A     ++  +++VT  Y M R  L+  R        P
Sbjct: 139 ANGDLIREQRSHTTYENARFTAAILRAQHYDDLILVTSSYQMRRALLDFARFG----IAP 194

Query: 150 YPIISHDLEENSSI 163
            P+ ++        
Sbjct: 195 QPVYANRRVAQLGW 208


>gi|209551623|ref|YP_002283540.1| hypothetical protein Rleg2_4052 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537379|gb|ACI57314.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 262

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 51/145 (35%), Gaps = 26/145 (17%)

Query: 30  HIPDHPSVSAIVVLTGE-----------------PIRIERAFELLENQIGEKIFISGVHH 72
              D  S+  ++VL G                    R   A  L +     +I +SG   
Sbjct: 71  PAADPDSLQCMIVLGGGFENEVNTARHGIEFNAAADRFVEALRLAQKFPQSRILVSGGDG 130

Query: 73  SVS------KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           S+S           +  P+     +  I+   ++  T  NA     +       + L++T
Sbjct: 131 SLSGIYEGDAAASERFFPLFGVGKDRLIE-ERQSRTTFENAVNTKEFLASQGLANCLLIT 189

Query: 127 HDYHMPRTFLELQRINSTVQFIPYP 151
             +HMPR+    +++   +  +P+P
Sbjct: 190 SGFHMPRSVGIFRKL--GIDIVPWP 212


>gi|312622108|ref|YP_004023721.1| hypothetical protein Calkro_1031 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202575|gb|ADQ45902.1| protein of unknown function DUF218 [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 195

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 55/148 (37%), Gaps = 14/148 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLT----GE------PIR 49
           MR F   L   L+  I+ F      +    I   P     I+VL     G+        R
Sbjct: 1   MRRFLKILLCTLVIVILIFAVTEASIIIFGISAKPKKSDCIIVLGCAVYGDFPSPFFRER 60

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           + RAFEL +      I + G      ++S+    ++  +   +    +    K+ +T  N
Sbjct: 61  LNRAFELYKKGYARYIVVCGAKGPGENISEAEAGKRYLVEMGVLPKFVLKEDKSFSTYEN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRT 134
              A     K  F   +IV++ +H+ R 
Sbjct: 121 LLHAKRVMNKKGFKSAIIVSNMFHLERA 148


>gi|218898164|ref|YP_002446575.1| hypothetical protein BCG9842_B2141 [Bacillus cereus G9842]
 gi|218541554|gb|ACK93948.1| conserved hypothetical protein [Bacillus cereus G9842]
          Length = 210

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L  N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 75  SLYRNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N  H   IV+   HM R      RI   +    Y   + 
Sbjct: 135 QVGIENGIHTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 174


>gi|75764443|ref|ZP_00743940.1| EpiH/GdmH-related protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228901618|ref|ZP_04065796.1| hypothetical protein bthur0014_28070 [Bacillus thuringiensis IBL
           4222]
 gi|228908852|ref|ZP_04072684.1| hypothetical protein bthur0013_30090 [Bacillus thuringiensis IBL
           200]
 gi|74488069|gb|EAO51788.1| EpiH/GdmH-related protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228850862|gb|EEM95684.1| hypothetical protein bthur0013_30090 [Bacillus thuringiensis IBL
           200]
 gi|228858030|gb|EEN02512.1| hypothetical protein bthur0014_28070 [Bacillus thuringiensis IBL
           4222]
          Length = 219

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L  N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 84  SLYRNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N  H   IV+   HM R      RI   +    Y   + 
Sbjct: 144 QVGIENGIHTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|104783752|ref|YP_610250.1| hypothetical protein PSEEN4811 [Pseudomonas entomophila L48]
 gi|95112739|emb|CAK17467.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 253

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/137 (18%), Positives = 42/137 (30%), Gaps = 21/137 (15%)

Query: 35  PSVSAIVVLTGEPIRIERA---------FEL--------LENQIGEKIFISGV-HHSVSK 76
               AIVVL     R + A           L        L    G  +  SG  H+    
Sbjct: 78  TKADAIVVLGAGRERGDPAWGGSDQPTYVALERMRFAAQLAKASGLPVLTSGGLHYGTPP 137

Query: 77  DILLQKIPIRQDLAECCIDIGYKA-LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
                     +      +    +A   T  NA   +   +      V++VT  +HM R+ 
Sbjct: 138 SEAQLMADRLEADFGVRVTWKEEASRTTWENADFTAKLLQPLGIRRVVVVTQAWHMQRSR 197

Query: 136 LELQRINSTVQFIPYPI 152
              +R     + +P P+
Sbjct: 198 WSFERA--GFEVVPAPV 212


>gi|307245325|ref|ZP_07527413.1| hypothetical protein appser1_5300 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254278|ref|ZP_07536118.1| hypothetical protein appser9_5280 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258738|ref|ZP_07540470.1| hypothetical protein appser11_5360 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306853666|gb|EFM85883.1| hypothetical protein appser1_5300 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862757|gb|EFM94711.1| hypothetical protein appser9_5280 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867089|gb|EFM98945.1| hypothetical protein appser11_5360 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 252

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 54/144 (37%), Gaps = 17/144 (11%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGE-------PIR--IERA-------FELLENQIG 62
            I  + + +++ I D+    AIVVL G          R  I  A          L  Q G
Sbjct: 64  LIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYTIAAAPLERMRYAAYLHKQTG 123

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHH 121
             I ++G      +           D     +  +   +  TE NA  + A  ++ +   
Sbjct: 124 LPILVTGGSPEGREPEAKIMAQELHDFFNVSVKWVESASNTTEQNAILSKAMLKQESIDR 183

Query: 122 VLIVTHDYHMPRTFLELQRINSTV 145
           +++VT+ +HM RT +  +R    V
Sbjct: 184 IILVTNQWHMKRTKMLFEREGFNV 207


>gi|229030771|ref|ZP_04186797.1| hypothetical protein bcere0028_28350 [Bacillus cereus AH1271]
 gi|228730533|gb|EEL81487.1| hypothetical protein bcere0028_28350 [Bacillus cereus AH1271]
          Length = 219

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKTNDGVKTDAGIVL-GAASWNGKPSPVFKERINHAI 83

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + +  I I  K+L TE N + A 
Sbjct: 84  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKDEDILIETKSLFTEENLKNAK 143

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 144 EVGIENGIRTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|283458819|ref|YP_003363461.1| hypothetical protein RMDY18_18090 [Rothia mucilaginosa DY-18]
 gi|283134876|dbj|BAI65641.1| uncharacterized conserved protein [Rothia mucilaginosa DY-18]
          Length = 385

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 58/152 (38%), Gaps = 22/152 (14%)

Query: 3   YFWYGLFVC-LIFFIMGF-ISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           YF++ L +     + +GF ++    +             +VVL               RI
Sbjct: 165 YFYFSLVLTYFTIYAVGFTVAAALNLVNFR----QQADYVVVLGSGLIGDQVTPLLAGRI 220

Query: 51  ERAFELLENQIGEKIFIS---GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +R  E+     G K+ +S   G    V + + + +  + + + E  I +  +A+NT  N 
Sbjct: 221 DRGIEIYRKNPGSKLIMSGGQGADEEVPEGVAMTRYAVSRGIPEADIIVEDRAVNTRENL 280

Query: 108 QEASAW---AEKNNFHHVLIVTHDYHMPRTFL 136
             + A      +     V +VT  YH+ R  L
Sbjct: 281 LFSYALMPEVAEGKTPKVAVVTTSYHLFRALL 312


>gi|260772652|ref|ZP_05881568.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio metschnikovii CIP 69.14]
 gi|260611791|gb|EEX36994.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio metschnikovii CIP 69.14]
          Length = 268

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     ++    G K+ +SG      +S   +L K+ +   +A+  I +   A +T   
Sbjct: 108 RLSEGIRVMRMYPGAKLILSGYAGGSEMSHARMLAKVALALGVAKSDIILLETAQDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
           A++A+A+ ++     +++VT   HMPR   E Q     +  IP P
Sbjct: 168 ARQAAAFVQQ---RTLVLVTSASHMPRAMNEFQSA--GLTPIPAP 207


>gi|332662639|ref|YP_004445427.1| hypothetical protein Halhy_0646 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332331453|gb|AEE48554.1| protein of unknown function DUF218 [Haliscomenobacter hydrossis DSM
           1100]
          Length = 251

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/148 (13%), Positives = 54/148 (36%), Gaps = 10/148 (6%)

Query: 48  IRIERAFELLENQIGEKIFISGVHHSV-SKDILLQKIPIR----QDLAECCIDIGYKALN 102
            R+ +  EL +      I ++G   ++ +K  L  ++ +       +    + +  +A N
Sbjct: 101 NRLTQTLELYQQGKIRNILLTGGSSNIITKGQLEAQVVVDFIEDMGIPRTAVIVESQARN 160

Query: 103 TEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           T  NA  ++   +        +++T   HM R     ++    +++         L   +
Sbjct: 161 TWENALNSTQIIQAKYPKASCVLITSATHMRRARACFRKAGLDIEYYCTDYRRTKLGGWA 220

Query: 162 SIFKIKI----LRVLLIEYLKILLLSIQ 185
            +            L  E+  +L+ +++
Sbjct: 221 WLKFEPGVIGDWEGLFKEWAGMLVYAMK 248


>gi|324327048|gb|ADY22308.1| EpiH/GdmH-related protein [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 210

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 58/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C     + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   +    Y   + 
Sbjct: 135 EVGIENGIQTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 174


>gi|165975946|ref|YP_001651539.1| hypothetical protein APJL_0514 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|303250279|ref|ZP_07336479.1| hypothetical protein APP6_1694 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252044|ref|ZP_07533944.1| hypothetical protein appser6_5630 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|165876047|gb|ABY69095.1| hypothetical protein APJL_0514 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|302650895|gb|EFL81051.1| hypothetical protein APP6_1694 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860513|gb|EFM92526.1| hypothetical protein appser6_5630 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 252

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 54/144 (37%), Gaps = 17/144 (11%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGE-------PIR--IERA-------FELLENQIG 62
            I  + + +++ I D+    AIVVL G          R  I  A          L  Q G
Sbjct: 64  LIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYTIAAAPLERMRYAAYLHKQTG 123

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHH 121
             I ++G      +           D     +  +   +  TE NA  + A  ++ +   
Sbjct: 124 LPILVTGGSPEGREPEAKIMAQELHDFFNVSVKWVESASNTTEQNAILSKAMLKQESIDR 183

Query: 122 VLIVTHDYHMPRTFLELQRINSTV 145
           +++VT+ +HM RT +  +R    V
Sbjct: 184 IILVTNQWHMKRTKMLFEREGFNV 207


>gi|325197310|gb|ADY92766.1| conserved hypothetical protein [Neisseria meningitidis G2136]
          Length = 218

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 57/152 (37%), Gaps = 19/152 (12%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           +RY+  G F   +F  ++ F   +  +       +P +    A +VL G           
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFTSSVWAVYRTGGQVLPPYVRADAALVL-GAAAWDKRPSPV 70

Query: 48  --IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALN 102
              RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + N
Sbjct: 71  FRERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRN 130

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
           T  N          N    V+IV+  YH+ R 
Sbjct: 131 TYENLNNIRPVLRANGIASVVIVSDPYHLARA 162


>gi|317968099|ref|ZP_07969489.1| hypothetical protein SCB02_01051 [Synechococcus sp. CB0205]
          Length = 213

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 64/191 (33%), Gaps = 30/191 (15%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
           C + +    + F         P  P    ++VL G+  R     E+   + G  + +SG 
Sbjct: 35  CAVAWSSRGLVF---------PALPPPQLVLVLGGDVERERVGAEV-AKRDGLPVMVSGG 84

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
               S       +   + L +  + + Y+A +T  N        +++   HV++VT   H
Sbjct: 85  ----SNPEYAHWLFRGRGLDDTRVLLDYRATDTLSNFTSVVDDLKRSKIRHVVLVTSSDH 140

Query: 131 MPRTFLELQRI--NSTVQFIPYPII--------------SHDLEENSSIFKIKILRVLLI 174
           M R  +  + +  +  +   P  +                  L     +   + LR    
Sbjct: 141 MDRALMVGRVVAGSRGIGLTPLAVPCGERCVPEDWRKVWGDGLRAALWVVSGRDLRDWAA 200

Query: 175 EYLKILLLSIQ 185
           E    LL  ++
Sbjct: 201 ERFGPLLEEVR 211


>gi|167562950|ref|ZP_02355866.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           oklahomensis EO147]
          Length = 240

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/146 (15%), Positives = 54/146 (36%), Gaps = 13/146 (8%)

Query: 38  SAIVVLTGEP-IRIERAFELLEN--QIGEK--IFISGVHH---SVSKDILLQKIPIRQDL 89
             +   T +   RI++  EL     +   +  + +SG       +++     +  + + +
Sbjct: 79  DGVAAPTHDALARIDKTAELYSACQRTAARCTVVVSGGDPQFRGITEADTYARYLLARGV 138

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           A   +    ++  T  NA+  +A     ++  +++VT  Y M R  L+  R        P
Sbjct: 139 ANGDLIREQRSHTTYENARFTAAILRAQHYDDLILVTSSYQMRRALLDFARFG----IAP 194

Query: 150 YPIISHDLEENSSIFKIKILRVLLIE 175
            P+ ++           +   ++  E
Sbjct: 195 QPVYANRRVAQFGWL-PRTGNLVNAE 219


>gi|165976456|ref|YP_001652049.1| hypothetical protein APJL_1049 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|307257077|ref|ZP_07538852.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|165876557|gb|ABY69605.1| hypothetical protein APJL_1049 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|306864448|gb|EFM96356.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 246

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 47/137 (34%), Gaps = 30/137 (21%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP-----------------IRIERAFELLENQIGEKIFISG 69
             + + D+    AIVVL G                    R+  A   L+ +    + I+G
Sbjct: 68  DNLALEDYKKAQAIVVLGGGVRDSKEIYNPIVVGNQALERMRYA-AYLQKETQLPLLITG 126

Query: 70  VHHS------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
              +         +       +          +  KA  T+ NAQ +     K   + ++
Sbjct: 127 SSPNGTSEAKTMANEFQYFFSVPTQW------LEEKAKTTKENAQFSRELLAKEGINKII 180

Query: 124 IVTHDYHMPRTFLELQR 140
           +VT+ +HM R  +  ++
Sbjct: 181 LVTNQWHMKRAKMLFEK 197


>gi|229167811|ref|ZP_04295543.1| hypothetical protein bcere0007_27710 [Bacillus cereus AH621]
 gi|228615627|gb|EEK72720.1| hypothetical protein bcere0007_27710 [Bacillus cereus AH621]
          Length = 210

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 59/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C I   + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSIILYVSYAAYDIWSYRFKTDDGVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEEELEEARTARVYALKHGVKEEDILIETKSLFTEDNLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      +I   ++   Y   + 
Sbjct: 135 QVGIENGIRTYTIVSDPLHMKRAM----KIAKHIKIEAYASPTP 174


>gi|229060751|ref|ZP_04198106.1| hypothetical protein bcere0026_28450 [Bacillus cereus AH603]
 gi|228718398|gb|EEL70030.1| hypothetical protein bcere0026_28450 [Bacillus cereus AH603]
          Length = 210

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 59/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C I   + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSIILYVSYAAYDIWSYRFKTDDDVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYALKHGVKEEDILIETKSLFTEENLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      +I   ++   Y   + 
Sbjct: 135 QVGIENGIRTYTIVSDPLHMKRAM----KIAKHIKIEAYASPTP 174


>gi|86749502|ref|YP_485998.1| hypothetical protein RPB_2382 [Rhodopseudomonas palustris HaA2]
 gi|86572530|gb|ABD07087.1| Protein of unknown function DUF218 [Rhodopseudomonas palustris
           HaA2]
          Length = 264

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 54/187 (28%), Gaps = 35/187 (18%)

Query: 35  PSVSAIVVLTG-----------------EPIRIERAFELLENQIGEKIFISG-------- 69
            +   I+VL G                    R+  A EL  +    +I  SG        
Sbjct: 77  RAPDGIIVLGGAIDSEVSAARDAVELDSSAERVMAALELARDYPQARIVYSGGSGNLIQN 136

Query: 70  -VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
            V  +     L  +  +  D       +  ++  T  NA               L+VT  
Sbjct: 137 SVAEAPIAADLFARFGVAPDRF----VVESRSRTTAENASFTRELVSPKPGEVWLLVTSA 192

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK-----IKILRVLLIEYLKILLLS 183
           +HMPR+    +     V   P    +    + +  F      +    V   E+  +L   
Sbjct: 193 FHMPRSITAFRAAGFDVTAAPVDWRTRGWGDAARPFDRLSSGLARTDVAAHEWAGLLAYR 252

Query: 184 IQLSLST 190
           +    ++
Sbjct: 253 LSGRTTS 259


>gi|82701477|ref|YP_411043.1| hypothetical protein Nmul_A0343 [Nitrosospira multiformis ATCC
           25196]
 gi|82409542|gb|ABB73651.1| Protein of unknown function DUF218 [Nitrosospira multiformis ATCC
           25196]
          Length = 251

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 52/143 (36%), Gaps = 20/143 (13%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEP-----------------IRIERAFELLENQIGEKI 65
           +        P   ++ AI+VL G                    R+  A ++     G+ I
Sbjct: 63  VLETPSEKNPFDDTIQAIIVLGGGTYYYAPEYGDHTVGRYTLERVRYAAKIYRL-TGKPI 121

Query: 66  FISGVHH-SVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHHVL 123
             +G           +Q   + ++     ++ +   + NT  NA ++ A  +K     + 
Sbjct: 122 LTAGGAPLGNHSSEAMQMKAVLEEEFLVPVEWVEETSSNTRENAYKSFAILQKQGIRQIA 181

Query: 124 IVTHDYHMPRTFLELQRINSTVQ 146
           +VTH +HMPR   E ++    V 
Sbjct: 182 LVTHAWHMPRAAREFEQAGFEVT 204


>gi|212694703|ref|ZP_03302831.1| hypothetical protein BACDOR_04235 [Bacteroides dorei DSM 17855]
 gi|212662682|gb|EEB23256.1| hypothetical protein BACDOR_04235 [Bacteroides dorei DSM 17855]
          Length = 252

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/157 (12%), Positives = 43/157 (27%), Gaps = 14/157 (8%)

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDIL---------LQKIPIRQDLAECCIDIG 97
             R+     L ++    K+ ++     +              +++      +    + + 
Sbjct: 95  ADRLLEGIRLYKHGCIRKLVLASDGSIIESKDGKGLQGNAADMKQYLADLGMPLEDVILE 154

Query: 98  YKALNTEGNAQEASAWA-EKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFI-PYP-I 152
            +A NT  NA                L++T   HM R+                  +P I
Sbjct: 155 TRANNTWENATFTLELIGNSMKTESTLLITSATHMRRSLWTFHAAGLNPDTYITDTFPEI 214

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
                    S   +     L  E++  L   ++   S
Sbjct: 215 KGEKTNFLPSWHVLASWPELTHEWVGYLYYRLRHKPS 251


>gi|325123318|gb|ADY82841.1| putative SanA protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 261

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 66/155 (42%), Gaps = 19/155 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH--PSVSAIVVLTGE----------PI 48
           +   W   ++C   +++G   F  ++K+     +  P V AI+VL               
Sbjct: 65  LHTLWRFGWLCFWIWLIGLGYFFSFIKENKDTSNNIPPVKAIIVLGSGVENGQPSTILAK 124

Query: 49  RIERAFEL-LENQIGEKIFISGVHHSVSKDI---LLQKIPIRQDLAECCIDIGYKALNTE 104
           R++ A  L L+ Q  + +   G+  S  +     + + +  +  +A   + +  K+ +TE
Sbjct: 125 RLDTAAPLALKQQQAQIVLTGGLDFSEKESEALVMSRYLEQKYHIARDQMILEDKSTSTE 184

Query: 105 GNAQEASAWAEKNNFH---HVLIVTHDYHMPRTFL 136
            N + +    E+++      + IVT D+H+PR   
Sbjct: 185 LNLKNSKPLLEQHHITLDQPIAIVTSDFHIPRAIA 219


>gi|148270249|ref|YP_001244709.1| hypothetical protein Tpet_1119 [Thermotoga petrophila RKU-1]
 gi|281412552|ref|YP_003346631.1| protein of unknown function DUF218 [Thermotoga naphthophila RKU-10]
 gi|147735793|gb|ABQ47133.1| protein of unknown function DUF218 [Thermotoga petrophila RKU-1]
 gi|281373655|gb|ADA67217.1| protein of unknown function DUF218 [Thermotoga naphthophila RKU-10]
          Length = 237

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 61/169 (36%), Gaps = 25/169 (14%)

Query: 2   RYFWYGLFVCLIFFI--MGFISFIRYVK-QMHIPDHPSVSA-IVVLTGEPIRIERAFELL 57
           R+F   L V    F   +G   F+  ++  + +P      A IVVL G   R  +A + L
Sbjct: 32  RWFLLALAVTAYLFSSYVGEFLFLWSLEKNLDVPATLPNDAVIVVLGGGVERNTKAGDNL 91

Query: 58  ENQIGEKIFISGVH----------------HSVSKDI-LLQKIPIRQDLAECCIDIGYKA 100
            +    ++  +GV                   +  +  +++   +   + E  I +  ++
Sbjct: 92  SDATLRRLL-TGVQIYQKTKMPILVTGGSLTGLRPEAMIMKDYLVSLGVPEEKITVEDRS 150

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            NT  NA        K     +++VT   HM R     +    +V   P
Sbjct: 151 RNTYENAFFTRE---KIGDVPIILVTDSIHMRRAVSTFKSFFQSVTPYP 196


>gi|51893168|ref|YP_075859.1| hypothetical protein STH2030 [Symbiobacterium thermophilum IAM
           14863]
 gi|51856857|dbj|BAD41015.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 225

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 51/149 (34%), Gaps = 18/149 (12%)

Query: 2   RYFWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PI 48
           R+    L V     +     + F    + +           +VL                
Sbjct: 13  RWLVRLLAVGTAAVLAINALVYFPGRSRIITADAARPAQVALVLGAGVYADGRPTPMLRD 72

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+E A  L E     K+ +SG H     D +  +++    + +    + + +   +T  +
Sbjct: 73  RLETALALYEAGKARKLLLSGDHSRPDYDEVNAMRRYLQERGVPPEDLFLDHAGFDTYDS 132

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
              A+A  +      V++VT  +H+PR  
Sbjct: 133 MYRAAAIFQ---VDDVIVVTQGFHLPRAL 158


>gi|294789429|ref|ZP_06754666.1| putative periplasmic protein [Simonsiella muelleri ATCC 29453]
 gi|294482642|gb|EFG30332.1| putative periplasmic protein [Simonsiella muelleri ATCC 29453]
          Length = 224

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 48/131 (36%), Gaps = 16/131 (12%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IRIERAFELLENQIGEK 64
           ++     +    Q   P      A+VVL G              RI    +L +    +K
Sbjct: 23  VVFCAWQVYDYAQHEKPLPQKADAVVVL-GAAAWGNNPSPVLRERINYGIKLYQQHTVQK 81

Query: 65  IFISGVHHSV---SKDILLQKIPIRQ-DLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           +  +G        ++  + Q+  +++ ++ +  I +  ++ +T  N          ++  
Sbjct: 82  MIFTGGTPKFGYPTEAEVAQRYAMQKFNVPQRDIILDTESSSTYENLTNTRTLMHNHHLD 141

Query: 121 HVLIVTHDYHM 131
            V+IV+   H+
Sbjct: 142 SVIIVSDPDHL 152


>gi|225568744|ref|ZP_03777769.1| hypothetical protein CLOHYLEM_04823 [Clostridium hylemonae DSM
           15053]
 gi|225162243|gb|EEG74862.1| hypothetical protein CLOHYLEM_04823 [Clostridium hylemonae DSM
           15053]
          Length = 201

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 49  RIERAFELLENQIGEKIFISGVHHSVS--KDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+E+   LL     + + +SG   S S  +  +++   ++  +    I    ++++T  N
Sbjct: 67  RVEKGAGLLREGKVKALLLSGGAVSNSHVEAEVMRDHALKLGVPADVIYTEPRSVSTYHN 126

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRT 134
            + + A   +N     ++VT+ +H+ + 
Sbjct: 127 MKYSKALMSENGLKDCVVVTNGWHLRKA 154


>gi|325965245|ref|YP_004243151.1| hypothetical protein Asphe3_39290 [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323471332|gb|ADX75017.1| uncharacterized conserved protein [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 331

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 52/159 (32%), Gaps = 23/159 (14%)

Query: 6   YGLFVCLIFFIMGFISF------IRYVKQMHIPDHPSVSAIVVLTGE----------PIR 49
            G+    +  ++G+  F         +    +P       +VVL               R
Sbjct: 118 LGVLTGTMAVLVGYFGFVFASYLAYSLIYSSLPPRRRPEYVVVLGSGLAGNAVPPLLAAR 177

Query: 50  IERAFELLENQIGE--KIFIS----GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           ++ A  L   + G   +  I     G     ++   + +    Q +    I I  KA  T
Sbjct: 178 LDAAVSLYRGKHGGTIRALIPSGGRGADELTTEGAAMARYLQEQGIPAASILIEDKATTT 237

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
             N   +    ++ +   V +VT  YH+ R  +  +R  
Sbjct: 238 LENLVFSRNLMDRPD-RPVTVVTSSYHVFRAAMFTRRAG 275


>gi|148977536|ref|ZP_01814115.1| hypothetical protein VSWAT3_23004 [Vibrionales bacterium SWAT-3]
 gi|145963187|gb|EDK28454.1| hypothetical protein VSWAT3_23004 [Vibrionales bacterium SWAT-3]
          Length = 284

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/168 (17%), Positives = 63/168 (37%), Gaps = 11/168 (6%)

Query: 46  EPIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R+     +L    G K+ +SG      VS   ++ K+ +   +A+  I +   A +T
Sbjct: 105 GLMRLSEGIRILRLYPGAKLILSGYGAGTEVSNARMMAKVALALGVAKPDIILLETAKDT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI------NSTVQFIPYPIISHDL 157
              A++A+A+ +      +++VT   HM R   E            T       I+    
Sbjct: 165 WEEARQAAAFVKN---KRMVLVTSASHMTRALNEFNAAGMKPLPAPTNYLAQEGIVEPWN 221

Query: 158 EENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEEIT 205
           +       ++       E + ++  S++  L T +       ++ E +
Sbjct: 222 KYMPKAIYLEQTERYWHETMGLVWQSLRDWLDTSSDIAEEPIVVPEAS 269


>gi|145629203|ref|ZP_01785002.1| hypothetical protein CGSHi22121_10385 [Haemophilus influenzae
           22.1-21]
 gi|145639142|ref|ZP_01794749.1| hypothetical protein CGSHiII_03869 [Haemophilus influenzae PittII]
 gi|144978706|gb|EDJ88429.1| hypothetical protein CGSHi22121_10385 [Haemophilus influenzae
           22.1-21]
 gi|145271704|gb|EDK11614.1| hypothetical protein CGSHiII_03869 [Haemophilus influenzae PittII]
 gi|309750723|gb|ADO80707.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 247

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 66/208 (31%), Gaps = 41/208 (19%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
             +  L++    F    ++       + + D+    AIV+L G                 
Sbjct: 43  ISFTWLYIISTPFTGLLLTDNDDTPALTLDDYKQAQAIVILGGGSYPTKELYAETASGSP 102

Query: 48  --IRI--------ERAFELLENQIGEKIFISGVHHS-VSKDILLQKIPIRQDLAECCIDI 96
              R+        E    +L         I G+    +    L Q   +     E     
Sbjct: 103 QLERLRYAAFLQKETGLPVLTTGYS---LI-GISEGDLMAKELNQFFNVPTQWIEN---- 154

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH- 155
             KA NTE NA        K+N   +++VT+ +HM R     ++    V        S  
Sbjct: 155 --KARNTEENASFTKNILIKDNIQKIILVTNQWHMKRAKYLFEKQGFDVLPAAAASYSSK 212

Query: 156 -DLEENSSIFKIKILR---VLLIEYLKI 179
            +L   S I  +  L    VLL E++  
Sbjct: 213 GNLSAKSFIPDLGALNSNMVLLKEWIGY 240


>gi|228959326|ref|ZP_04121021.1| hypothetical protein bthur0005_28140 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228800396|gb|EEM47318.1| hypothetical protein bthur0005_28140 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 219

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 58/163 (35%), Gaps = 17/163 (10%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRIERAFE 55
           + L +C     + + ++  +  +    D     A +VL+              RI  A  
Sbjct: 25  FLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLSAASWNGKPSPVFKERINHAIS 84

Query: 56  LLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N + A  
Sbjct: 85  LYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENLKNAKQ 144

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
              +N      IV+   HM R      RI   +    Y   + 
Sbjct: 145 VGIENGIQTYTIVSDPLHMKRAM----RIAKHINIEAYASPTP 183


>gi|68250305|ref|YP_249417.1| hypothetical protein NTHI2008 [Haemophilus influenzae 86-028NP]
 gi|145633636|ref|ZP_01789363.1| hypothetical protein CGSHi3655_00981 [Haemophilus influenzae 3655]
 gi|148825756|ref|YP_001290509.1| hypothetical protein CGSHiEE_03525 [Haemophilus influenzae PittEE]
 gi|229845236|ref|ZP_04465369.1| hypothetical protein CGSHi6P18H1_02444 [Haemophilus influenzae
           6P18H1]
 gi|229847322|ref|ZP_04467424.1| hypothetical protein CGSHi7P49H1_00484 [Haemophilus influenzae
           7P49H1]
 gi|68058504|gb|AAX88757.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|144985513|gb|EDJ92329.1| hypothetical protein CGSHi3655_00981 [Haemophilus influenzae 3655]
 gi|148715916|gb|ABQ98126.1| hypothetical protein CGSHiEE_03525 [Haemophilus influenzae PittEE]
 gi|229809747|gb|EEP45471.1| hypothetical protein CGSHi7P49H1_00484 [Haemophilus influenzae
           7P49H1]
 gi|229811831|gb|EEP47527.1| hypothetical protein CGSHi6P18H1_02444 [Haemophilus influenzae
           6P18H1]
          Length = 247

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 68/205 (33%), Gaps = 35/205 (17%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
             +  L++  + F    ++       + + ++    AIV+L G                 
Sbjct: 43  ISFTWLYIMSVPFTGLLLTNNDDSPALTLDEYKQAQAIVILGGGSYQTKELYAETASGAP 102

Query: 48  --IRIERAFELLENQIGEKIFISGV------HHSVSKDILLQKIPIRQDLAECCIDIGYK 99
              R+  A   L+ + G  I  +G          +    L Q   +     E       K
Sbjct: 103 QLERLRYA-AFLQKETGLPILTTGYSLIGISEGDLMAKELNQFFNVPTQWIEN------K 155

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH--DL 157
           A NTE NA        K++   +++VT+ +HM R     ++    V            +L
Sbjct: 156 ARNTEENASFTKNILVKDHIQKIILVTNQWHMKRAKYLFEKQGFDVLPAAAASYGSKGNL 215

Query: 158 EENSSIFKIKILR---VLLIEYLKI 179
              S I  +  L    VLL E++  
Sbjct: 216 SAKSFIPDLGALNSNMVLLKEWIGY 240


>gi|209964476|ref|YP_002297391.1| hypothetical protein RC1_1164 [Rhodospirillum centenum SW]
 gi|209957942|gb|ACI98578.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 271

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 52/167 (31%), Gaps = 27/167 (16%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQK 82
              + ++         A +V TG    +                       + +  + + 
Sbjct: 106 AERLTEIPALARRYPDARIVFTGGSGLVFE-------------------QDLKEAPVARA 146

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
              R       +    ++ NT  NA  +   A        L+VT   HMPR+    +RI 
Sbjct: 147 AWERMGFDTARVLFEQESRNTWENALLSRDLAHPVEGEAWLLVTSAMHMPRSVGIFRRIG 206

Query: 143 STVQFIPYPI---ISHDLEENSSIFKIKILRVL---LIEYLKILLLS 183
             V  +PYP+   +               LR L   L EY+ +++  
Sbjct: 207 WNV--VPYPVDFHVPDRSLYRIGFDLTDGLRSLSYALHEYIGLVVYR 251


>gi|312793878|ref|YP_004026801.1| hypothetical protein Calkr_1698 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181018|gb|ADQ41188.1| protein of unknown function DUF218 [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 195

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 49/127 (38%), Gaps = 13/127 (10%)

Query: 34  HPSVSAIVVLT----GE------PIRIERAFELLENQIGEKIFISGV---HHSVSKDILL 80
                 I+VL     G+        R+ RAFEL +      I + G      ++S+    
Sbjct: 35  PKKSDCIIVLGCAVYGDFPSPFFRERLNRAFELYKKGYARYIIVCGAKGPGENISEAEAG 94

Query: 81  QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           ++  + + +    I    K+ +T  N   +     K  F   +IV++ +H+ R  L  ++
Sbjct: 95  KRYLVERGVLPELILKEDKSFSTYENLLYSKKIMNKKGFKSTIIVSNMFHLRRASLIAKK 154

Query: 141 INSTVQF 147
           +     F
Sbjct: 155 LKMNASF 161


>gi|328950417|ref|YP_004367752.1| protein of unknown function DUF218 [Marinithermus hydrothermalis
           DSM 14884]
 gi|328450741|gb|AEB11642.1| protein of unknown function DUF218 [Marinithermus hydrothermalis
           DSM 14884]
          Length = 190

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 40/188 (21%), Positives = 61/188 (32%), Gaps = 36/188 (19%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------R 49
           MR  W  L          FI  +    QM         AIVVL G              R
Sbjct: 1   MRKLWAALLCV-------FIWGLASAPQM-------ADAIVVL-GAAQYNGHPSPIFANR 45

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           +  A  L        I ++G        S+  +  +      +    +    ++ +T  N
Sbjct: 46  LNAALALYRQGYAPTILVTGGKQPGDRYSEGEVGCRYLEAAGVPRDALICETRSRSTWEN 105

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
            + A A         VLIVT   H+PR  +  QR+   +    YP+      E     + 
Sbjct: 106 LKNARALL---GPARVLIVTDAPHLPRAMMLAQRL--NIDAGGYPVAGRFPLEYRW--RE 158

Query: 167 KILRVLLI 174
            +LR+L  
Sbjct: 159 AVLRLLTR 166


>gi|312877810|ref|ZP_07737760.1| protein of unknown function DUF218 [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795436|gb|EFR11815.1| protein of unknown function DUF218 [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 195

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 49/127 (38%), Gaps = 13/127 (10%)

Query: 34  HPSVSAIVVLT----GE------PIRIERAFELLENQIGEKIFISGV---HHSVSKDILL 80
                 I+VL     G+        R+ RAFEL +      I + G      ++S+    
Sbjct: 35  PKKSDCIIVLGCAVYGDFPSPFFRERLNRAFELYKKGYARYIIVCGAKGPGENISEAEAG 94

Query: 81  QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
           ++  + + +    I    K+ +T  N   +     K  F   +IV++ +H+ R  L  ++
Sbjct: 95  KRYLVERGVLPELILKEDKSFSTYENLLYSKRIMNKKGFKSAIIVSNMFHLRRASLIAKK 154

Query: 141 INSTVQF 147
           +     F
Sbjct: 155 LKMNASF 161


>gi|269120765|ref|YP_003308942.1| hypothetical protein Sterm_2157 [Sebaldella termitidis ATCC 33386]
 gi|268614643|gb|ACZ09011.1| protein of unknown function DUF218 [Sebaldella termitidis ATCC
           33386]
          Length = 243

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 51/120 (42%), Gaps = 16/120 (13%)

Query: 31  IPDHPSVSAIVVLTGE-----------PIRIERAFELLENQIGEKIFISG---VHHSVSK 76
                    +VVL                R ++A E L+      +F++G   +   V +
Sbjct: 81  PSGAQKSDFVVVLGSGLRYGTYLSPEGKRRSDKAIEYLKEYPHLNVFLTGGQGIDEKVPE 140

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMPRT 134
            +++++  +   + E  I +  K+ NT  N +      +  +  +H++L+VT D+HMPR 
Sbjct: 141 SVIMKEYFLENGIDENRIFLEDKSTNTNENIKFYIDALKDTDMEYHNILLVTSDFHMPRA 200


>gi|34496963|ref|NP_901178.1| transmembrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34102819|gb|AAQ59183.1| probable transmembrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 254

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 61/190 (32%), Gaps = 34/190 (17%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEP----------------IRIERAFELLENQIGEKIF 66
           +     +   D  +  AIVVL G                   R+  A   L  Q G+ + 
Sbjct: 69  VERYPPIRPADLAAADAIVVLGGGKRPAPEFGGNAPSSDTLARLRYA-AYLARQSGKPVL 127

Query: 67  ISGVHH-------SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           ++G           V    L     IR    E       ++  T  NA+ ++   +    
Sbjct: 128 VTGGSPLGGEPEGKVMASALHDDYGIRARWVED------RSDTTLDNARLSAEMLKAAGA 181

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD----LEENSSIFKIKILRVLLIE 175
             + +V+  +H+ R     Q     V   P   + ++         S   +    VLL E
Sbjct: 182 TRIALVSQGWHLGRAVPFFQSQGLQVSPAPTGFVRYEGPAFTRYLPSGKAMGDCHVLLRE 241

Query: 176 YLKILLLSIQ 185
           Y+ +L   ++
Sbjct: 242 YIGLLYYRLR 251


>gi|307256540|ref|ZP_07538321.1| hypothetical protein appser10_5450 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306864950|gb|EFM96852.1| hypothetical protein appser10_5450 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 252

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 52/144 (36%), Gaps = 17/144 (11%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGE-------PIR--IERA-------FELLENQIG 62
            I  + + +++ I D+    AIVVL G          R  I  A          L  Q G
Sbjct: 64  LIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYAIAAAPLERMRYAAYLHKQTG 123

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCID-IGYKALNTEGNAQEASAWAEKNNFHH 121
             I  +G      +           D     +  +   +  TE NA  + A  ++     
Sbjct: 124 LPILATGGSPEGREPEAKIMAQELHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDR 183

Query: 122 VLIVTHDYHMPRTFLELQRINSTV 145
           +++VT+ +HM RT +  +R    V
Sbjct: 184 IILVTNQWHMKRTKMLFEREGFNV 207


>gi|88807093|ref|ZP_01122605.1| hypothetical protein WH7805_11118 [Synechococcus sp. WH 7805]
 gi|88788307|gb|EAR19462.1| hypothetical protein WH7805_11118 [Synechococcus sp. WH 7805]
          Length = 195

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 64/170 (37%), Gaps = 11/170 (6%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVS--AIVVLTGEPIRIERAFELLENQIGEKIFI 67
             LI  ++   +F   ++   +          I+VL G+  R      L   Q+   + +
Sbjct: 8   FLLISSLVAGAAFATPLRPFAVAALTRQDPQKILVLGGDADRERIGLRL-ARQLELPLVV 66

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SG     +     Q +   + L +  + + Y+A +T GN        +     HVL+VT 
Sbjct: 67  SGG----TNPEYAQWLMEHEGLGQNEVRLDYRAQDTLGNFTSLVDELQGEEIEHVLLVTS 122

Query: 128 DYHMPRTFLE--LQRINSTVQFIPYPIISHD--LEENSSIFKIKILRVLL 173
           + H+PR  +   +   +  ++    P+   +   +E+        LR L 
Sbjct: 123 EDHLPRALMVGGIVAGSRGIRLTGVPVSCAERCRKESLGKRWGDGLRALA 172


>gi|296137799|ref|YP_003645042.1| hypothetical protein Tpau_0049 [Tsukamurella paurometabola DSM
           20162]
 gi|296025933|gb|ADG76703.1| protein of unknown function DUF218 [Tsukamurella paurometabola DSM
           20162]
          Length = 185

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 53/136 (38%), Gaps = 13/136 (9%)

Query: 5   WYGLFVCLIFFIMGFISFIRY--VKQMHIPDHPSVSAIVVLTGEP--IRIERAFELLENQ 60
           W    + ++F  +G ++ + Y    Q        V A+VVL G     R +   +L +  
Sbjct: 9   WSTAVLVVVF--LGAVAAVGYPVFGQAKQDPLERVDAVVVL-GGEHDGREQYGLQLAKEG 65

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQ--DLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
               + +S  +     D ++  +  R+   +   C         T G A      A +  
Sbjct: 66  YAPTLVLS--NPYEPDDHVMAPLCDRRVDGIEVLCEVPDPS--TTRGEALFTERLARERG 121

Query: 119 FHHVLIVTHDYHMPRT 134
           +  V++V+  YH+PR+
Sbjct: 122 WKKVIVVSWRYHLPRS 137


>gi|229018413|ref|ZP_04175281.1| hypothetical protein bcere0030_29410 [Bacillus cereus AH1273]
 gi|229024642|ref|ZP_04181087.1| hypothetical protein bcere0029_29550 [Bacillus cereus AH1272]
 gi|228736707|gb|EEL87257.1| hypothetical protein bcere0029_29550 [Bacillus cereus AH1272]
 gi|228742893|gb|EEL93025.1| hypothetical protein bcere0030_29410 [Bacillus cereus AH1273]
          Length = 210

 Score = 59.9 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 59/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C I   + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSIILYVSYAAYDIWSYRFKTDDGMKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKHGVKEEDILIETKSLFTEDNLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      RI   ++   Y   + 
Sbjct: 135 QVGIENGIRTYTIVSDPLHMKRAM----RIAKHIKIEAYASPTP 174


>gi|317052073|ref|YP_004113189.1| hypothetical protein Selin_1906 [Desulfurispirillum indicum S5]
 gi|316947157|gb|ADU66633.1| protein of unknown function DUF218 [Desulfurispirillum indicum S5]
          Length = 249

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 55/161 (34%), Gaps = 38/161 (23%)

Query: 20  ISFIRYVKQMHIP---DHPSVSAIVVLTGEPI------------------RIERAFELLE 58
                 ++Q   P   D     AIV+L G                     R+     L  
Sbjct: 55  AWLHSGLQQHPPPTGKDIRRAQAIVILGGGRDYGAPEFGAEDAPGNATWRRLAYGAHL-A 113

Query: 59  NQIGEKIFISG--VHHSVSKDI------LLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
            Q G  I +SG  VH  +  +       L     +     E        +  T  NA+ +
Sbjct: 114 RQSGLPILVSGGRVHGELHSEAWLMDQALRHSFGLEAQWRE------EHSRTTRENARYS 167

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
           +   +  +  H+L+VT  +H+PR   E +R    ++ IP P
Sbjct: 168 APILQNADITHILLVTQAWHLPRALPEFRR--QGLEVIPAP 206


>gi|309390074|gb|ADO77954.1| protein of unknown function DUF218 [Halanaerobium praevalens DSM
           2228]
          Length = 253

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 57/166 (34%), Gaps = 35/166 (21%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVS-------------AIVVLTGEP------- 47
           L      F + F+ F+       +  HP  +              IVVL G         
Sbjct: 38  LIRLTAVFSLIFLIFLATAVGARVLVHPLENYAERNLVEVSQKYPIVVLGGGSNYYSAKK 97

Query: 48  --------IRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGY- 98
                    R+ + +EL  +     I+  GV  ++ +  + +     + L +  +D+ + 
Sbjct: 98  TTPSTHSLQRLVKGYELHRSLKTPLIYSGGV--AIGQQNISEADAASEFLQDLGMDLEFY 155

Query: 99  ----KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
               KA  T  NA     W +++    V + T  YHM R+    + 
Sbjct: 156 FSETKAQTTFENAAYLRKWIKQHQVKKVYLFTSAYHMLRSMTVFKA 201


>gi|254409533|ref|ZP_05023314.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196183530|gb|EDX78513.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 206

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 60/142 (42%), Gaps = 6/142 (4%)

Query: 34  HPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECC 93
            P   AI+ L G   R +   +  +      I++S    S S   +L  I    ++    
Sbjct: 27  SPHPQAILTLGGGRDREKFTAQFAQTHPSLDIWVS----SGSPPDVLYAIFQNANIPIQR 82

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR--TFLELQRINSTVQFIPYP 151
           + + Y+A++T  N     A  ++ N  H+ ++T DYH+PR      L   + ++ F P  
Sbjct: 83  VHLDYRAVDTVTNFTSLVADFKRRNIQHIYLITSDYHIPRAKAIAILVLGSQSITFTPVA 142

Query: 152 IISHDLEENSSIFKIKILRVLL 173
           + S+   E+        +R LL
Sbjct: 143 VPSNQPPESWLRILRDSIRALL 164


>gi|3056882|gb|AAC14002.1| unknown [Actinosynnema pretiosum subsp. auranticum]
          Length = 336

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 60/162 (37%), Gaps = 24/162 (14%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV------SAIVVLTGE----------PI 48
           W       +F + G++ F   +  ++   +  V      +AIVVL               
Sbjct: 123 WVLAAAGSLFLLAGYLGFAFTLFLLYSVLYGRVRKRTGHTAIVVLGAGVPGGRVTPLLAG 182

Query: 49  RIERAFELL----ENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           R++RA +L            +  SG        S+  ++      + + +  +    ++ 
Sbjct: 183 RLDRALKLYRRAAAKGASPLVVASGGQGPDEPASEAEVMANYLRERGIPDEALLEEREST 242

Query: 102 NTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRIN 142
           +T  N + +SA   +      +L+VT  YH+PR  +  +R  
Sbjct: 243 STWENLRLSSALLAERGVTGRLLVVTSSYHVPRAAILSRRAG 284


>gi|33152333|ref|NP_873686.1| hypothetical protein HD1239 [Haemophilus ducreyi 35000HP]
 gi|33148556|gb|AAP96075.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 256

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 54/147 (36%), Gaps = 23/147 (15%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN-----------------QI 61
            I  + + +++ I ++    AIVVL G    +  + EL  +                   
Sbjct: 67  LIQAVSFSEKLTIEEYRQAQAIVVLGGG---VRNSRELFADYAIAATPLERMRYAAYLHK 123

Query: 62  GEKI--FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALN-TEGNAQEASAWAEKNN 118
             ++   ++G   +  +           +  +  +     A N TE NA    A  +K  
Sbjct: 124 QTRLPVLVTGGSPTGKQPEANIMAQEFANFFDVQVKWIESASNITEENAHLTKAILDKEG 183

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTV 145
              +++VT+++HM R  +  +R    V
Sbjct: 184 ITKIILVTNEWHMKRAKMLFEREGFNV 210


>gi|17158752|ref|NP_478263.1| hypothetical protein all7616 [Nostoc sp. PCC 7120]
 gi|17134701|dbj|BAB77259.1| all7616 [Nostoc sp. PCC 7120]
          Length = 228

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 62/173 (35%), Gaps = 28/173 (16%)

Query: 1   MRYFWYGLFVCLIF---FIMGFISFIRYVKQ-MHIPDHPSVSAIVVLTGE---------- 46
           +R+   GL + ++        +I  +    + +     P     +V              
Sbjct: 19  LRWILLGLVISVLAKPLIATAYIGLMTNGDRYVQPESVPKEQVAIVFGAGILPNDNPTPM 78

Query: 47  -PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDL--AECCIDIGYKALNT 103
              R+E A +L +     K+ ++G + +VS + +   +    DL      I + Y   +T
Sbjct: 79  LSDRVEAAVKLYKMGKISKLLMTGDNSTVSYNEVRSMLKYAHDLGVPMKNITLDYAGFST 138

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN--------STVQFI 148
             +   A    +    H  +++T +YH+PRT    +++           ++  
Sbjct: 139 YESCYRAH---KVFGVHKAVVITQNYHLPRTVYTCRQLGLKTVGLGTPDIEIY 188


>gi|257454427|ref|ZP_05619689.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257448193|gb|EEV23174.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 274

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 76/205 (37%), Gaps = 33/205 (16%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQ-MHIPDHPSVS-AIVVLTGEPI---------- 48
           ++  W  +++    +++ F  F+ Y+KQ  +  +HP  + AI+VL G             
Sbjct: 78  LKKLWQLVWLLFFVWLISFCIFVSYLKQHFNTDNHPKAAQAIIVLGGGTKDNKPTDAVKL 137

Query: 49  RIERAFELLENQIGEKIFIS--GVHHSVSKDI---LLQKIPIRQDLAECCIDIGYKALNT 103
           R+++A E++       + I+  G            +   +     ++   I +  ++ +T
Sbjct: 138 RLDKASEVIRR-FANALVITSGGFDAGEDVSEAKAMADYLHDTYGISLANISLEEQSTST 196

Query: 104 EGNAQEASAWAEKNNF---HHVLIVTHDYHMPR-TFLELQRINSTVQFIPYPIISHDLEE 159
           E N   +     +        ++ VT D+H  R + +  ++  + +Q +          +
Sbjct: 197 ELNFVHSKKILAQQGIALNQPIIAVTSDFHTLRASLIGKRQGYTNLQVVG--------SD 248

Query: 160 NSSIFKIKILRVLLIEYLKILLLSI 184
                +     V   EY   +   +
Sbjct: 249 TPWYIRPN---VWFREYFAFISGWL 270


>gi|87123615|ref|ZP_01079466.1| hypothetical protein RS9917_07130 [Synechococcus sp. RS9917]
 gi|86169335|gb|EAQ70591.1| hypothetical protein RS9917_07130 [Synechococcus sp. RS9917]
          Length = 214

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 56/151 (37%), Gaps = 21/151 (13%)

Query: 40  IVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYK 99
           I+VL G+  R +   +L     G ++ +  V    S       +  R+ L++  + + Y+
Sbjct: 38  ILVLGGDVDREKAGLQL-----GRRLALPVVVSGGSNPEYAHWLMDREGLSQSRVRLDYR 92

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL--ELQRINSTVQFIPYPI----- 152
           A +T GN        ++    H+L+VT   H+PR      L   +  ++    P+     
Sbjct: 93  AKDTLGNFTSLVDDLKREGVQHMLLVTSRDHLPRAMAVGRLVAGSRGIRLTAVPVACAPR 152

Query: 153 ---------ISHDLEENSSIFKIKILRVLLI 174
                    +   L   + +   + L+    
Sbjct: 153 CLEESLGKQVGDGLRALAWVLTGRDLKPWAR 183


>gi|108804095|ref|YP_644032.1| hypothetical protein Rxyl_1256 [Rubrobacter xylanophilus DSM 9941]
 gi|108765338|gb|ABG04220.1| protein of unknown function DUF218 [Rubrobacter xylanophilus DSM
           9941]
          Length = 195

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 56/160 (35%), Gaps = 12/160 (7%)

Query: 22  FIRYVKQMHIPDHPSVSAIVVLTGEP------IRIERAFELLENQIGEKIFI--SGVHHS 73
           F   + +    +   V    VL G         R   A  L       ++ I   GV   
Sbjct: 21  FSGEMPRPGGAEVAVVLGSQVLPGGRPSGTLMARTLHAARLYRGGRV-RLLIPTGGVGRH 79

Query: 74  V-SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
             S+  ++ ++     +    + +  +AL+T  +A+  S  A       VL+VT   H  
Sbjct: 80  PPSEAEIMARLLRGAGVPGRAVLLEDRALSTWDSARYVSRMARGLGVGRVLVVTDPLHCV 139

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
           RT    +     ++ IP P+ S  +     +   +  R +
Sbjct: 140 RTVAAFRHA--GLEAIPEPVYSSPMWRVRWLRLGQFFREM 177


>gi|229012351|ref|ZP_04169528.1| hypothetical protein bmyco0001_27960 [Bacillus mycoides DSM 2048]
 gi|228748987|gb|EEL98835.1| hypothetical protein bmyco0001_27960 [Bacillus mycoides DSM 2048]
          Length = 210

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 59/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C I   + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSIILYVSYAAYDIWSYRFKTDDGVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYALKHGVKEEDILIETKSLFTEDNLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      +I   ++   Y   + 
Sbjct: 135 QVGIENGIRTYTIVSDPLHMKRAM----KIAKHIKIEAYASPTP 174


>gi|163940818|ref|YP_001645702.1| hypothetical protein BcerKBAB4_2882 [Bacillus weihenstephanensis
           KBAB4]
 gi|229133982|ref|ZP_04262803.1| hypothetical protein bcere0014_28980 [Bacillus cereus BDRD-ST196]
 gi|163863015|gb|ABY44074.1| protein of unknown function DUF218 [Bacillus weihenstephanensis
           KBAB4]
 gi|228649475|gb|EEL05489.1| hypothetical protein bcere0014_28980 [Bacillus cereus BDRD-ST196]
          Length = 210

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 59/164 (35%), Gaps = 19/164 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
           + L +C I   + + ++  +  +    D     A +VL G              RI  A 
Sbjct: 16  FLLMICSIILYVSYAAYDIWSYRFKTDDGVKTDAGIVL-GAASWNGKPSPVFKERINHAI 74

Query: 55  ELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N + A 
Sbjct: 75  SLYKNGNIKKIIFTGGTKFEAELEEARTARVYALKHGVKEEDILIETKSLFTEDNLKNAK 134

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               +N      IV+   HM R      +I   ++   Y   + 
Sbjct: 135 QVGIENGIRTYTIVSDPLHMKRAM----KIAKHIKIEAYASPTP 174


>gi|300312530|ref|YP_003776622.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
 gi|300075315|gb|ADJ64714.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
          Length = 269

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 74/226 (32%), Gaps = 51/226 (22%)

Query: 2   RYFWYGLFVCLIFFI--------MGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIE 51
           R+  +GL + ++           +G +  I  ++  +          AIV+L     RI+
Sbjct: 52  RWRRFGLLLIVLGVATLLVLSTRVGSLLLIAPLENSYPVLRSPGQAQAIVIL--GSGRID 109

Query: 52  RAFEL-------------------LENQIGEKIFISGVHHSVSKDI--------LLQKIP 84
           RA E                    L  Q G  I ++G +   S +         L +   
Sbjct: 110 RAPEYGGLDDANAIGMKRLQYGAYLHRQSGLPILVTGGNPDGSPESEAAVMARTLERDFA 169

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST 144
           +     E       ++  T  NA  ++A  ++     +L+VT   HMPR           
Sbjct: 170 VPVRWQEG------RSNTTYDNATLSAAMLKEAGISRILLVTDSLHMPRAMQVFATTGLQ 223

Query: 145 VQFIPYPIISHDLEENSSIFKIKILRV-----LLIEYLKILLLSIQ 185
           VQ  P  + +       + +      +      L E++  L   ++
Sbjct: 224 VQAAPT-VFAGQARTRVTDYLPNAASLQLASYALREWIGQLWYRVR 268


>gi|262404134|ref|ZP_06080689.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC586]
 gi|262349166|gb|EEY98304.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC586]
          Length = 283

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 62/166 (37%), Gaps = 11/166 (6%)

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+     +     G K+ +SG      VS   ++ ++ +   + +  I +   A +T   
Sbjct: 108 RLAEGIRINRMYPGSKMILSGYAGGSEVSHARMMARVALALGVPKSDIILLETAKDTWEE 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           A++A+A+ ++     +++VT   HM R   E +         P   + H          I
Sbjct: 168 ARQAAAFVQQ---KRMVLVTSASHMKRAMREFEAAGLNPIPAPTNFLGHLNIAQPWDKYI 224

Query: 167 KILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIEEITV 206
              R L        E L +L   ++ +++    +      + E TV
Sbjct: 225 PKARYLEQTEQYWYETLGLLWQKLRDTVAGDVETPLANPAVIEETV 270


>gi|108763026|ref|YP_634765.1| hypothetical protein MXAN_6648 [Myxococcus xanthus DK 1622]
 gi|108466906|gb|ABF92091.1| hypothetical protein MXAN_6648 [Myxococcus xanthus DK 1622]
          Length = 292

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 47/153 (30%), Gaps = 16/153 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVL-----TGE------PIR 49
              +  L V       G       V +            +VVL      G         R
Sbjct: 90  ARLFRLLMVGAGVLTCGVFGLAWVVDRFGQREQAAPADVLVVLGARVLPGGVPSGALRAR 149

Query: 50  IERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
            E A  L    +  ++  SG   V+       +L         AE C+ +   + +T+ N
Sbjct: 150 TEHAVALYHRGVAPRLVFSGGVGVNPPSEARAMLALATRMGVPAEACV-LEEGSHSTDDN 208

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           A+  +          V++V+  YH+ R     +
Sbjct: 209 ARLTAEVLRGLGARRVVVVSDPYHLLRARNYFR 241


>gi|260582799|ref|ZP_05850585.1| molybdate ABC transporter permease [Haemophilus influenzae NT127]
 gi|260094125|gb|EEW78027.1| molybdate ABC transporter permease [Haemophilus influenzae NT127]
          Length = 247

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 65/208 (31%), Gaps = 41/208 (19%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
             +  L++    F    ++       + + D+    AIV+L G                 
Sbjct: 43  ISFTWLYIISTPFTGLLLTDNDDTPALTLDDYKQAQAIVILGGGSYPTKELYAETASGSP 102

Query: 48  --IRI--------ERAFELLENQIGEKIFISGVHHS-VSKDILLQKIPIRQDLAECCIDI 96
              R+        E    +L         I G+    +    L Q   +     E     
Sbjct: 103 QLERLRYAAFLQKETGLPVLTTGYS---LI-GISEGDLMAKELNQFFNVPTQWIEN---- 154

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH- 155
             KA NTE NA        K++   +++VT+ +HM R     ++    V           
Sbjct: 155 --KARNTEENASFTKNILVKDHIQKIILVTNQWHMKRAKYLFEKQGFDVLPAAAASYGSK 212

Query: 156 -DLEENSSIFKIKILR---VLLIEYLKI 179
            +L   S I  +  L    VLL E++  
Sbjct: 213 GNLSAKSFIPDLGALNSNMVLLKEWIGY 240


>gi|119896762|ref|YP_931975.1| hypothetical protein azo0471 [Azoarcus sp. BH72]
 gi|119669175|emb|CAL93088.1| conserved hypothetical membrane protein [Azoarcus sp. BH72]
          Length = 283

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 53/188 (28%), Gaps = 45/188 (23%)

Query: 33  DHPSVSAIVVLTGEP-----------------IRIERAFELLENQIGEKIFISGVHHSVS 75
                 AIV+L G                    R+     L     G  + +SG   S  
Sbjct: 103 AARGAQAIVILGGGRRSHAAEYGGDTVNRLTLERLRYGARLARA-TGLPLLVSGGAPSGD 161

Query: 76  KDI-------LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
                     L +   I     E        + +T  NA+ ++A    +    V++VTH 
Sbjct: 162 VPEATLMAAALREDFGIAPRWEEG------GSFDTRDNARLSAAMLRADGVTRVVLVTHA 215

Query: 129 YHMPRTFLELQRINSTVQFIPYPII-------SHDLEENSSIFKIKI-----LRVLLIEY 176
            HM R   E       +  +P P           D ++                  L E+
Sbjct: 216 AHMRRAEAEF--ALHGLAVVPAPTAWLGPGPERADDDDEVWPSLPSQGTAYAGWYALHEW 273

Query: 177 LKILLLSI 184
           + +L   +
Sbjct: 274 MGLLAYRL 281


>gi|317489670|ref|ZP_07948174.1| DUF218 domain-containing protein [Eggerthella sp. 1_3_56FAA]
 gi|316911264|gb|EFV32869.1| DUF218 domain-containing protein [Eggerthella sp. 1_3_56FAA]
          Length = 218

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 52/153 (33%), Gaps = 25/153 (16%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPD---HPS------VSAIVVL------TGEPI-- 48
            GL +  +  ++   +           D    P         AIVVL       G P   
Sbjct: 5   LGLMLGCMLVVVAVFAATNVATIATTKDRIVEPQSAVGFDADAIVVLGASVFADGTPSGI 64

Query: 49  ---RIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNT 103
              R++    L +  +  K+ +SG + +VS +   +++   I Q +    I   +   +T
Sbjct: 65  LRDRLDDGIALYKEGVAPKLIMSGDNSTVSYNEVQVMKDYAISQGVPSHDIFCDHAGFST 124

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             +   A           +++ T  YH+ R   
Sbjct: 125 YESMYRAKH---VFGAERIVVATQTYHLYRALY 154


>gi|298493004|ref|YP_003723181.1| hypothetical protein Aazo_4922 ['Nostoc azollae' 0708]
 gi|298234922|gb|ADI66058.1| protein of unknown function DUF218 ['Nostoc azollae' 0708]
          Length = 198

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 64/186 (34%), Gaps = 22/186 (11%)

Query: 1   MRYFWYGL----FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFEL 56
           M+  +Y L     + L  F + F+S I     +     P   AI+ L G   R +   E 
Sbjct: 1   MKRSYYLLKKYWILSLASFSLVFLSIIPIRIAIASYQAPHPQAILTLGGGQEREKFTAEF 60

Query: 57  LENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
            +N     I+IS     +              +    I + Y+A++T  N         K
Sbjct: 61  AQNHPNLHIWIS---SGILPAQAFAIFE-EVSIPTERIHLDYRAVDTVTNCTTLVHDFHK 116

Query: 117 NNFHHVLIVTHDYHMPRT--FLELQRINSTVQFIP------------YPIISHDLEENSS 162
            +  H+ ++T D+H+PR      L   +  + F P            +PI+         
Sbjct: 117 YHIKHIYLITSDFHLPRAKTIATLVLGSQGITFTPISIPSERPRESIFPIVRDSGRSLLW 176

Query: 163 IFKIKI 168
           I   + 
Sbjct: 177 IVSGRT 182


>gi|327398427|ref|YP_004339296.1| hypothetical protein Hipma_0260 [Hippea maritima DSM 10411]
 gi|327181056|gb|AEA33237.1| protein of unknown function DUF218 [Hippea maritima DSM 10411]
          Length = 258

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 25/161 (15%)

Query: 2   RYFWYGLFVCLIFFIM----GFISFIRYVKQMHIPDHPSVSAIVVLTGEPI---RIER-- 52
           R+ W+ +    + + +    G    + Y++ +      + SA+VVL+G      RI+   
Sbjct: 42  RFRWFFMVSAFVLWFISTTPGKNLLLSYLEDIKT-SSDTASAVVVLSGGSNPYDRIKTYP 100

Query: 53  -AFE------LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECC-----IDIGYKA 100
            AF+      LL  +    +  SG    +  +   Q     + +A+ C     I    K+
Sbjct: 101 EAFKRLMYGILLAKRYNIPLIFSGG--GLKYNDSAQAKNDIEIIAKICNCKIKIYFENKS 158

Query: 101 LNTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQR 140
           LNT  NA+  S + EK      + IVT  YH  R  +  + 
Sbjct: 159 LNTYQNAKYTSKFFEKMKIKKDIFIVTSAYHQKRANILFRY 199


>gi|318042858|ref|ZP_07974814.1| hypothetical protein SCB01_14194 [Synechococcus sp. CB0101]
          Length = 268

 Score = 59.5 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 59/173 (34%), Gaps = 27/173 (15%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGEPIRIE----RAFELLENQ-------------IGEKIF 66
                +     P   A+VVL G  +R      +A E+ E