BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780579|ref|YP_003064992.1| hypothetical protein
CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|227823233|ref|YP_002827205.1| hypothetical protein NGR_c27030 [Sinorhizobium fredii NGR234]
 gi|227342234|gb|ACP26452.1| hypothetical protein NGR_c27030 [Sinorhizobium fredii NGR234]
          Length = 242

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 70/207 (33%), Positives = 117/207 (56%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  ++ L   L  F+ GF+ F   V  +  P  P   AIVVLTG   RIE+A ELL++ 
Sbjct: 35  LRRGFFVLLAFLAVFVAGFLYFADTVASLQPPAAPKADAIVVLTGGFQRIEQAVELLKSG 94

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGV+ + +   + +      DL +CC+DIG++A++T GNA EA  W   + + 
Sbjct: 95  AGNRLLISGVNPATTGSQIRRNTQSSADLFKCCVDIGHEAVDTIGNATEAGQWIHDHGYR 154

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT++YHMPR+ LEL+R+    +FI YP+++ DL+ ++ +   + ++ +L+EY K  
Sbjct: 155 SVLVVTNNYHMPRSLLELRRVRPDTEFIAYPVVNSDLKTSNWLRNPRFIKAILLEYAKYS 214

Query: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207
           +  ++   +   A          I  K
Sbjct: 215 IAFLRDFANAHLADSSRTDTAPPIQAK 241


>gi|299132206|ref|ZP_07025401.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
 gi|298592343|gb|EFI52543.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
          Length = 236

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/183 (31%), Positives = 93/183 (50%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            LF   + F+ GF  F   ++            IVVLTG   R+  A +LL    G+++ 
Sbjct: 27  FLFSFFVIFLAGFAWFASQLRSEESKPDRHADGIVVLTGGASRVADALDLLSKGYGKRLL 86

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH +     +L+  P  Q L +CC+D+   A+NT  NA E   W ++  FH +++VT
Sbjct: 87  ISGVHPANGAADILRAQPESQALLKCCVDLDRSAVNTRSNATETRRWVKERGFHSLIVVT 146

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            +YHMPR  +EL      +  I YP++S              +R++ +EY+K L+  +++
Sbjct: 147 SNYHMPRATVELTHAMPDIDLIFYPVVSEAWRGEPWWNSPAGVRLVALEYVKYLVAQVRV 206

Query: 187 SLS 189
            L+
Sbjct: 207 RLA 209


>gi|222149964|ref|YP_002550921.1| hypothetical protein Avi_4029 [Agrobacterium vitis S4]
 gi|221736946|gb|ACM37909.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 246

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 72/185 (38%), Positives = 104/185 (56%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +RY  Y + + +   + GF+ F   V  M  P  P   AIVVLTG   RI++A +LL   
Sbjct: 38  LRYGGYAILLLMACLVAGFLHFADDVTAMMPPAEPKADAIVVLTGGYQRIDQAVDLLRKG 97

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGVH S S   + +      DL  CC+D+GY+A++T GNA E + W     F 
Sbjct: 98  SGRRLLISGVHPSTSPATIRKMTQASPDLFACCVDMGYRAIDTIGNANETAQWIHDKGFS 157

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT +YHM R+ +EL+R +   QFIPYP+++ DL   +       LR L+ EY KIL
Sbjct: 158 SVLVVTSNYHMRRSLMELRRTDHETQFIPYPVVTADLRTRAWYADPNALRTLMSEYAKIL 217

Query: 181 LLSIQ 185
           +   +
Sbjct: 218 IAYTR 222


>gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040256|gb|ACT57052.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ
Sbjct: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH
Sbjct: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL
Sbjct: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180

Query: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207
           LLSIQLSLSTQTASQFFITLIEEITVK
Sbjct: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207


>gi|218462839|ref|ZP_03502930.1| hypothetical protein RetlK5_26822 [Rhizobium etli Kim 5]
          Length = 236

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/185 (37%), Positives = 109/185 (58%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 32  LRWGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKG 91

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+E S W     + 
Sbjct: 92  AGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGHDAIDTIGNAEETSNWIHAKGYR 151

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VL+VT++YHMPRT  EL  ++  ++FIPYP+++ DL+  +       +RV+L EYLK+L
Sbjct: 152 SVLVVTNNYHMPRTLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYLKVL 211

Query: 181 LLSIQ 185
           L   +
Sbjct: 212 LAGAR 216


>gi|90426336|ref|YP_534706.1| hypothetical protein RPC_4865 [Rhodopseudomonas palustris BisB18]
 gi|90108350|gb|ABD90387.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB18]
          Length = 240

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 58/196 (29%), Positives = 97/196 (49%), Gaps = 5/196 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +  +    GF+ F+  ++   I    +   IVVLTG   R+  A ELL    G ++ I
Sbjct: 31  LAIGFVGMASGFVVFLSQLRGAEIQPGRNADGIVVLTGGSSRVSDAIELLAAGYGRRLLI 90

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +   + + + +P  Q L  CC+D+   A+NT  NA EA  WA +  FH +++VT 
Sbjct: 91  SGVHPTNGANDISRSLPDSQQLLSCCVDLDRSAINTRSNAAEARRWAHERGFHSLIVVTS 150

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +E+      ++ IP+ ++     ++         R+LL EY K +    ++ 
Sbjct: 151 NYHMPRAIVEMSHAMPDIELIPFAVVGDKWRDDPWWTSGATFRLLLSEYAKYIAAEARVR 210

Query: 188 LSTQTASQFFITLIEE 203
           L+      F   L+ +
Sbjct: 211 LA-----GFGAELMPD 221


>gi|220921160|ref|YP_002496461.1| hypothetical protein Mnod_1152 [Methylobacterium nodulans ORS 2060]
 gi|219945766|gb|ACL56158.1| protein of unknown function DUF218 [Methylobacterium nodulans ORS
           2060]
          Length = 245

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 62/205 (30%), Positives = 100/205 (48%), Gaps = 5/205 (2%)

Query: 2   RYFWYGLFVCL----IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELL 57
           R     L   +    + F +GF++F+  + +     H     IV LTG   RI  A +LL
Sbjct: 26  RRLVLTLAALVGASGLAFGVGFLAFVGCLARTERQPHAPADGIVALTGGAQRIGDAIDLL 85

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
               G ++ I+GV+   S++ + +  P +Q L  CC+D+ Y+A NT GNA E   W  +N
Sbjct: 86  AAGYGRRLLITGVNERTSREEIARLNPGQQHLIACCVDLDYRARNTIGNAIETRRWMREN 145

Query: 118 NFHHVLIVTHDYHMPRTFLELQRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
            F  V +VT +YHMPRT LEL        + +P+P++    + ++        R+L+ EY
Sbjct: 146 GFRTVAVVTSNYHMPRTLLELGHALADGNRVVPHPVVHDGFDPDAWWHHPASARLLVSEY 205

Query: 177 LKILLLSIQLSLSTQTASQFFITLI 201
           +K L+  I+    T         L+
Sbjct: 206 VKFLVAWIRTRFETDPEDSRAAVLM 230


>gi|39937792|ref|NP_950068.1| hypothetical protein RPA4734 [Rhodopseudomonas palustris CGA009]
 gi|39651652|emb|CAE30174.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 255

 Score =  158 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 57/197 (28%), Positives = 96/197 (48%), Gaps = 5/197 (2%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L +  +    GF+ F+  ++        +   IVVLTG   R+  A ELL    G+++ 
Sbjct: 45  VLALGFLVGAGGFVVFLSQLRGAEQKPRHNADGIVVLTGGSSRVSDAVELLAAGYGKRLL 104

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH +     + + +P  +D   CC+D+   A++T  NA E   W ++  F  +++VT
Sbjct: 105 ISGVHRTNGARDISRSVPESRDWFSCCVDLDRSAVDTRSNASETRRWVQERGFRSLIVVT 164

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + +++
Sbjct: 165 SNYHMPRAIAEMSHAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELRV 224

Query: 187 SLSTQTASQFFITLIEE 203
            L     S+  I ++ E
Sbjct: 225 RL-----SKLGIEVMPE 236


>gi|192293574|ref|YP_001994179.1| hypothetical protein Rpal_5216 [Rhodopseudomonas palustris TIE-1]
 gi|192287323|gb|ACF03704.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           TIE-1]
          Length = 241

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 57/197 (28%), Positives = 96/197 (48%), Gaps = 5/197 (2%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L +  +    GF+ F+  ++        +   IVVLTG   R+  A ELL    G+++ 
Sbjct: 31  VLALGFLVGAGGFVVFLSQLRGAEQKPRHNADGIVVLTGGSSRVSDAVELLAAGYGKRLL 90

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH +     + + +P  +D   CC+D+   A++T  NA E   W ++  F  +++VT
Sbjct: 91  ISGVHRTNGARDISRSVPESRDWFSCCVDLDRSAVDTRSNASETRRWVQERGFRSLIVVT 150

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + +++
Sbjct: 151 SNYHMPRAIAEMSHAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELRV 210

Query: 187 SLSTQTASQFFITLIEE 203
            L     S+  I ++ E
Sbjct: 211 RL-----SKLGIEVMPE 222


>gi|209883916|ref|YP_002287773.1| hypothetical protein OCAR_4768 [Oligotropha carboxidovorans OM5]
 gi|209872112|gb|ACI91908.1| protein of unknown function [Oligotropha carboxidovorans OM5]
          Length = 234

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 91/183 (49%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            +   +I F+ GF  F   +    I        IVVLTG   R+  A +LL    G+++ 
Sbjct: 27  FVVSFVIIFLAGFAWFAGQLHSEEIKPERHADGIVVLTGGASRVADALDLLSRGYGKRLL 86

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH +     +L+  P R+ L  CC+D+   A+NT  NA E   W ++  F  +++VT
Sbjct: 87  ISGVHPANGTADILRAQPERETLLSCCVDLDRSAVNTRSNATETRRWVKERGFRSLIVVT 146

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            +YHMPR  +EL      +  I YP++S              +R++ +EY+K L   +++
Sbjct: 147 SNYHMPRASVELSHAMPDIDLIFYPVVSEAWRGEPWWHSAAGIRLVALEYVKYLAAQVRV 206

Query: 187 SLS 189
            L+
Sbjct: 207 RLA 209


>gi|241206553|ref|YP_002977649.1| hypothetical protein Rleg_3867 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860443|gb|ACS58110.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 238

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/185 (37%), Positives = 108/185 (58%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 34  LRWGGFACLLAIALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKG 93

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH + +   + +      DL  CC+DIGY A++T GNA+EAS W     + 
Sbjct: 94  AGKRLLISGVHPTTTPAQIRKMTQGSADLFSCCVDIGYDAIDTIGNAEEASNWIHTKGYR 153

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VLIVT++YHMPR+  EL  ++  ++FI YP+++ DL+  +       +RV+L EY+K+L
Sbjct: 154 SVLIVTNNYHMPRSLAELSYVDPDIEFIAYPVVNSDLKSRNWFTDPNAMRVMLAEYVKVL 213

Query: 181 LLSIQ 185
           L   +
Sbjct: 214 LTGAR 218


>gi|327193562|gb|EGE60452.1| hypothetical protein RHECNPAF_150012 [Rhizobium etli CNPAF512]
          Length = 238

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 106/183 (57%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 36  WGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGAG 95

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      +L  CC+DIG+ AL+T GNA+E S W     +  V
Sbjct: 96  KRLLISGVHPTTTPAQIRKMTQGSANLFSCCVDIGHDALDTIGNAEETSNWIHAKGYRSV 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 156 LVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 215

Query: 183 SIQ 185
             +
Sbjct: 216 GAR 218


>gi|190893641|ref|YP_001980183.1| hypothetical protein RHECIAT_CH0004075 [Rhizobium etli CIAT 652]
 gi|190698920|gb|ACE93005.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 236

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 107/183 (58%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +G  + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  +G
Sbjct: 34  WGGFGCVLAIALLFGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGVG 93

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      +L  CC+DIG+ AL+T GNA+E S W     +  V
Sbjct: 94  KRLLISGVHPTTTPAQIRKMTQGSANLFSCCVDIGHDALDTIGNAEETSNWIHAKGYRSV 153

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 154 LVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 213

Query: 183 SIQ 185
             +
Sbjct: 214 GAR 216


>gi|316936202|ref|YP_004111184.1| hypothetical protein Rpdx1_4910 [Rhodopseudomonas palustris DX-1]
 gi|315603916|gb|ADU46451.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           DX-1]
          Length = 241

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/197 (29%), Positives = 94/197 (47%), Gaps = 5/197 (2%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L +  +    GF++F+  +    +    +   IVVLTG   R+  A ELL    G ++ 
Sbjct: 31  VLALGFVAVAGGFVAFLAQLHSAELQPRRNAEGIVVLTGGSSRVSDAVELLAAGYGRRLL 90

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGVH +     + + +P   D   CC+D+   A++T  NA E   W  +  F  +++VT
Sbjct: 91  ISGVHRTNGARDISRSVPESSDWFSCCVDLDRSAVDTRSNAAETRRWVRERGFRSLIVVT 150

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            +YHMPR   E+      V+ IP+ +I     +         LR+LL EY K L + +++
Sbjct: 151 SNYHMPRAIAEMSDAMPDVELIPFAVIGDKWRDEPWWTSGGTLRLLLSEYAKYLAVELRV 210

Query: 187 SLSTQTASQFFITLIEE 203
            L     S+  I L+ E
Sbjct: 211 RL-----SKLGIELMPE 222


>gi|116254067|ref|YP_769905.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258715|emb|CAK09820.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 236

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 68/185 (36%), Positives = 107/185 (57%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R+  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+  
Sbjct: 32  LRWGGFACLLAIALVFGGFLRFADSVTTLKPPTEPKADAIVVLTGGYQRIDQAVELLQKG 91

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISG H + +   + +      DL  CC+DIGY A++T GNA+EAS W     + 
Sbjct: 92  AGKRLLISGAHPTTTPAQIRKMTQGSADLFSCCVDIGYDAIDTIGNAEEASNWIHAKGYR 151

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            VLIVT++YHMPR+  EL  ++  ++FI YP+++ DL+  +       +RV+L EY+K+L
Sbjct: 152 SVLIVTNNYHMPRSLAELSYVDPDIEFIAYPVVNSDLKSRNWFTDPNAMRVMLAEYVKVL 211

Query: 181 LLSIQ 185
           L   +
Sbjct: 212 LTGAR 216


>gi|92116288|ref|YP_576017.1| hypothetical protein Nham_0669 [Nitrobacter hamburgensis X14]
 gi|91799182|gb|ABE61557.1| protein of unknown function DUF218 [Nitrobacter hamburgensis X14]
          Length = 238

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/198 (30%), Positives = 96/198 (48%), Gaps = 5/198 (2%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A ELL    G+++ ISG
Sbjct: 34  IGFVGAAVGFVGFLSQLRGVETKPASNADGIVVLTGGSSRISDAVELLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W ++  F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDNQRLLTCCVDLDRSAVNTRSNASETRRWVDEQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      +  IP+ +I     E         LR+LL EY K L   +++ L+
Sbjct: 154 HMPRAIVELSYAMPDITLIPFAVIGDKWREEPWWTSGATLRLLLSEYAKYLAAEVRVRLA 213

Query: 190 TQTASQFFITLIEEITVK 207
                   + L  EI  +
Sbjct: 214 -----YLGLELAPEIGDQ 226


>gi|209551150|ref|YP_002283067.1| hypothetical protein Rleg2_3574 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536906|gb|ACI56841.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 238

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 107/183 (58%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 36  WGGFACVLAIALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKGAG 95

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+EAS W   N +  V
Sbjct: 96  KRLLISGVHPTTTPRQIRRMTQGSADLFSCCVDIGHDAIDTIGNAEEASNWIHANGYRSV 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL 
Sbjct: 156 IVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLA 215

Query: 183 SIQ 185
             +
Sbjct: 216 GAR 218


>gi|91975425|ref|YP_568084.1| hypothetical protein RPD_0945 [Rhodopseudomonas palustris BisB5]
 gi|91681881|gb|ABE38183.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB5]
          Length = 241

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 60/206 (29%), Positives = 104/206 (50%), Gaps = 6/206 (2%)

Query: 1   MRYFWYG-LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           +R      L +  +    GF++F+  ++   +  + +   IVVLTG   R+  A ELL +
Sbjct: 24  LRAVIVATLALGFVATAAGFVAFLAQLRGAELKPNRTADGIVVLTGGSSRVSDAVELLAS 83

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             G+++ ISGVH +     + + +P  +D  +CC+D+   A+NT  NA E   WA +  F
Sbjct: 84  GYGKRLLISGVHRTNGASDISRSVPDSKDWLDCCVDLDRSAVNTRSNAAETRRWAHERGF 143

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
           H +++VT +YHMPR  +E+      V+ IP+ +I     +         LR+LL EY K 
Sbjct: 144 HSLIVVTSNYHMPRAIVEMSHAMPDVELIPFAVIGDKWRDEPWWTSGATLRLLLSEYAKY 203

Query: 180 LLLSIQLSLSTQTASQFFITLIEEIT 205
           + +  ++ L+     +  I L  E +
Sbjct: 204 VAVEARVRLA-----RLGIELAPEAS 224


>gi|218531041|ref|YP_002421857.1| hypothetical protein Mchl_3091 [Methylobacterium chloromethanicum
           CM4]
 gi|218523344|gb|ACK83929.1| protein of unknown function DUF218 [Methylobacterium
           chloromethanicum CM4]
          Length = 234

 Score =  154 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 105/202 (51%), Gaps = 1/202 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F     V L+    GF++F+  V++   P    V  IV +TG   R+  A +LL   
Sbjct: 15  LRAFVGLSLVGLLALAGGFLAFVAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEG 74

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGV+   ++D +++  P ++    CC+D+ Y+A NT GNA E   W  +++F 
Sbjct: 75  HGRRLLISGVNERTTRDEIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFG 134

Query: 121 HVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            V++VT +YHMPRT +EL+         IPYP++S  L+ +       + R+L  EYLK 
Sbjct: 135 TVVVVTSNYHMPRTLVELRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKF 194

Query: 180 LLLSIQLSLSTQTASQFFITLI 201
           L+   +    +      F  LI
Sbjct: 195 LVAWGRTRFESDPEQSRFAVLI 216


>gi|15966410|ref|NP_386763.1| hypothetical protein SMc00715 [Sinorhizobium meliloti 1021]
 gi|307300553|ref|ZP_07580333.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
 gi|307318418|ref|ZP_07597853.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|15075681|emb|CAC47236.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896100|gb|EFN26851.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|306904719|gb|EFN35303.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
          Length = 232

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/189 (35%), Positives = 112/189 (59%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  ++ L   L  FI GF+ F   V  +  P  P   AIVVLTG   RI++A +LL+  
Sbjct: 25  LRRGFFVLLAFLTVFIAGFLQFADTVASLQPPATPKADAIVVLTGGFQRIDQAVDLLKLG 84

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH S ++  + +      DL +CC+DIG+ A++T GNA E S W     + 
Sbjct: 85  AGKRLLISGVHPSTTRSQIRRNTQSSADLFKCCVDIGHAAIDTIGNATETSLWIRNRGYR 144

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +L+VT++YHMPR+ LEL+R     +FI YP+++ DL+  + +    +L+ +L+EY K  
Sbjct: 145 TILVVTNNYHMPRSLLELRRARPETEFIAYPVVNSDLKTTNWLRNPLVLKAILLEYGKYS 204

Query: 181 LLSIQLSLS 189
           + +++  + 
Sbjct: 205 VATLRDVMG 213


>gi|150397743|ref|YP_001328210.1| hypothetical protein Smed_2545 [Sinorhizobium medicae WSM419]
 gi|150029258|gb|ABR61375.1| protein of unknown function DUF218 [Sinorhizobium medicae WSM419]
          Length = 232

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 114/202 (56%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  ++ L   L  FI GF+ F   V  +  P  P   AIVVLTG   RI++A +LL+  
Sbjct: 25  LRRSFFVLLAFLAVFIAGFLQFADTVASLQPPPTPKADAIVVLTGGFQRIDQAVDLLKLG 84

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+++ ISGVH S ++  + +      DL +CC+DIG +A++T GNA E S W     + 
Sbjct: 85  AGKRLLISGVHPSTTRSQIRRNTQSSADLFKCCVDIGREAVDTIGNATETSHWIRSRGYR 144

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +L+VT++YHMPR+ LEL+R     +F+ YP+++ DL+  + +    +L+ +L+EY+K  
Sbjct: 145 TILVVTNNYHMPRSLLELRRARPETEFVAYPVVNSDLKTTNWLRNPLVLKAILLEYVKYS 204

Query: 181 LLSIQLSLSTQTASQFFITLIE 202
           + S++  +     +        
Sbjct: 205 VSSLRDVMGAGWTNGLRNEPSP 226


>gi|13473042|ref|NP_104609.1| hypothetical protein mlr3524 [Mesorhizobium loti MAFF303099]
 gi|14023790|dbj|BAB50395.1| mlr3524 [Mesorhizobium loti MAFF303099]
          Length = 241

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/196 (34%), Positives = 108/196 (55%), Gaps = 1/196 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R     L +  + F  GF  F   V  +  P +P    AI+VLTG   R++ A +LL +
Sbjct: 35  LRISALSLLILAVLFAGGFGWFANKVAHLTTPANPEKADAIIVLTGGQSRLDAAMDLLAS 94

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GE++ ISGVH S S+  L       ++L  CC+DI   AL+T GNA+E++ W E + +
Sbjct: 95  GKGERLLISGVHPSASRRQLQAATGGDKNLFSCCVDIDRAALDTIGNAEESAKWVESHAY 154

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             V++VT++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K 
Sbjct: 155 GTVILVTNNYHMPRSLLEMGRLLHGAKLEPYPVVNSNLDNGGWLTKPRALRVLFTEYTKY 214

Query: 180 LLLSIQLSLSTQTASQ 195
           LL   +  +  +    
Sbjct: 215 LLALARGIVPVKPTPD 230


>gi|148252746|ref|YP_001237331.1| hypothetical protein BBta_1178 [Bradyrhizobium sp. BTAi1]
 gi|146404919|gb|ABQ33425.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 221

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 5/197 (2%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L +      +GFI F+  ++   I        IVVLTG   R+  A ELL    G ++ I
Sbjct: 13  LAIGFFVAAVGFIGFLSQLRGAEIKPERKADGIVVLTGGSSRVSDAVELLAGGYGRRLLI 72

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           SGVH +     + + +P  +    CC+D+ Y A+NT  NA +   WA +  F  +++VT 
Sbjct: 73  SGVHPTNEASDITRSLPEARSFINCCVDLDYSAINTRSNAAQTRRWAAERGFKSLIVVTS 132

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +YHMPR  +EL     ++  IPY ++     +         LR+LL EY K +    +L 
Sbjct: 133 NYHMPRAIVELSHAMPSLDLIPYAVVGEKWRDEPWWTSGPTLRLLLSEYAKYVAAEARLR 192

Query: 188 LSTQTASQFFITLIEEI 204
           L+        + L  E+
Sbjct: 193 LA-----DLGLDLAPEV 204


>gi|218680941|ref|ZP_03528838.1| hypothetical protein RetlC8_19678 [Rhizobium etli CIAT 894]
          Length = 216

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/183 (36%), Positives = 108/183 (59%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +   + +     GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G
Sbjct: 14  WGGFACVLTMALVFGGFLRFADSVTTLKPPAEPKADAIVVLTGGYQRIDQAVELLQKGAG 73

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGVH + +   + +      DL  CC+DIG+ A++T GNA+EAS W   N +  V
Sbjct: 74  KRLLISGVHPTTTPRQIRRMTQGSADLFSCCVDIGHDAIDTIGNAEEASNWIHANGYRSV 133

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT++YHMPR+  EL  ++  ++FIPYP+++ DL+  +       +RV+L EY+K+LL 
Sbjct: 134 IVVTNNYHMPRSLAELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYVKVLLA 193

Query: 183 SIQ 185
             +
Sbjct: 194 GAR 196


>gi|304394191|ref|ZP_07376114.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303293631|gb|EFL88008.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 241

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 60/203 (29%), Positives = 101/203 (49%), Gaps = 3/203 (1%)

Query: 2   RYFWYGLFVCLIFFIMGFISF---IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLE 58
           R F   LF+ +   + GF+ F   +   +Q+     P+  A+VVLTG   RI    +L+ 
Sbjct: 37  RLFLVLLFIGVGLLVGGFLKFSDGVTSTEQLEAARVPAADAVVVLTGGSARIAEGLDLIA 96

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G+++ ISGV+   S   L         L +CC+D+   AL+T GNA+E + W     
Sbjct: 97  AGKGKRLLISGVNEDTSVAALKAINTNHAPLFDCCVDVERAALDTIGNARETAKWVADKG 156

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  +++VT  YHMPR+ LE +R    +   P+ +I   L         + LR L++EY+K
Sbjct: 157 YSSLIVVTSSYHMPRSLLEFRRTMPKLNIKPHAVILEPLAREGWWKNPETLRFLVVEYVK 216

Query: 179 ILLLSIQLSLSTQTASQFFITLI 201
            +  +++  L  QT S    +++
Sbjct: 217 YVGAAMREYLKPQTISALRGSML 239


>gi|118591370|ref|ZP_01548768.1| hypothetical protein SIAM614_27023 [Stappia aggregata IAM 12614]
 gi|118436042|gb|EAV42685.1| hypothetical protein SIAM614_27023 [Stappia aggregata IAM 12614]
          Length = 241

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 61/189 (32%), Positives = 95/189 (50%), Gaps = 1/189 (0%)

Query: 1   MRYFWYGLFVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           +R  +  +   L+    G F  F + V    +P   +  AIVVLTG   R+  A  LLE 
Sbjct: 49  LRVLFVAVVTALLAGTAGQFAMFAQKVANARVPATANADAIVVLTGGHARVNEAVRLLEE 108

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
               ++ ISGVH   +++ L         L    +D+   ALNT GNA E + W  KN F
Sbjct: 109 GRANRLLISGVHPGTTREQLAAVTASNMPLETNSVDLDRVALNTAGNAVETANWVRKNGF 168

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             +L+VT  YH+PR  +EL      V  I YP+ S DL+ +    +   +R+L+ EY+K 
Sbjct: 169 SSLLVVTSAYHLPRAKVELAGALPDVSLIAYPVFSKDLKLDHWYREPATMRLLMREYVKY 228

Query: 180 LLLSIQLSL 188
           +L  +++++
Sbjct: 229 ILARLRITV 237


>gi|146343248|ref|YP_001208296.1| hypothetical protein BRADO6468 [Bradyrhizobium sp. ORS278]
 gi|146196054|emb|CAL80081.1| conserved hypothetical protein; putative exported protein
           [Bradyrhizobium sp. ORS278]
          Length = 221

 Score =  151 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 58/200 (29%), Positives = 92/200 (46%), Gaps = 5/200 (2%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
               L +      +GF+ F+  ++   I        IVVLTG   R+  A ELL    G 
Sbjct: 9   LVATLGLGFFIAAVGFVGFLSQLRGAEIKPERKADGIVVLTGGSSRVSDAVELLAGGYGR 68

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ISGVH +   + + + +P  +    CC+D+ Y A+NT  NA +   WA +  F  ++
Sbjct: 69  RLLISGVHPTNDANDITRSLPEARSFINCCVDLDYSAINTRSNAAQTRRWAAERGFKSLV 128

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT +YHMPR   EL     ++  IPY ++     +         LR+LL EY K +   
Sbjct: 129 VVTSNYHMPRAIAELSHAMPSMDLIPYAVVGEKWRDEPWWTSGPTLRLLLSEYAKYVAAE 188

Query: 184 IQLSLSTQTASQFFITLIEE 203
            +L L+        + L  E
Sbjct: 189 ARLRLA-----DLGLDLAPE 203


>gi|75674776|ref|YP_317197.1| hypothetical protein Nwi_0578 [Nitrobacter winogradskyi Nb-255]
 gi|74419646|gb|ABA03845.1| Protein of unknown function DUF218 [Nitrobacter winogradskyi
           Nb-255]
          Length = 241

 Score =  151 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 59/194 (30%), Positives = 93/194 (47%), Gaps = 3/194 (1%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A +LL    G+++ ISG
Sbjct: 34  IAFVGAAVGFVGFLSQLRGVETKPAANADGIVVLTGGSSRISDAVDLLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W +   F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDSQRLLTCCVDLDRSAVNTRSNASETRRWVDGQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      V  IP+ +I     E         LR+LL EY+K L    ++ L+
Sbjct: 154 HMPRAIVELSHAMPDVTLIPFAVIGEKWREEPWWTSGATLRLLLSEYVKYLAAEARVRLA 213

Query: 190 TQTASQFFITLIEE 203
                   + L  E
Sbjct: 214 HLGLD---LELPPE 224


>gi|260466676|ref|ZP_05812863.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029539|gb|EEW30828.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
          Length = 241

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/196 (34%), Positives = 105/196 (53%), Gaps = 1/196 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R     L V    F  GF  F   V  +  P +P    AI+VLTG   R++ A ELL +
Sbjct: 35  IRISALSLLVLATLFAGGFGWFANKVSHLTTPANPTKADAIIVLTGGQSRLDAAMELLAS 94

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GE++ ISGVH S S+  L       + L  CC+DI   AL+T GNA++++ W   + +
Sbjct: 95  GKGERLLISGVHPSASRRQLQAATGGDKKLFSCCVDIDRAALDTIGNAEQSAKWVTNHAY 154

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             V++VT++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K 
Sbjct: 155 GTVILVTNNYHMPRSLLEMGRLLHGARLEPYPVVNSNLDNGGWLTKPRALRVLFTEYTKY 214

Query: 180 LLLSIQLSLSTQTASQ 195
           LL   +  +  +    
Sbjct: 215 LLALARGIVPVKPTPD 230


>gi|27376503|ref|NP_768032.1| hypothetical protein blr1392 [Bradyrhizobium japonicum USDA 110]
 gi|27349644|dbj|BAC46657.1| blr1392 [Bradyrhizobium japonicum USDA 110]
          Length = 234

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 92/188 (48%), Gaps = 5/188 (2%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDIL 79
           I+F+  ++   I        IVVLTG   R+  A ELL    G ++ ISGVH + +   +
Sbjct: 37  IAFLSQLRGAEIAPDRKADGIVVLTGGSSRVSDAMELLAAGYGRRLLISGVHPTSTASDI 96

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
            + +P  Q    CC+D+   AL+T GNA EA  WA+   F  +++VT +YHMPR  +E  
Sbjct: 97  SRTLPENQSFMTCCVDLDRTALSTRGNAAEARRWAQARRFKSLIVVTSNYHMPRALVEFS 156

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFIT 199
                   IP+ ++     E         LR+LL EY+K +   +++ L       F I 
Sbjct: 157 HAMPETILIPFAVVGDKWREEPWWASASTLRLLLSEYVKYIAAEVRVRLE-----DFGID 211

Query: 200 LIEEITVK 207
           L  E++ +
Sbjct: 212 LSPEVSEQ 219


>gi|319781280|ref|YP_004140756.1| hypothetical protein Mesci_1548 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167168|gb|ADV10706.1| protein of unknown function DUF218 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 241

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/196 (34%), Positives = 107/196 (54%), Gaps = 1/196 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLEN 59
           +R     + +    F  GF  F   V  +  P +P    AI+VLTG   R++ A +LL +
Sbjct: 35  LRLSALSVLILATLFAGGFGWFANKVSHLTTPANPARADAIIVLTGGQSRLDAAMDLLAS 94

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
             GE++ ISGVH S S+  L       ++L  CC+DI   AL+T GNA+E++ W E + +
Sbjct: 95  GKGERLLISGVHPSASRRQLQAATGGDKNLFSCCVDIDRAALDTIGNAEESAKWVESHAY 154

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             V++VT++YHMPR+ LE+ R+    +  PYP+++ +L+    + K + LRVL  EY K 
Sbjct: 155 GTVILVTNNYHMPRSLLEMGRLLHGAKLEPYPVVNSNLDNGGWLTKPRALRVLFTEYNKY 214

Query: 180 LLLSIQLSLSTQTASQ 195
           LL   +  +  +    
Sbjct: 215 LLALARGIVPVKPTPN 230


>gi|85713578|ref|ZP_01044568.1| hypothetical protein NB311A_03539 [Nitrobacter sp. Nb-311A]
 gi|85699482|gb|EAQ37349.1| hypothetical protein NB311A_03539 [Nitrobacter sp. Nb-311A]
          Length = 239

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 60/200 (30%), Positives = 94/200 (47%), Gaps = 7/200 (3%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           +  +   +GF+ F+  ++ +      +   IVVLTG   RI  A ELL    G+++ ISG
Sbjct: 34  IAFVGAGVGFVGFLSQLRGVETKPVNNADGIVVLTGGSSRISDAVELLAGGYGKRLLISG 93

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           VH +     + + +P  Q L  CC+D+   A+NT  NA E   W ++  F  +++VT +Y
Sbjct: 94  VHPTNGVSDISRSLPDSQQLLTCCVDLDRSAVNTRSNASETRRWVDEQGFRSLIVVTSNY 153

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
           HMPR  +EL      V  IP+ +I     E         LR+LL EY+K L    ++ L+
Sbjct: 154 HMPRAIVELSHAMPNVTLIPFAVIGDKWREEPWWTSGTTLRLLLSEYVKYLAAEARVRLA 213

Query: 190 -------TQTASQFFITLIE 202
                   +   Q    L  
Sbjct: 214 YLGLEFFPENGEQPTGALEP 233


>gi|209967333|ref|YP_002300248.1| hypothetical protein RC1_4097 [Rhodospirillum centenum SW]
 gi|209960799|gb|ACJ01436.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 244

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/204 (28%), Positives = 91/204 (44%), Gaps = 1/204 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +   + G     + +  G   F   + +    D     AIVVLTG   R+   FELL   
Sbjct: 33  LHALFGGALTLAVAWFAGLFLFAAGLPRTPPEDDRQTDAIVVLTGGSERLAAGFELLRAH 92

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
              K+FISGV+  V    LL+         ECCI +GY A +TEGNA E + W  +  F 
Sbjct: 93  RARKLFISGVYRGVDVQELLRLSRQAPGDLECCIVLGYAADDTEGNAAETALWVRQEGFR 152

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            + +VT +YHMPR+ +E +R    V  I +P+   ++             +++ EY K L
Sbjct: 153 SLRVVTANYHMPRSLVEFRRALPEVDLIAHPVAPPNVRLEHWWRWPGTASLIVGEYNKFL 212

Query: 181 LLSIQLSLSTQTASQFFITLIEEI 204
           L   + +L    A+     +   +
Sbjct: 213 LAWTR-ALLPVPAATPPADVPPGV 235


>gi|254472459|ref|ZP_05085859.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211958742|gb|EEA93942.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 239

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/191 (34%), Positives = 103/191 (53%), Gaps = 1/191 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERAFELLEN 59
           +R+F+    +C + F  GF+ F+  ++             IVVLTG   RI ++ +LLE 
Sbjct: 41  VRFFFLLFLICSVAFAAGFLWFVEVLQPAVQAVVPKHADGIVVLTGGRDRISQSLDLLET 100

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
              +++ ISGVH S S   + +    R  L +CC+D+  KALNT GNA+E ++W  KN F
Sbjct: 101 GSAKRLLISGVHPSTSAKQIARLNSKRMWLFDCCVDLDRKALNTIGNAEETASWVRKNQF 160

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
           + +L+VT  YHMPR   ELQ         P P+   +L+         I ++LL EY+K 
Sbjct: 161 NSLLVVTSAYHMPRALAELQVRLPEADLYPSPVYHKELDLEHWYESSSITKLLLREYVKY 220

Query: 180 LLLSIQLSLST 190
           +L+ +++ L T
Sbjct: 221 ILVRLRVELDT 231


>gi|86359387|ref|YP_471279.1| hypothetical protein RHE_CH03804 [Rhizobium etli CFN 42]
 gi|86283489|gb|ABC92552.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 191

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 66/170 (38%), Positives = 101/170 (59%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
             GF+ F   V  +  P  P   AIVVLTG   RI++A ELL+   G+++ ISGVH + +
Sbjct: 2   FGGFLRFADSVTTLKPPVEPKADAIVVLTGGYQRIDQAVELLQKGAGKRLLISGVHPTTT 61

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
              + +      DL  CC+DIG+ A++T GNA+E S W     +  VL+VT++YHMPR+ 
Sbjct: 62  PAQIRKMTQGSADLFSCCVDIGHDAIDTIGNAEETSNWIHAKGYRSVLVVTNNYHMPRSL 121

Query: 136 LELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
            EL  ++  ++FIPYP+++ DL+  +       +RV+L EY K+LL   +
Sbjct: 122 AELSYVDPDIEFIPYPVVNSDLKTRNWFTDPNAMRVMLAEYAKVLLTGAR 171


>gi|163759927|ref|ZP_02167011.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
 gi|162282885|gb|EDQ33172.1| putative transmembrane protein [Hoeflea phototrophica DFL-43]
          Length = 220

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 73/200 (36%), Positives = 111/200 (55%), Gaps = 1/200 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLEN 59
           +R    G  + + F ++GF  F   + ++  P     V AIVVLTG   RIE+A  LLE+
Sbjct: 9   LRILTIGAILGVTFVVIGFFRFTDEIAELKAPGTSVDVDAIVVLTGGYQRIEQALALLED 68

Query: 60  QIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
            IG+++ ISGV+ S S   L +    +    +CC+DIGY+AL+T GNA E + W  +NN+
Sbjct: 69  GIGDRLLISGVNPSTSSAALRRATGTQSATFDCCVDIGYQALDTIGNANETADWIRQNNY 128

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             VL+VT++YHMPR+ +EL + +  V F+ YP+   DL+  + +     LR L  EY K 
Sbjct: 129 VRVLVVTNNYHMPRSLMELSQASPDVSFVAYPVTHADLKTEAWLTDPVALRTLFTEYAKY 188

Query: 180 LLLSIQLSLSTQTASQFFIT 199
            L  ++      TA+     
Sbjct: 189 SLARLRNWSGATTATGLRAD 208


>gi|153008321|ref|YP_001369536.1| hypothetical protein Oant_0986 [Ochrobactrum anthropi ATCC 49188]
 gi|151560209|gb|ABS13707.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 302

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 78/210 (37%), Positives = 120/210 (57%), Gaps = 11/210 (5%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERA 53
           MR F         LFV L+ F++GF++F   V  M  P       AI+VLTG   RI+ A
Sbjct: 92  MRMFRRLQPVSIVLFVILLAFLVGFVAFGEKVTSMQPPAIDEPADAIIVLTGGQSRIQAA 151

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
            +LL+++ G+++ ISGVH + ++  L +     Q L +CC+D+   ALNT GNA E+  W
Sbjct: 152 VDLLKDKRGKRLLISGVHPATNEKALQRATHADQSLFDCCVDLDRSALNTIGNATESERW 211

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              NN+  V++VT++YH+PR+ LE+      V+FIPYP+++ D  E+S + +   LRVL 
Sbjct: 212 IRTNNYRRVILVTNNYHIPRSTLEMSYRMKDVEFIPYPVVNGDRREHSWVSEGDTLRVLF 271

Query: 174 IEYLKILLLSIQLS----LSTQTASQFFIT 199
           IEY+K L  ++++       TQT       
Sbjct: 272 IEYVKYLGAAVRVGTTELFGTQTNQSVTTE 301


>gi|222087356|ref|YP_002545893.1| hypothetical protein Arad_4209 [Agrobacterium radiobacter K84]
 gi|221724804|gb|ACM27960.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 240

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/183 (33%), Positives = 100/183 (54%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
           +  +     +     GF+ F   +  +  P  P   AI+VLTG   RI++A ELL    G
Sbjct: 37  WGGFAFVFLVAIVFGGFLHFADSITTLKPPLEPKADAIIVLTGGYQRIDQAVELLRTGAG 96

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++ ISG H + +   + +      +L  CC+DIGY A++T GNA+EA+ W     +  +
Sbjct: 97  NRLLISGAHPTTTPSQIRKLTQSPANLFNCCVDIGYDAIDTIGNAREAAKWIHARGYKSI 156

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           L+VT++YHMPR+  EL+ ++    FIPYP+++ DL+  +       LR ++ EY K+LL 
Sbjct: 157 LVVTNNYHMPRSLAELKYVDPATDFIPYPVVNSDLKTKNWFTDPNALRTMIYEYAKVLLA 216

Query: 183 SIQ 185
             +
Sbjct: 217 GAR 219


>gi|254500805|ref|ZP_05112956.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436876|gb|EEE43555.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 243

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/195 (31%), Positives = 96/195 (49%), Gaps = 6/195 (3%)

Query: 2   RYFWY--GLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFE 55
           R F     L  C+  F++G    F +F   V    +P      AIVVLTG   R+  A  
Sbjct: 47  RRFALRTFLVACVTVFVVGTTIQFANFANRVSTATVPVSTQADAIVVLTGGQERVSEAVR 106

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           LLE     ++ ISGVH   ++  +       + L E  +++   ALNT GNA E + W  
Sbjct: 107 LLEEGHAGRLLISGVHPGTTRKQIAVVTASAKPLEEGSVELDRVALNTAGNATETANWVR 166

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           KN F  +L+VT  YH+PR   EL      V  I YP+ + DL+  +   K   +R+L+ E
Sbjct: 167 KNGFDSLLVVTSAYHLPRATAELSGALPDVTLIGYPVFAKDLQLEAWHTKPATIRLLIRE 226

Query: 176 YLKILLLSIQLSLST 190
           Y+K  +  +++++ +
Sbjct: 227 YVKYTVARLRIAVRS 241


>gi|332716396|ref|YP_004443862.1| hypothetical protein AGROH133_11928 [Agrobacterium sp. H13-3]
 gi|325063081|gb|ADY66771.1| hypothetical protein AGROH133_11928 [Agrobacterium sp. H13-3]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/185 (34%), Positives = 107/185 (57%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R       + L  F  GF+ F   V  M  P+     AI+VLTG   RIE+A  LL + 
Sbjct: 31  IRGLILLCVITLGAFSGGFLWFADSVASMRPPEGAKGDAIIVLTGGYQRIEQAVGLLRDG 90

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           +G+++ ISGV+ + ++  + +      D+  CC+D+GYKA++T GNA EA++W   + + 
Sbjct: 91  VGKRLLISGVNPATTRTQIRKMTQGSSDMFSCCVDMGYKAIDTIGNANEAASWIRDHGYS 150

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +++VT++YHM R+  EL   +   QFI YP+IS DL   +   +  ++R +L EY+K +
Sbjct: 151 SIVVVTNNYHMHRSLHELHNASPQTQFIAYPVISADLARTNWFAEPDVVRTMLYEYMKFV 210

Query: 181 LLSIQ 185
           + + +
Sbjct: 211 IAAGR 215


>gi|170749389|ref|YP_001755649.1| hypothetical protein Mrad2831_2982 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655911|gb|ACB24966.1| protein of unknown function DUF218 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 258

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 91/193 (47%), Gaps = 1/193 (0%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISG 69
           + ++    GF+ F+  + +           IV LTG   RI  A +LL    G ++ I+G
Sbjct: 47  LGMLALFAGFLVFVSALARHERTPTDRADGIVALTGGAQRIGDAIDLLAGGYGRRLLITG 106

Query: 70  VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
           V+   S+D + +  P ++ L  CC+D+ Y+A NT GNA E   W   + F  V +VT +Y
Sbjct: 107 VNERTSRDEIARLNPTQRALIACCVDLDYRARNTIGNAIETRRWMRAHRFSTVAVVTSNY 166

Query: 130 HMPRTFLELQRINSTVQ-FIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
           HMPRT +EL          +P+P+++   + +         R+L  EY+K L+  ++   
Sbjct: 167 HMPRTLVELDHALQDSDRVLPHPVVTEAFDADRWWQNPPAARLLASEYMKFLVSWVRTRF 226

Query: 189 STQTASQFFITLI 201
                      LI
Sbjct: 227 EADPERSRAAILI 239


>gi|170740433|ref|YP_001769088.1| hypothetical protein M446_2193 [Methylobacterium sp. 4-46]
 gi|168194707|gb|ACA16654.1| protein of unknown function DUF218 [Methylobacterium sp. 4-46]
          Length = 245

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 93/184 (50%), Gaps = 1/184 (0%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F+ F+  + +     +     IVVLTG   RI  A +LL    G ++ I+GV+   S+D 
Sbjct: 47  FLVFVGGLARTEQQPYARADGIVVLTGGAQRIGDAIDLLAAGFGRRLLITGVNERTSRDE 106

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + +  P +Q L  CC+D+ Y+A NT GNA E   W  +N F  + +VT +YHMPRT LEL
Sbjct: 107 IARLNPGQQHLISCCVDLDYRARNTIGNAIETRRWMRENGFRTIAVVTSNYHMPRTLLEL 166

Query: 139 QRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFF 197
                S  + +P+P++    + ++        R+L  EY+K L+  ++  +         
Sbjct: 167 DHALTSGDRVVPHPVVHEGFDADAWWHHPASARLLASEYVKFLVAWLRTRIEADPEDSRA 226

Query: 198 ITLI 201
             L+
Sbjct: 227 AVLM 230


>gi|163852283|ref|YP_001640326.1| hypothetical protein Mext_2865 [Methylobacterium extorquens PA1]
 gi|163663888|gb|ABY31255.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 283

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 99/187 (52%), Gaps = 1/187 (0%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
             GF++F+  V++   P    V  IV +TG   R+  A +LL    G ++ ISGV+   +
Sbjct: 79  AGGFLAFVAVVERTDRPSLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLISGVNERTT 138

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           +D +++  P ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +YHMPRT 
Sbjct: 139 RDEIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSNYHMPRTL 198

Query: 136 LELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTAS 194
           +EL+         IPYP++S  L+ +       + R+L  EYLK L+   +    +    
Sbjct: 199 VELRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTRFESDPEQ 258

Query: 195 QFFITLI 201
             F  LI
Sbjct: 259 SRFAVLI 265


>gi|239833000|ref|ZP_04681329.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239825267|gb|EEQ96835.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 302

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 76/206 (36%), Positives = 119/206 (57%), Gaps = 11/206 (5%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERA 53
           MR F         LFV L+ F++GF++F   V  M  P       AI+VLTG   RI+ A
Sbjct: 92  MRMFRRFQPVSIVLFVILLAFLVGFVAFGEKVTSMQPPAIDEPADAIIVLTGGQSRIQAA 151

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+++ G+++ ISGVH S ++ +L +     Q L +CC+D+   ALNT GNA E+  W
Sbjct: 152 VNLLKDKRGKRLLISGVHPSTNEKVLQRATHADQSLFDCCVDLDRSALNTIGNAAESERW 211

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              NN+  V++VT++YH+PR+ LE+  +   V+F+PYP+++ +  E+S + +   LRVL 
Sbjct: 212 IRTNNYRRVILVTNNYHIPRSTLEMSYLMKDVEFVPYPVVNGERREHSWVAEGDTLRVLF 271

Query: 174 IEYLKILLLSIQLS----LSTQTASQ 195
           IEY+K L   +++       TQ    
Sbjct: 272 IEYVKYLGAVVRVGASELFGTQPQQS 297


>gi|158426237|ref|YP_001527529.1| hypothetical protein AZC_4613 [Azorhizobium caulinodans ORS 571]
 gi|158333126|dbj|BAF90611.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS
           571]
          Length = 256

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 101/191 (52%), Gaps = 4/191 (2%)

Query: 1   MRYFWYGLFV----CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFEL 56
           +R     L        + F+ GF+ F   +             IVVLTG   RI    +L
Sbjct: 29  LRRAALSLAFVSGTLALLFVGGFVVFTTAIAPREPAGLKPADGIVVLTGGASRIADGVQL 88

Query: 57  LENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
           L +  G+++ ISGV+ + S+D + + +P  + L +CC+D+G++ALNT GNA EA+ W   
Sbjct: 89  LASGHGQRLLISGVNRATSQDEIRRTLPDNEHLLDCCVDLGHRALNTFGNAIEAAEWTRA 148

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
             F  +++VT  +HMPR  +EL R    V+ + YP+++  ++        + +++LL EY
Sbjct: 149 QGFRSLVVVTSAWHMPRALVELGRALPEVELVAYPVVTDRMQSGGWWTDPQTVKLLLKEY 208

Query: 177 LKILLLSIQLS 187
           LK ++   ++ 
Sbjct: 209 LKYMMAMAKIR 219


>gi|154252045|ref|YP_001412869.1| hypothetical protein Plav_1593 [Parvibaculum lavamentivorans DS-1]
 gi|154155995|gb|ABS63212.1| protein of unknown function DUF218 [Parvibaculum lavamentivorans
           DS-1]
          Length = 208

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 58/183 (31%), Positives = 91/183 (49%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R       +    ++ GF  F   ++++     P    IV LTG P RI  A++LL+  
Sbjct: 16  LRILVGFTALLAAAYVAGFFLFTAELERIPPVRVPVADGIVALTGGPDRITAAYKLLQEG 75

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ I+GVH  VS   L + +P      +CC+D+G+ A NT GNA E + W  + N+ 
Sbjct: 76  KGNRLLITGVHPDVSVASLKEMVPGGSAKFDCCVDLGHMAENTIGNATETAEWVRERNYR 135

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +++VT  YH+PR  LEL R    V+   +P+    L  +         R+L+ EY K L
Sbjct: 136 SIILVTSTYHLPRARLELARAMPDVEISAFPVFQDTLHLDGWWAYPGTTRLLISEYTKYL 195

Query: 181 LLS 183
           L  
Sbjct: 196 LTL 198


>gi|256112323|ref|ZP_05453244.1| hypothetical protein Bmelb3E_06514 [Brucella melitensis bv. 3 str.
           Ether]
          Length = 208

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 72/194 (37%), Positives = 111/194 (57%), Gaps = 4/194 (2%)

Query: 1   MRYF---WYGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERAFEL 56
           MR        LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++    L
Sbjct: 1   MRRLQPVSIILFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAGINL 60

Query: 57  LENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
           L+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W   
Sbjct: 61  LKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERWIRA 120

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
           N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL  EY
Sbjct: 121 NDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLFTEY 180

Query: 177 LKILLLSIQLSLST 190
           +K L   ++L  ++
Sbjct: 181 VKYLGAVVRLGSAS 194


>gi|15891332|ref|NP_357004.1| hypothetical protein Atu3608 [Agrobacterium tumefaciens str. C58]
 gi|15159715|gb|AAK89789.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 243

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/182 (35%), Positives = 106/182 (58%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
                 + L  F  GF+ F   V  M  P+     AI+VLTG   RIE+A  LL + +G+
Sbjct: 34  LILVCVIALGAFSGGFLWFADSVASMRPPEGARGDAIIVLTGGYQRIEQAVGLLRDGVGK 93

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ISGV+ + ++  + +      D+  CC+D+GYKA++T GNA EA++W   +N+  ++
Sbjct: 94  RLLISGVNPATTRSQIRKMTQGSSDMFTCCVDMGYKAIDTIGNANEAASWIRDHNYSSIV 153

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT++YHM R+  EL+  +   +FI YP+IS DL   +   +  ++R LL EYLK +  +
Sbjct: 154 VVTNNYHMHRSLHELRNASPQTEFIAYPVISADLVRTNWFVEPDVVRTLLYEYLKFVAAA 213

Query: 184 IQ 185
            +
Sbjct: 214 GR 215


>gi|240139618|ref|YP_002964094.1| hypothetical protein MexAM1_META1p3069 [Methylobacterium extorquens
           AM1]
 gi|240009591|gb|ACS40817.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 234

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 105/202 (51%), Gaps = 1/202 (0%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F     V L+    GF++F+  V++   P    V  IV +TG   R+  A +LL   
Sbjct: 15  LRAFVGLSLVGLLVLAGGFLAFVAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEG 74

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G ++ ISGV+   ++D +++  P ++    CC+D+ Y+A NT GNA E   W  +++F 
Sbjct: 75  HGRRLLISGVNERTTRDEIVRLNPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFG 134

Query: 121 HVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            V++VT +YHMPRT +EL+         IPYP++S  L+ +       + R+L  EYLK 
Sbjct: 135 TVVVVTSNYHMPRTLVELRHALKDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKF 194

Query: 180 LLLSIQLSLSTQTASQFFITLI 201
           L+   +    +      F  LI
Sbjct: 195 LVAWGRTRFESDPEQSRFAVLI 216


>gi|23502843|ref|NP_698970.1| hypothetical protein BR1995 [Brucella suis 1330]
 gi|62290842|ref|YP_222635.1| hypothetical protein BruAb1_1970 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700754|ref|YP_415328.1| hypothetical protein BAB1_1995 [Brucella melitensis biovar Abortus
           2308]
 gi|254705003|ref|ZP_05166831.1| hypothetical protein Bsuib36_14000 [Brucella suis bv. 3 str. 686]
 gi|256370397|ref|YP_003107908.1| hypothetical protein BMI_I2019 [Brucella microti CCM 4915]
 gi|294851231|ref|ZP_06791904.1| hypothetical protein BAZG_00130 [Brucella sp. NVSL 07-0026]
 gi|23348869|gb|AAN30885.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196974|gb|AAX75274.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616855|emb|CAJ11951.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|256000560|gb|ACU48959.1| hypothetical protein BMI_I2019 [Brucella microti CCM 4915]
 gi|294819820|gb|EFG36819.1| hypothetical protein BAZG_00130 [Brucella sp. NVSL 07-0026]
 gi|326539710|gb|ADZ87925.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 212

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 72/197 (36%), Positives = 111/197 (56%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 2   MRILRRLQPVSIILFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 61

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 62  INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 121

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 122 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 181

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 182 TEYVKYLGAVVRLGSAS 198


>gi|256059967|ref|ZP_05450151.1| hypothetical protein Bneo5_06389 [Brucella neotomae 5K33]
          Length = 212

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 72/197 (36%), Positives = 110/197 (55%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+  I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 2   MRILRRLQPVSIILFLAFIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 61

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 62  INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 121

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 122 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 181

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 182 TEYVKYLGAVVRLGSAS 198


>gi|110635418|ref|YP_675626.1| hypothetical protein Meso_3089 [Mesorhizobium sp. BNC1]
 gi|110286402|gb|ABG64461.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 218

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/195 (33%), Positives = 103/195 (52%), Gaps = 8/195 (4%)

Query: 2   RYFWYG-------LFVCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERA 53
           R  W G       +F+  + ++ GF  F  +V ++  P +      IVVLTG   RI+  
Sbjct: 5   RRMWVGVRSAAATIFLFFVLYVAGFGIFADHVVRLRAPAELNPADGIVVLTGGQSRIDTG 64

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
            +LL+    +++ ISGV+     D L       + L  CC+DI   ALNT GNAQE++ W
Sbjct: 65  MDLLKAGKAKRLLISGVNPVARVDDLRLATGGDRALFNCCVDIDRAALNTVGNAQESAKW 124

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N +  +++VT++YHMPR+ LE++RI       PYP+++  L++ + I     LRVLL
Sbjct: 125 VSANTYGSIIVVTNNYHMPRSLLEMRRILPNADLQPYPVVNTPLDDGAWISNPDALRVLL 184

Query: 174 IEYLKILLLSIQLSL 188
           IEY K +    +   
Sbjct: 185 IEYTKYIAALARGLF 199


>gi|148559698|ref|YP_001259812.1| hypothetical protein BOV_1921 [Brucella ovis ATCC 25840]
 gi|189025061|ref|YP_001935829.1| hypothetical protein BAbS19_I18730 [Brucella abortus S19]
 gi|237816354|ref|ZP_04595347.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260546109|ref|ZP_05821849.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260562906|ref|ZP_05833392.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567524|ref|ZP_05837994.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|265999274|ref|ZP_06111628.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|297247229|ref|ZP_06930947.1| hypothetical protein BAYG_00126 [Brucella abortus bv. 5 str. B3196]
 gi|148370955|gb|ABQ60934.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|189020633|gb|ACD73355.1| hypothetical protein BAbS19_I18730 [Brucella abortus S19]
 gi|237788421|gb|EEP62636.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260096216|gb|EEW80092.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260152922|gb|EEW88014.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260157042|gb|EEW92122.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|263092990|gb|EEZ17140.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|297174398|gb|EFH33745.1| hypothetical protein BAYG_00126 [Brucella abortus bv. 5 str. B3196]
          Length = 300

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 72/197 (36%), Positives = 111/197 (56%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 90  MRILRRLQPVSIILFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 149

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 150 INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 209

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 210 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 269

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 270 TEYVKYLGAVVRLGSAS 286


>gi|90420238|ref|ZP_01228146.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335572|gb|EAS49322.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 244

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/197 (32%), Positives = 94/197 (47%), Gaps = 1/197 (0%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPIRIERAFELLENQIGEK 64
               +   +   GF+ F   V  +  P    +   IVVLTG  +RI++A +LL+   G +
Sbjct: 44  LVGVLLGGYLAGGFVRFAEEVSLLAKPAPIGAADGIVVLTGGALRIDQAIDLLKEGRGRR 103

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+   S   L +     +DL  CC+D+ Y ALNT GNA+ A  WA +  F  +++
Sbjct: 104 LLISGVNPGTSAATLARMTDTDRDLFACCVDLDYAALNTVGNAEIARNWAREQGFRDLIL 163

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT DYHMPR+  E  RI       PY +   DL     +     LRVLL EY K++   +
Sbjct: 164 VTSDYHMPRSLREFDRIGELRSVTPYAVRRDDLWSAELMPNTAGLRVLLTEYAKLIAARV 223

Query: 185 QLSLSTQTASQFFITLI 201
           +L             L 
Sbjct: 224 RLVFGVAQTDSVATELA 240


>gi|307943505|ref|ZP_07658849.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773135|gb|EFO32352.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 245

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 63/181 (34%), Positives = 92/181 (50%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
            G  V +   +  F SF   V  +  P  P   AIVVLTG   RI +A  LLE    E++
Sbjct: 58  LGFIVVVGLVVGSFASFAERVATIETPRDPRADAIVVLTGGKERISKAMRLLEEGRAERL 117

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ISGVH   S   + Q       L  CC+D+   ALNT GNA E ++W  ++ F  +L+V
Sbjct: 118 LISGVHPGSSARQIAQATSSDLPLFTCCVDLDRAALNTLGNATETASWVAEHEFETLLVV 177

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T  YH+PR  LEL  +      +PYP+ S + +  +       L++L+ EY+K  L  ++
Sbjct: 178 TSAYHLPRAELELAEVLPNAGLLPYPVFSSERDLTAWYSSFDTLKLLMREYVKYTLARLR 237

Query: 186 L 186
           +
Sbjct: 238 I 238


>gi|254718046|ref|ZP_05179857.1| hypothetical protein Bru83_00605 [Brucella sp. 83/13]
          Length = 212

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF  F   V  M  P       AIVVLTG   R++  
Sbjct: 2   MRILRRLQPVSIILFLAVIAFLGGFFVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 61

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 62  INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 121

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 122 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 181

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   +++  ++
Sbjct: 182 TEYVKYLGAVVRVGSAS 198


>gi|261758934|ref|ZP_06002643.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp.
           F5/99]
 gi|261738918|gb|EEY26914.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp.
           F5/99]
          Length = 269

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 59  MRILRRLQPVSIILFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 118

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GN  E+  W
Sbjct: 119 INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNVAESERW 178

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 179 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 238

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 239 TEYVKYLGAVVRLGSAS 255


>gi|17986358|ref|NP_538992.1| hypothetical protein BMEI0074 [Brucella melitensis bv. 1 str. 16M]
 gi|260755671|ref|ZP_05868019.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758896|ref|ZP_05871244.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760620|ref|ZP_05872963.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884697|ref|ZP_05896311.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214946|ref|ZP_05929227.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261217820|ref|ZP_05932101.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261314966|ref|ZP_05954163.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316476|ref|ZP_05955673.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321332|ref|ZP_05960529.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751141|ref|ZP_05994850.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755703|ref|ZP_05999412.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265987548|ref|ZP_06100105.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265992020|ref|ZP_06104577.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993756|ref|ZP_06106313.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17981947|gb|AAL51256.1| hypothetical protein BMEI0074 [Brucella melitensis bv. 1 str. 16M]
 gi|260669214|gb|EEX56154.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671052|gb|EEX57873.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675779|gb|EEX62600.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874225|gb|EEX81294.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916553|gb|EEX83414.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260922909|gb|EEX89477.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294022|gb|EEX97518.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295699|gb|EEX99195.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303992|gb|EEY07489.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740894|gb|EEY28820.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745456|gb|EEY33382.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262764737|gb|EEZ10658.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003086|gb|EEZ15379.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659745|gb|EEZ30006.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 250

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 72/197 (36%), Positives = 111/197 (56%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 40  MRILRRLQPVSIILFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 99

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 100 INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 159

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 160 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 219

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 220 TEYVKYLGAVVRLGSAS 236


>gi|261323939|ref|ZP_05963136.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261299919|gb|EEY03416.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 250

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 72/197 (36%), Positives = 110/197 (55%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+  I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 40  MRILRRLQPVSIILFLAFIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 99

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 100 INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 159

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 160 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 219

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 220 TEYVKYLGAVVRLGSAS 236


>gi|261221047|ref|ZP_05935328.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265997008|ref|ZP_06109565.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260919631|gb|EEX86284.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262551476|gb|EEZ07466.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 254

 Score =  141 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 72/197 (36%), Positives = 111/197 (56%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 44  MRILRRLQPVSIILFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 103

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 104 INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 163

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 164 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 223

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 224 TEYVKYLGAVVRLGSAS 240


>gi|225628192|ref|ZP_03786227.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617017|gb|EEH14064.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 254

 Score =  141 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF+ F   V  M  P       AIVVLTG   R++  
Sbjct: 44  MRILRRLQPVSIILFLAVIAFLGGFLVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 103

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GN  E+  W
Sbjct: 104 INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNVAESERW 163

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 164 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 223

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 224 TEYVKYLGAVVRLGSAS 240


>gi|265982992|ref|ZP_06095727.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264661584|gb|EEZ31845.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 250

 Score =  141 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF  F   V  M  P       AIVVLTG   R++  
Sbjct: 40  MRILRRLQPVSIILFLAVIAFLGGFFVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 99

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 100 INLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 159

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 160 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 219

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   +++  ++
Sbjct: 220 TEYVKYLGAVVRVGSAS 236


>gi|306843432|ref|ZP_07476033.1| Hypothetical protein BIBO1_0084 [Brucella sp. BO1]
 gi|306276123|gb|EFM57823.1| Hypothetical protein BIBO1_0084 [Brucella sp. BO1]
          Length = 250

 Score =  141 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 72/197 (36%), Positives = 110/197 (55%), Gaps = 7/197 (3%)

Query: 1   MRYFW------YGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPIRIERA 53
           MR           LF+ +I F+ GF  F   V  M  P       AIVVLTG   R++  
Sbjct: 40  MRILRRLQPVSIILFLAVIAFLGGFFVFSEKVTGMQPPVLSEPAEAIVVLTGGQSRVKAG 99

Query: 54  FELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALNT GNA E+  W
Sbjct: 100 INLLKERRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALNTVGNAAESERW 159

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S + +   LRVL 
Sbjct: 160 IRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSWVAEGDTLRVLF 219

Query: 174 IEYLKILLLSIQLSLST 190
            EY+K L   ++L  ++
Sbjct: 220 TEYVKYLGAVVRLGSAS 236


>gi|296447118|ref|ZP_06889050.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
 gi|296255387|gb|EFH02482.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
          Length = 232

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 93/189 (49%), Gaps = 3/189 (1%)

Query: 5   WYGLFVCLIF--FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                   +   F+ GFI F   +++           +VVLTG   RI  A ELL     
Sbjct: 22  LLLCLAGFLASGFVAGFIGFALSLERAEPILTVQADGVVVLTGGSDRIHEAAELLARGQA 81

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF-HH 121
            ++ I+GV+ S     + + +P+ + L +CCID+GY+AL+T GNA E   WA+       
Sbjct: 82  RRLLITGVNKSTRGPEIAKLLPVSRQLFDCCIDLGYEALDTAGNAAETREWAKARGIGGS 141

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +++VT +YHMPR  +EL      V+  P+P++S  ++    +    + R++  EY+K L 
Sbjct: 142 LIVVTSNYHMPRALVELSAALPGVELYPFPVVSEHMQVADWLDDASVARLIGGEYVKYLF 201

Query: 182 LSIQLSLST 190
              +  L  
Sbjct: 202 ALARTRLFP 210


>gi|154243978|ref|YP_001414936.1| hypothetical protein Xaut_0020 [Xanthobacter autotrophicus Py2]
 gi|154158063|gb|ABS65279.1| protein of unknown function DUF218 [Xanthobacter autotrophicus Py2]
          Length = 300

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 62/191 (32%), Positives = 102/191 (53%), Gaps = 4/191 (2%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFEL 56
           +R     L +      +     F++F   +            AIVVLTG P RI  A  L
Sbjct: 62  LRRLVVSLVLLTGVAGVAVAAGFLAFTAQIAAREPAAVKPADAIVVLTGGPSRIVDAVGL 121

Query: 57  LENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
           L +  G ++ I+GV+ + S D + + +P  + L  CCID+G+KALNT GNA EA+ WA +
Sbjct: 122 LADGRGRRLLITGVNPTTSMDEMRRALPDGEHLLGCCIDLGHKALNTRGNALEAAEWARE 181

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
             F  +++VT  +HMPR  +EL R    V+ + YP+++   +  S       L++L+ EY
Sbjct: 182 KRFRSLVVVTSSWHMPRAMMELGRALPDVELVSYPVVTTRTQPESWWSDPGTLKLLVKEY 241

Query: 177 LKILLLSIQLS 187
           LK ++ ++++ 
Sbjct: 242 LKFIMATVKIR 252


>gi|329847903|ref|ZP_08262931.1| hypothetical protein ABI_09720 [Asticcacaulis biprosthecum C19]
 gi|328842966|gb|EGF92535.1| hypothetical protein ABI_09720 [Asticcacaulis biprosthecum C19]
          Length = 220

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 63/193 (32%), Positives = 100/193 (51%), Gaps = 4/193 (2%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVK--QMHIPDHPSVSAIVV-LTGEPIRIERAFELL 57
           MR       V ++ +  G + F   V      I       AIVV      +R++    LL
Sbjct: 1   MRSL-IAFLVVVLLWAAGLLVFADRVIESTPAIEPEEPADAIVVLTGASDMRLKEGMRLL 59

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           E + GE++FISGV+  V +  L+      + L ECC+D+GY+A NT  NA+E + WA  +
Sbjct: 60  ERRKGERLFISGVNRDVKRPELMDVTEGSKRLYECCVDLGYQAENTVQNAREIAEWARGH 119

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
           +F  +++VT DYHMPR+ LEL+       FI YP+ + DL         K  R++++EY 
Sbjct: 120 DFDTLIVVTSDYHMPRSLLELKADMPDAHFISYPVPTADLSARDWWKSGKGARLIVLEYC 179

Query: 178 KILLLSIQLSLST 190
           K L +  + ++ +
Sbjct: 180 KYLAILGRDAVLS 192


>gi|144898927|emb|CAM75791.1| Protein of unknown function DUF218 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 202

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 52/193 (26%), Positives = 84/193 (43%), Gaps = 1/193 (0%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                L      +  GF+ F+  V +          AIVVLTG   R+    +LLE  + 
Sbjct: 11  RLGAVLVALAALWSGGFLWFVDEVPRAVDDQTSHTDAIVVLTGGRERLTTGLDLLEAGLS 70

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++FISGV+  V    ++Q +       +  + +GY A +T GNA E + WA ++N   +
Sbjct: 71  QRLFISGVYKGVDLAEIIQ-LGRGHAGLKEAVVLGYAADDTVGNAIETALWATEHNLRSL 129

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
            IVT  YHMPR   E +     +  I +P+    ++            +L  EY K L  
Sbjct: 130 RIVTGAYHMPRALAEFRHALPEITLIAHPVFPDQVKSREWWRWPGTAALLATEYSKYLAA 189

Query: 183 SIQLSLSTQTASQ 195
            I+     + A+ 
Sbjct: 190 IIRHWFLPRKAAP 202


>gi|86747962|ref|YP_484458.1| hypothetical protein RPB_0836 [Rhodopseudomonas palustris HaA2]
 gi|86570990|gb|ABD05547.1| Protein of unknown function DUF218 [Rhodopseudomonas palustris
           HaA2]
          Length = 240

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 53/185 (28%), Positives = 92/185 (49%), Gaps = 5/185 (2%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F +F+  ++        +   IVVLTG   R+  A +LL +  G+++ ISGVH +     
Sbjct: 42  FAAFLLQLRVEESRPSRAADGIVVLTGGSSRVSDAVDLLASGYGKRLLISGVHRTSGASE 101

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + + +P  +D   CC+D+   A NT  NA E   WA +  F  +++VT +YHMPR   E+
Sbjct: 102 ISRSVPDSKDWLGCCVDLDRSAFNTRSNAAETRRWAHERGFRSLIVVTSNYHMPRAIAEM 161

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFI 198
                 ++ IP+ +I     + +       LR+LL EY K + +  ++ L+     +  I
Sbjct: 162 SHAMPDIELIPFSVIGEKWRDEAWWSSGATLRLLLSEYAKYVAVEARVRLA-----RLGI 216

Query: 199 TLIEE 203
            ++ E
Sbjct: 217 DIMPE 221


>gi|114570926|ref|YP_757606.1| hypothetical protein Mmar10_2376 [Maricaulis maris MCS10]
 gi|114341388|gb|ABI66668.1| protein of unknown function DUF218 [Maricaulis maris MCS10]
          Length = 195

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 61/193 (31%), Positives = 104/193 (53%), Gaps = 6/193 (3%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV-SAIVVLTGEPIRIERAFELLENQI 61
           +     FV ++  ++GF ++   V    +P   +   AI+VLTG+  R+    ELL++  
Sbjct: 7   WLRGLCFVVVLASMIGFAAYAGKVTGYDLPATDNTVDAIIVLTGDAGRLSAGGELLQDGR 66

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
              + ISGVH SV+   + ++  +  D   CC+ +G +A +T GNA+EA+A+ + N +  
Sbjct: 67  ASHLMISGVHPSVTTADIRRQTGLGDDAFSCCVTLGREATDTVGNAREAAAYVQANGYDR 126

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           ++IVT DYH+PR+ LE +     V  IPYP+ +           +  LR+ L EY K   
Sbjct: 127 LIIVTSDYHLPRSLLEFRSHMPGVDLIPYPVRTQAP-----WQDVGALRLWLQEYAKYTT 181

Query: 182 LSIQLSLSTQTAS 194
           + ++ SL++QT  
Sbjct: 182 VQLRHSLTSQTED 194


>gi|329890874|ref|ZP_08269217.1| hypothetical protein BDIM_25830 [Brevundimonas diminuta ATCC 11568]
 gi|328846175|gb|EGF95739.1| hypothetical protein BDIM_25830 [Brevundimonas diminuta ATCC 11568]
          Length = 218

 Score =  138 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 95/190 (50%), Gaps = 3/190 (1%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIV-VLTGEPIRIERAFELLE 58
           M++      V L+ ++ G   F   V+     PD     AIV +      R+  A  LLE
Sbjct: 1   MKFLTLIAVVALM-WLTGLFVFAERVRGFTPAPDPARADAIVSLTGPSAERVNAAIRLLE 59

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              G+++ ISGV+  V +  L    P    L  CC+D+G++A NT GNAQE +AWA    
Sbjct: 60  QGKGDRLLISGVNREVRRQELRALTPGSSKLFNCCVDLGFEAENTVGNAQEIAAWARSKG 119

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  +++VT DYHMPR+ LE++     V+  PY + +  L+        +  R + +EY+K
Sbjct: 120 YDDLIVVTSDYHMPRSLLEIRGAAPGVRLTPYAVSTPSLDNAGWWRATETARRMTLEYMK 179

Query: 179 ILLLSIQLSL 188
            L +  +  +
Sbjct: 180 YLAVLGREGM 189


>gi|302384409|ref|YP_003820232.1| hypothetical protein Bresu_3303 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302195037|gb|ADL02609.1| protein of unknown function DUF218 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 208

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 100/205 (48%), Gaps = 3/205 (1%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIV-VLTGEPIRIERAFELLE 58
           M++      V L  +++G  +F   V+ +    +      IV +      R+  A  LLE
Sbjct: 1   MKFLALVGIVGL-IWLVGLFAFADRVRNLTPADEPARADGIVALTGPSAERVNAAVRLLE 59

Query: 59  NQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
              GE++ ISGV+  V +  L +  P    L  CC+D+G++A +T GNAQE +AWA   N
Sbjct: 60  QDKGERVLISGVNREVRRQELRELTPGSNRLFNCCVDLGFEAEDTGGNAQEIAAWAGSKN 119

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           +  +++VT DYHMPR+ LE++     ++  PY + +  L+ +         R + +EY+K
Sbjct: 120 YTSLIVVTSDYHMPRSLLEIRSAAPGLELTPYAVSTPSLDNSRWWRAAVTARRMTLEYMK 179

Query: 179 ILLLSIQLSLSTQTASQFFITLIEE 203
            L +  + ++             EE
Sbjct: 180 YLAVLGREAVHRVVGHDERPETPEE 204


>gi|328541756|ref|YP_004301865.1| hypothetical protein SL003B_0132 [polymorphum gilvum SL003B-26A1]
 gi|326411508|gb|ADZ68571.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 196

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 61/177 (34%), Positives = 102/177 (57%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
            +    + F+ F + V  +  P+  S   IVVLTG   RIERA  LL+ +   ++ ISGV
Sbjct: 12  LVAGLGISFLLFAQSVVSIRAPEEASADGIVVLTGGQDRIERAVGLLQEERARRLLISGV 71

Query: 71  HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
           + + +   ++++      L  CC+D+  KALNT GNA E +AWA  + F  +L+VT  YH
Sbjct: 72  YPATTDRQIVERTSGDLPLFRCCVDLDRKALNTVGNAVETAAWARTHGFSSLLLVTSAYH 131

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           +PR  LEL+ +   ++ +PYP+ + DL  +S   + + +R+LL E++K  L  +++ 
Sbjct: 132 LPRAALELKAVMPELELVPYPVFAEDLMLSSWYRRPQTIRLLLREFVKYTLARLRIG 188


>gi|115526818|ref|YP_783729.1| hypothetical protein RPE_4830 [Rhodopseudomonas palustris BisA53]
 gi|115520765|gb|ABJ08749.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisA53]
          Length = 233

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 84/166 (50%)

Query: 25  YVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIP 84
            ++   +    +   IVVLTG   R+  A ELL +  G+++ ISGVH +     + + +P
Sbjct: 41  QLRGAEVRPGRNADGIVVLTGGSSRVSDAIELLSSGYGKRLLISGVHRTNGVHDISRTVP 100

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST 144
                 +CCID+   A+NT  NA EA  WA +  F  +++VT +YHMPR  +E+      
Sbjct: 101 DSHRWLDCCIDLDRSAINTRSNAAEARRWAHERGFRSLIVVTSNYHMPRAIVEMSHAMPD 160

Query: 145 VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           V+ IP+ ++     +          R+LL EY K L    ++ L++
Sbjct: 161 VELIPFAVVGDKWRDEPWWSSGTTFRLLLSEYAKYLAAETRVRLAS 206


>gi|83594586|ref|YP_428338.1| hypothetical protein Rru_A3256 [Rhodospirillum rubrum ATCC 11170]
 gi|83577500|gb|ABC24051.1| Protein of unknown function DUF218 [Rhodospirillum rubrum ATCC
           11170]
          Length = 226

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 88/200 (44%), Gaps = 1/200 (0%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRY-VKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           R            ++ G   F    +      D  +  AIVVLTG   R+    +LL   
Sbjct: 6   RRLGLLALTAFGLWLAGLALFASTVLPSAIEDDQTTTDAIVVLTGGSERLPVGLDLLARG 65

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           +G K+F+SGV   V+ D L   I    +     + +G+ AL+T GNA+E + W    +F 
Sbjct: 66  LGRKLFLSGVGVEVTLDDLRAAIVDVPENLRSRVVLGHAALDTVGNAEETAHWLATEHFT 125

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            + +VT  YHMPR+ +E +     V+ I +P+    +++          R++  EY K L
Sbjct: 126 SLRLVTAAYHMPRSLVEFRAAMPDVRIIAHPVFPGSVKQQEWWMWKGTARLMAEEYSKFL 185

Query: 181 LLSIQLSLSTQTASQFFITL 200
           +  ++ +LS          L
Sbjct: 186 VAWLRRTLSPVNVEALAAPL 205


>gi|254562029|ref|YP_003069124.1| hypothetical protein METDI3633 [Methylobacterium extorquens DM4]
 gi|254269307|emb|CAX25273.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 234

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 58/180 (32%), Positives = 94/180 (52%), Gaps = 1/180 (0%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQK 82
           +  V++   P    V  IV +TG   R+  A +LL    G ++ ISGV+   ++D +++ 
Sbjct: 37  VAVVERTDRPGLDGVDGIVAMTGGSQRVGDAIDLLAEGHGRRLLISGVNERTTRDEIVRL 96

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
            P ++    CC+D+ Y+A NT GNA E   W  +++F  V++VT +YHMPRT +EL+   
Sbjct: 97  NPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHSFGTVVVVTSNYHMPRTLVELRHAL 156

Query: 143 S-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                 IPYP++S  L+ +       + R+L  EYLK L+   +    +      F  LI
Sbjct: 157 KDGETLIPYPVVSDGLDVSRWWADPAVTRLLGAEYLKFLVAWGRTRFESDPEQSRFAVLI 216


>gi|188582230|ref|YP_001925675.1| hypothetical protein Mpop_2985 [Methylobacterium populi BJ001]
 gi|179345728|gb|ACB81140.1| protein of unknown function DUF218 [Methylobacterium populi BJ001]
          Length = 234

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 91/180 (50%), Gaps = 1/180 (0%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQK 82
           +  V+Q   P    +  IV +TG   R+  A +LL    G+++ ISGV+   ++D +++ 
Sbjct: 37  VAVVEQAERPSLDGIDGIVAMTGGSQRVGDAIDLLAEGHGKRLLISGVNERTTRDEIVRL 96

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN 142
            P ++    CC+D+ Y+A NT GNA E   W  ++ F  + +VT  YHMPRT +EL+   
Sbjct: 97  NPSQEHWITCCVDLDYRARNTIGNAIETRRWMRRHGFTAIAVVTSSYHMPRTLVELRHAL 156

Query: 143 -STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                 IPYP++S  L+         ++R+L  EYLK L+   +           F  LI
Sbjct: 157 RDGETLIPYPVVSDGLDLGRWWADPAVMRLLGAEYLKFLVAWGRTRFEADPEQSRFAVLI 216


>gi|300024263|ref|YP_003756874.1| hypothetical protein Hden_2757 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526084|gb|ADJ24553.1| protein of unknown function DUF218 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 214

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 90/172 (52%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
           + GF+ F   V +  +        IVVLTG  +R+E   +L+     +++ ISGV+  V 
Sbjct: 20  VFGFVLFSVTVTRDDVGGWDKADGIVVLTGGDLRVEAGAKLMNEGRAKRLLISGVNRKVR 79

Query: 76  KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF 135
           ++ + + + +      CC+D+GY+AL+T GNA E   WA  N +  ++IVT  YHMPR+ 
Sbjct: 80  REEMQRLLGLDAKTFNCCVDLGYEALDTVGNADETRTWARNNGYTKLIIVTSRYHMPRSL 139

Query: 136 LELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            EL  +   V  IPYP+      E +        RVL+ EYLK L    +L+
Sbjct: 140 AELALVMPKVTLIPYPVTPRHFPETAWWLHSSTTRVLVSEYLKFLPAVARLA 191


>gi|163793809|ref|ZP_02187783.1| hypothetical protein BAL199_12291 [alpha proteobacterium BAL199]
 gi|159180920|gb|EDP65437.1| hypothetical protein BAL199_12291 [alpha proteobacterium BAL199]
          Length = 231

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 52/206 (25%), Positives = 91/206 (44%), Gaps = 10/206 (4%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                +      + +G + +   +        P+  A+VVLTG   R++    LL     
Sbjct: 22  LITVVVLSLATAWTIGLVRYASRIPTQPTLVEPAA-AVVVLTGGSKRMDAGVALLAKGTA 80

Query: 63  EKIFISGVHHSVSKDILLQKIP-----IRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
             +F+SGV H V    +   IP     + Q   +CC+ +GY A +T GNA+E + WA   
Sbjct: 81  PVLFVSGVDHRVDPARIRDLIPDAGDSLDQATIDCCVVLGYGASDTLGNARETALWARAT 140

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
               +++VT +YHMPR  LE       V+ +PYP+I  D+  ++       L ++  E+ 
Sbjct: 141 ERTSLILVTSNYHMPRARLEFTHALPEVRLVPYPVIPPDVRMDAWWRWPGTLGLVAGEWT 200

Query: 178 KILLLSIQLSLS----TQTASQFFIT 199
           K +   +++ L+    +  A      
Sbjct: 201 KYVFARVRIGLADLVSSAAAPSPGTD 226


>gi|83313543|ref|YP_423807.1| hypothetical protein amb4444 [Magnetospirillum magneticum AMB-1]
 gi|82948384|dbj|BAE53248.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 206

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 80/173 (46%)

Query: 22  FIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQ 81
           F   +            A+VVLTG   R+     LLE   G K+F+SGVH  V    LL+
Sbjct: 31  FAADLAIRVEDQSTVTDAVVVLTGGAERLNSGIALLEAGRGRKLFVSGVHRGVDLPDLLR 90

Query: 82  KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
           +  +  + A CCI +G+ A +T GNA E +AW  +  F  + +VT  YHM R+ LEL+R 
Sbjct: 91  QAHVSPERARCCIVLGHAADDTVGNATETAAWMGREGFSSLRLVTAAYHMRRSLLELRRA 150

Query: 142 NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTAS 194
                 I +P+     + +          +L +EY K L    +  ++ +   
Sbjct: 151 LPDATIIAHPVFPDAFKRDQWWRWPGTAHLLAVEYTKYLAALARPLITPKKTE 203


>gi|295690243|ref|YP_003593936.1| hypothetical protein Cseg_2870 [Caulobacter segnis ATCC 21756]
 gi|295432146|gb|ADG11318.1| protein of unknown function DUF218 [Caulobacter segnis ATCC 21756]
          Length = 205

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 6/203 (2%)

Query: 5   WYGLFVCLIFFIMGFISFIRYV-KQMHIPDHPSVSAIV-VLTGEPIRIERAFELLENQIG 62
              L + L+ + +G ++F   V      P+ P    +V +     +R+E A  LLE   G
Sbjct: 4   LAALLIALMIWGLGLVAFTGRVDLSTPAPEPPEADGVVALTGASSLRLEAATRLLEEGKG 63

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGV+   ++  +       + + +CC+D+G+ A NT GNA E + WA    +  +
Sbjct: 64  KRLLISGVNRETTRADVQSVTKAVKPIYDCCVDLGFTAANTVGNALETAEWARSKGYKSL 123

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT DYHMPR+ LEL      V+  PYP+ + DL  +         R +++EY K L +
Sbjct: 124 IVVTADYHMPRSMLELSAAMPGVKLFPYPVKT-DLNAHRWWKTSISARRMIVEYCKYLAI 182

Query: 183 SIQ---LSLSTQTASQFFITLIE 202
             +   L L  +T        + 
Sbjct: 183 LGREAFLGLGPKTKPAPEAKDVP 205


>gi|16126457|ref|NP_421021.1| hypothetical protein CC_2218 [Caulobacter crescentus CB15]
 gi|221235238|ref|YP_002517674.1| hypothetical protein CCNA_02301 [Caulobacter crescentus NA1000]
 gi|13423723|gb|AAK24189.1| hypothetical protein CC_2218 [Caulobacter crescentus CB15]
 gi|220964410|gb|ACL95766.1| hypothetical protein CCNA_02301 [Caulobacter crescentus NA1000]
          Length = 205

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 100/203 (49%), Gaps = 3/203 (1%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIV-VLTGEPIRIERAFELLENQIG 62
              L + L+ + +G ++F   V Q    P+ P    +V +     +R+E A  LLE+  G
Sbjct: 4   LAALLIALMIWGLGLLAFTGRVDQSTPAPEPPISDGVVALTGASTLRLEAATRLLEDGKG 63

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGV+   ++  +       + + +CC+D+G+ A NT GNA+E + WA    +  +
Sbjct: 64  QRLLISGVNREATRAEIQAVTKAVKPIYDCCVDLGFAAANTVGNARETAEWARSKGYKSL 123

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           ++VT DYHMPR+ LEL+     V   PYP+ + DL            R +++EY K L +
Sbjct: 124 IVVTADYHMPRSMLELRAAMPNVVLHPYPVKT-DLNARRWWKTGVSARRMIVEYCKYLAI 182

Query: 183 SIQLSLSTQTASQFFITLIEEIT 205
             + +              +E++
Sbjct: 183 LGREAFLGLGPEDKAAPAAKEVS 205


>gi|114705471|ref|ZP_01438379.1| hypothetical protein FP2506_11041 [Fulvimarina pelagi HTCC2506]
 gi|114540256|gb|EAU43376.1| hypothetical protein FP2506_11041 [Fulvimarina pelagi HTCC2506]
          Length = 234

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 65/191 (34%), Positives = 103/191 (53%), Gaps = 4/191 (2%)

Query: 2   RYFWYGLFVCLI---FFIMGFISFIRY-VKQMHIPDHPSVSAIVVLTGEPIRIERAFELL 57
           R F     V L+   F +  F+ +         + + P   AIVVLTG   RIERA  LL
Sbjct: 28  RRFAILCLVVLVAGGFIVGSFLRYAETTAAVSRLENVPPADAIVVLTGGANRIERAISLL 87

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +N  G+++ ISGV+ + S   + +      DL ECC+DI   AL+T GNA EA  WA +N
Sbjct: 88  KNGYGKRLLISGVNENTSARAIARATNTDLDLFECCVDIDVAALDTVGNAMEAVRWAAEN 147

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            F  +++VT DYHM R+ +E  R+    +  P  +   +L ++ +I   + L VL++EY 
Sbjct: 148 GFDELILVTSDYHMQRSLIEFDRVGDLDRITPVAVRLDELWQDDTIPTRRGLEVLVMEYA 207

Query: 178 KILLLSIQLSL 188
           K++   ++ ++
Sbjct: 208 KLMAARVRAAI 218


>gi|294085432|ref|YP_003552192.1| hypothetical protein SAR116_1865 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665007|gb|ADE40108.1| protein of unknown function DUF218 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 207

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 51/185 (27%), Positives = 85/185 (45%), Gaps = 5/185 (2%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHP--SVSAIVVLTGEPIRIERAFELLENQIGEK 64
            + + + F +  F  F+  + +             IVV TG   R+     LL +   +K
Sbjct: 23  VICILVAFMLASFQHFVLTLPRGETDFTKLDHTDGIVVTTGGQQRLVEGLNLLVSGTTDK 82

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAE---CCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           + ISGV   V+K +L+Q++ +         CC+++ Y AL+T GNA  A AW + N    
Sbjct: 83  VLISGVGKGVNKAVLVQELNLDDQQVSALFCCVELEYGALDTRGNALAARAWIDLNGLKS 142

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           + +VT +YHMPR  +   R    V    + +  + L+         I+R+L  EY K + 
Sbjct: 143 IRLVTANYHMPRAEIVFSRAIPNVDIHQWAVSPNALDVERWWQDPMIIRLLTREYAKYVA 202

Query: 182 LSIQL 186
             I+L
Sbjct: 203 EIIRL 207


>gi|49476199|ref|YP_034240.1| hypothetical protein BH15440 [Bartonella henselae str. Houston-1]
 gi|49239007|emb|CAF28307.1| hypothetical protein BH15440 [Bartonella henselae str. Houston-1]
          Length = 230

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 67/191 (35%), Positives = 112/191 (58%), Gaps = 6/191 (3%)

Query: 2   RYF---WYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELL 57
           RYF    + L + ++FF  GF+ F    +Q+  P   P   AI+VLTG   RIE   +LL
Sbjct: 42  RYFPPTAFFLLMIVLFFCAGFVVFSEKTEQLTPPSPLPKADAIIVLTGGENRIETGLDLL 101

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +  +G ++ ISGV+ + +    +    I   L  CC+DIG+KA+NT+GNA+E++ W +K+
Sbjct: 102 QQGLGSRLLISGVNTTTTLKRFMHSTHITPQLFACCVDIGHKAINTKGNAEESAVWIKKH 161

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
           ++  V IVTHDYHM R+  EL+ +   + FI YP+      + S + ++  +R+L  +Y+
Sbjct: 162 HYKTVYIVTHDYHMWRSMRELKYLMPDINFIAYPVKKSG--DESIVQQLNQIRILAFQYI 219

Query: 178 KILLLSIQLSL 188
           K + + I+ + 
Sbjct: 220 KTIDVYIRTAF 230


>gi|298293358|ref|YP_003695297.1| hypothetical protein Snov_3404 [Starkeya novella DSM 506]
 gi|296929869|gb|ADH90678.1| protein of unknown function DUF218 [Starkeya novella DSM 506]
          Length = 228

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 94/185 (50%), Gaps = 1/185 (0%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           GF  F+  +K            IVVLTG   RI  A  LL    G ++ I+GVH   +  
Sbjct: 42  GFGLFVAGIKGREAQTARRADGIVVLTGGAERITDATNLLVEGRGTRLLITGVHPDTTLA 101

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            + + +P  ++  ECC+++G  ALNT GNA E + WA ++ F  +L+VT  +HMPR  +E
Sbjct: 102 EIGRTVPATRESLECCVELGRAALNTRGNAIETAQWAREHRFRSLLVVTSAWHMPRALVE 161

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFF 197
           L+R    V+ +PYP++       +    +  +R+L +EY+K +   + +    + ++Q  
Sbjct: 162 LRRALPDVELVPYPVVPKR-GPENWEASLANVRLLFVEYVKFIGAWLGVRSWPELSTQLG 220

Query: 198 ITLIE 202
                
Sbjct: 221 EHARP 225


>gi|315121772|ref|YP_004062261.1| hypothetical protein CKC_00110 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495174|gb|ADR51773.1| hypothetical protein CKC_00110 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 188

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 129/186 (69%), Positives = 160/186 (86%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           MRY WY L  CLIFFI GF+ FI+Y+ Q+ IP +PS++AIVVLTGEP RIE+AFELLEN+
Sbjct: 1   MRYLWYSLAACLIFFIGGFVLFIQYIVQIPIPANPSINAIVVLTGEPNRIEKAFELLENK 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           IG+++FISGVHHSVSKDILLQKIPIR+DLAECC+DIGYKALNT GNA+EA  W  K+++H
Sbjct: 61  IGQRVFISGVHHSVSKDILLQKIPIRKDLAECCVDIGYKALNTAGNAKEALEWIRKHDYH 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           HVLI+THDYH+PR  LEL R NS  +F+PYPII+HDL++N+ I  +K+LR+  IEYLKIL
Sbjct: 121 HVLIITHDYHIPRILLELNRKNSMTKFVPYPIITHDLQKNTLILYMKMLRMTFIEYLKIL 180

Query: 181 LLSIQL 186
           LLS+Q+
Sbjct: 181 LLSLQI 186


>gi|323136484|ref|ZP_08071566.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
 gi|322398558|gb|EFY01078.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
          Length = 225

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 51/176 (28%), Positives = 97/176 (55%), Gaps = 1/176 (0%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           F+ G+++F   + +          A+V LTG   R+  A + L     +++ I+GV+ + 
Sbjct: 32  FVAGYVAFALSLARQEPILKVEAEAVVALTGGSDRVLDAADFLARGQAKRMLITGVNRAT 91

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF-HHVLIVTHDYHMPR 133
              +L + +P+ +DL  CC+D+GY+A++T GNA+E   WA+  N    +++VT +YHMPR
Sbjct: 92  RSSVLARILPVSRDLFNCCVDLGYQAMDTAGNARETREWAQSRNITRSLIVVTSNYHMPR 151

Query: 134 TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
             +EL      ++  P+P++S  ++       + + R++  EY+K L   ++  LS
Sbjct: 152 ALVELSAALPDIKLYPFPVVSEHVDVADWATDLGVARLVGSEYVKFLGALLRTRLS 207


>gi|167647181|ref|YP_001684844.1| hypothetical protein Caul_3219 [Caulobacter sp. K31]
 gi|167349611|gb|ABZ72346.1| protein of unknown function DUF218 [Caulobacter sp. K31]
          Length = 207

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 96/184 (52%), Gaps = 2/184 (1%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVV-LTGEPIRIERAFELLENQIGEK 64
            L + ++ + +G ++F   V Q     + P    +VV      +R+E A +LLE   G++
Sbjct: 6   ALLIVVMVWFVGLLAFTSRVDQSTPALEPPVSDGVVVLTGASNVRLEVATKLLEAGKGKR 65

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+   S++ +L      + + ECC+D+GY A +T GNA E + WA   ++  +++
Sbjct: 66  LLISGVNREASREDVLGVTKAVRPIYECCVDLGYAAADTIGNASETAEWARAKDYRSLIV 125

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT DYHMPR+ LEL      V   PYP+++  L  +         R + +EY K L +  
Sbjct: 126 VTADYHMPRSMLELHASMPGVTLHPYPVVTESLNAHRWWQGGTSARRMTVEYCKYLAILG 185

Query: 185 QLSL 188
           + + 
Sbjct: 186 REAF 189


>gi|163844017|ref|YP_001628421.1| hypothetical protein BSUIS_A1836 [Brucella suis ATCC 23445]
 gi|163674740|gb|ABY38851.1| protein of unknown function DUF218 [Brucella suis ATCC 23445]
          Length = 177

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 61/161 (37%), Positives = 95/161 (59%)

Query: 30  HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDL 89
                    AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L
Sbjct: 3   PPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSL 62

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             CCID+   ALNT GNA E+  W   NN+H V++VT++YH+PR+ LE+      V+FIP
Sbjct: 63  FACCIDLDRTALNTVGNAAESERWIRANNYHRVIVVTNNYHIPRSILEMSSRMKDVEFIP 122

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           YP+++ +  E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 123 YPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|83859181|ref|ZP_00952702.1| hypothetical protein OA2633_12290 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852628|gb|EAP90481.1| hypothetical protein OA2633_12290 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 191

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 61/189 (32%), Positives = 93/189 (49%), Gaps = 5/189 (2%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           R+     F+ L  F++GF  F+R  +           AIVVLTG P R+  A  LL++  
Sbjct: 7   RFLRLTAFILLTAFVVGFALFVRQARTFTPDASVRGQAIVVLTGGPNRVSTAAALLQDGS 66

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           G ++ ISGV+       +       Q L ECC+D G +A +T GNA E +AWA ++ +  
Sbjct: 67  GRRLLISGVNPDSPPADIAAAAGASQALFECCVDFGLQAADTIGNAAETAAWARQHGYDR 126

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +++VT DYHMPR  LELQ     V+ + Y + +               R  L+EY+K   
Sbjct: 127 IIVVTSDYHMPRALLELQAAMPDVRLVAYGVPAPAP-----WSGGHEARRWLVEYVKYAA 181

Query: 182 LSIQLSLST 190
           +  +  + T
Sbjct: 182 VYGRERVRT 190


>gi|161619913|ref|YP_001593800.1| hypothetical protein BCAN_A2041 [Brucella canis ATCC 23365]
 gi|225853431|ref|YP_002733664.1| hypothetical protein BMEA_A2054 [Brucella melitensis ATCC 23457]
 gi|254690133|ref|ZP_05153387.1| hypothetical protein Babob68_08186 [Brucella abortus bv. 6 str.
           870]
 gi|254694623|ref|ZP_05156451.1| hypothetical protein Babob3T_08184 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696248|ref|ZP_05158076.1| hypothetical protein Babob28_00674 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700633|ref|ZP_05162461.1| hypothetical protein Bsuib55_07228 [Brucella suis bv. 5 str. 513]
 gi|254707480|ref|ZP_05169308.1| hypothetical protein BpinM_11037 [Brucella pinnipedialis
           M163/99/10]
 gi|254708978|ref|ZP_05170789.1| hypothetical protein BpinB_01690 [Brucella pinnipedialis B2/94]
 gi|254713593|ref|ZP_05175404.1| hypothetical protein BcetM6_09616 [Brucella ceti M644/93/1]
 gi|254716053|ref|ZP_05177864.1| hypothetical protein BcetM_06394 [Brucella ceti M13/05/1]
 gi|254731166|ref|ZP_05189744.1| hypothetical protein Babob42_08216 [Brucella abortus bv. 4 str.
           292]
 gi|256030505|ref|ZP_05444119.1| hypothetical protein BpinM2_07627 [Brucella pinnipedialis
           M292/94/1]
 gi|256045596|ref|ZP_05448476.1| hypothetical protein Bmelb1R_13928 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256158491|ref|ZP_05456389.1| hypothetical protein BcetM4_06532 [Brucella ceti M490/95/1]
 gi|256253910|ref|ZP_05459446.1| hypothetical protein BcetB_06374 [Brucella ceti B1/94]
 gi|256258387|ref|ZP_05463923.1| hypothetical protein Babob9C_13798 [Brucella abortus bv. 9 str.
           C68]
 gi|161336724|gb|ABX63029.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|225641796|gb|ACO01710.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|326409995|gb|ADZ67060.1| conserved hypothetical protein [Brucella melitensis M28]
          Length = 177

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 60/161 (37%), Positives = 95/161 (59%)

Query: 30  HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDL 89
                    AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L
Sbjct: 3   PPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSL 62

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             CCID+   ALNT GNA E+  W   N++H V++VT++YH+PR+ LE+      V+FIP
Sbjct: 63  FACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIP 122

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           YP+++ +  E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 123 YPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|260169411|ref|ZP_05756222.1| hypothetical protein BruF5_13857 [Brucella sp. F5/99]
          Length = 177

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/161 (36%), Positives = 94/161 (58%)

Query: 30  HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDL 89
                    AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L
Sbjct: 3   PPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSL 62

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             CCID+   ALNT GN  E+  W   N++H V++VT++YH+PR+ LE+      V+FIP
Sbjct: 63  FACCIDLDRTALNTVGNVAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIP 122

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           YP+++ +  E S + +   LRVL  EY+K L   ++L  ++
Sbjct: 123 YPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRLGSAS 163


>gi|306837606|ref|ZP_07470477.1| Hypothetical protein BROD_0407 [Brucella sp. NF 2653]
 gi|306407313|gb|EFM63521.1| Hypothetical protein BROD_0407 [Brucella sp. NF 2653]
          Length = 177

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/161 (36%), Positives = 95/161 (59%)

Query: 30  HIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDL 89
                    AIVVLTG   R++    LL+ + G+++ ISGVH S +++ L +     + L
Sbjct: 3   PPVLSEPAEAIVVLTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSL 62

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
             CCID+   ALNT GNA E+  W   N++H V++VT++YH+PR+ LE+      V+FIP
Sbjct: 63  FACCIDLDRTALNTVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIP 122

Query: 150 YPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           YP+++ +  E S + +   LRVL  EY+K L   +++  ++
Sbjct: 123 YPVVNGEKREQSWVAEGDTLRVLFTEYVKYLGAVVRVGSAS 163


>gi|315500246|ref|YP_004089049.1| hypothetical protein Astex_3264 [Asticcacaulis excentricus CB 48]
 gi|315418258|gb|ADU14898.1| protein of unknown function DUF218 [Asticcacaulis excentricus CB
           48]
          Length = 214

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 61/197 (30%), Positives = 100/197 (50%), Gaps = 4/197 (2%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA---IVVLTGEPIRIERAFELL 57
           MR     + V    ++ G  +F   V        P  +A   +V+     +RI+    LL
Sbjct: 1   MRRLLAVVLVIG-LWLAGLYAFADRVIHSTPAAEPEEAADAIVVLTGASDMRIKEGMRLL 59

Query: 58  ENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           E + G ++ ISGV+  V ++ LL      + L ECC+D+GY+A  T GNA E + WA+  
Sbjct: 60  ERRKGARMLISGVNREVKREELLPVTEGSKKLYECCVDLGYEAQTTLGNAYEVAEWAKAK 119

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYL 177
            F  +++VT DYH+PR+ LE++     V+   YP+ +  L+        +  RVL++EY 
Sbjct: 120 GFDDLIVVTSDYHVPRSLLEIKAALPGVKLHAYPVATPTLDAREWWKSWRSSRVLIVEYS 179

Query: 178 KILLLSIQLSLSTQTAS 194
           K L +  +   S+ T+S
Sbjct: 180 KYLAILARDIFSSLTSS 196


>gi|49474722|ref|YP_032764.1| hypothetical protein BQ12360 [Bartonella quintana str. Toulouse]
 gi|49240226|emb|CAF26695.1| hypothetical protein BQ12360 [Bartonella quintana str. Toulouse]
          Length = 230

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 67/184 (36%), Positives = 110/184 (59%), Gaps = 3/184 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEK 64
             L + + FF  GF+ F    +Q+  P+  P   AI+VLTG   RIE    LL+ ++G +
Sbjct: 49  LFLLMIVFFFCAGFVIFSEKTEQLKPPNPLPKADAIIVLTGGEKRIETGLNLLQQELGSR 108

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ + +    +    I   L  CC+DIG+KA+NT+GNA+E++ W +K+++  V I
Sbjct: 109 LLISGVNTTTNLKRFMYSTHITPQLFTCCVDIGHKAINTKGNAEESADWIKKHHYQTVYI 168

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VTHDYHM R+  EL+ +   + FI YP+   ++E    I +I  +R+L+ +Y+K L + I
Sbjct: 169 VTHDYHMWRSLRELKYLMPDINFIAYPVKKSEIEST--IQQINQIRILVFQYIKTLEVYI 226

Query: 185 QLSL 188
           + + 
Sbjct: 227 RTAF 230


>gi|163869202|ref|YP_001610454.1| hypothetical protein Btr_2487 [Bartonella tribocorum CIP 105476]
 gi|161018901|emb|CAK02459.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 221

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 69/184 (37%), Positives = 108/184 (58%), Gaps = 3/184 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEK 64
             L V +  F  GFI F    +++  P   P   AI+VLTG   RIE    LL+  +G +
Sbjct: 40  LTLVVIVFIFWGGFIIFSEKTERLVPPTPLPKADAIIVLTGGEHRIETGLHLLQKGLGSR 99

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ S +    +  + I   L  CCIDIG++A+NT GNAQE++AW +K+++  + I
Sbjct: 100 LLISGVNTSTNLKSFMHNMHISPQLISCCIDIGHQAINTRGNAQESAAWIKKHHYKTLYI 159

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VTHDYH+ R+  EL+ +   + FI YP+     +  S+I +IK  R+L+ +Y+K L + I
Sbjct: 160 VTHDYHIWRSMRELKYLMPDIHFIAYPV--KKSKAESTIQQIKQARILIFQYIKTLQVYI 217

Query: 185 QLSL 188
           + + 
Sbjct: 218 RTAF 221


>gi|319409380|emb|CBI83024.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 225

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 65/184 (35%), Positives = 110/184 (59%), Gaps = 3/184 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEK 64
             LF+ ++     F++F   ++ +  P+  P   AI+VLTG   RI+  F+LL+  +G +
Sbjct: 44  LALFITILLIGATFVTFSEKIEHLTPPNPLPQADAIIVLTGGENRIKTGFDLLQKGLGSR 103

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ ++  + L+    I   L    +D GY+A NT+GNA+E++AW +++N+  V I
Sbjct: 104 LLISGVNSTIDLNKLIDATYINPHLLVSRVDFGYEATNTKGNAEESAAWIKQHNYKTVYI 163

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VTHDYHM R+ LEL+ +   + FI YPI  +     S I +I  +R+L+ EY+K + + I
Sbjct: 164 VTHDYHMVRSLLELKYLMPHIDFIAYPIKEN--TTGSWIKQINQMRILVSEYIKNIGVYI 221

Query: 185 QLSL 188
           + + 
Sbjct: 222 RTAF 225


>gi|46206241|ref|ZP_00047534.2| COG1434: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 178

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 54/160 (33%), Positives = 84/160 (52%), Gaps = 1/160 (0%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           +TG   RI  A +LL    G+++ ISGV+   +++ +++  P ++    CC+D+ Y+A N
Sbjct: 1   MTGGAQRIGDAIDLLAGGRGKRLLISGVNERTTREEIIRLNPAQEQWISCCVDLDYRARN 60

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENS 161
           T GNA E   W  ++ F  V +VT  YHMPRT +EL+   +     IPYP+++  LE   
Sbjct: 61  TIGNAIETRRWMRRHRFGTVAVVTSSYHMPRTLVELRHALNAGETVIPYPVVTEGLEIER 120

Query: 162 SIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                   R+L  EYLK L+  ++    T      F  LI
Sbjct: 121 WWADPAATRLLGAEYLKFLVAWLRTRFETDPEQSRFAVLI 160


>gi|319404819|emb|CBI78420.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 231

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 64/176 (36%), Positives = 108/176 (61%), Gaps = 3/176 (1%)

Query: 16  IMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
              F++F   V Q+  P   P   AI+VLTG   RIE   +LL+ ++G ++ ISGV+ + 
Sbjct: 57  CFTFVAFTEKVGQLTPPQPLPKADAIIVLTGGKNRIETGLKLLQKKLGSRLLISGVNTTT 116

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
             + L++ + I   L  CC+DI ++A+NT+GNA+E++ W +K+ +  + IVTHDYHM R+
Sbjct: 117 HPNRLIRIMNINPRLFSCCVDIDHQAVNTQGNAKESAHWIKKHRYKTLYIVTHDYHMIRS 176

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            LE + +   V FI YPI  +    ++ I +   +R+L +EY+K + + I++ LS+
Sbjct: 177 LLEFKYLMPDVNFIAYPIKQN--VADNWIKQANQIRLLALEYIKSISVKIRIILSS 230


>gi|319406304|emb|CBI79941.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 226

 Score =  124 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 66/173 (38%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 19  FISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           F++F   V+Q+  P   P V AI+VLTG   RIE   ELL+ ++G ++ ISGV+ ++  +
Sbjct: 55  FVAFTEKVEQLTPPHPLPKVDAIIVLTGGKNRIETGLELLQKKLGSRLLISGVNTTIHPN 114

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            L++++ I   L  CC+DI + A NT+GNA+E++ W  K+ +  + IVTHDYHM R+ LE
Sbjct: 115 KLIRRMNINPRLFACCVDIDHHATNTQGNAKESAHWINKHRYKTLYIVTHDYHMIRSLLE 174

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            + +   + FI YPI  +    +S I +   +R+L +EY+K + + I++ LS+
Sbjct: 175 FKYLMPNINFIAYPIKQN--VTDSWIKQANQIRLLALEYVKNISVKIRIILSS 225


>gi|319899424|ref|YP_004159521.1| hypothetical protein BARCL_1288 [Bartonella clarridgeiae 73]
 gi|319403392|emb|CBI76960.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 225

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 67/171 (39%), Positives = 104/171 (60%), Gaps = 3/171 (1%)

Query: 21  SFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDIL 79
           +F   V +   P     V AI+VLTG   RIE   +LLE   G ++ ISGV  +   + L
Sbjct: 56  AFTEKVGRFTPPHPLQKVDAIIVLTGGKNRIETGLKLLEKGFGSRLLISGVSTTTHPNKL 115

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           ++ + I   L  CCIDIGY+A+NT+GNA+E++ W +K+ +  + IVTHDYHM R+ LE Q
Sbjct: 116 IRMMNINPQLFSCCIDIGYQAINTQGNAKESADWIKKHRYKTLYIVTHDYHMMRSLLEFQ 175

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            +   + FI YPI       +S I +   +R+L++EY+K + + I+++LS+
Sbjct: 176 YLMPNINFIAYPIKQD--VADSWIKEANQIRLLVLEYIKNICVKIRMTLSS 224


>gi|240851278|ref|YP_002972681.1| hypothetical membrane protein [Bartonella grahamii as4aup]
 gi|240268401|gb|ACS51989.1| hypothetical membrane protein [Bartonella grahamii as4aup]
          Length = 229

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 66/184 (35%), Positives = 105/184 (57%), Gaps = 3/184 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEK 64
             L + +  F  GFI F    +++  P   P   AI+VLTG   RIE    LL+  +G +
Sbjct: 48  LTLAIIVFIFWGGFIVFSEKTERLSPPKPLPKADAIIVLTGGENRIETGLHLLQKGLGSR 107

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ + +    +    I   L  CCIDIG++A+NT GNA+E++ W +K++F  + I
Sbjct: 108 LLISGVNTTTNLKGFMHNRHITPRLVSCCIDIGHQAINTRGNAKESATWIKKHHFKTLYI 167

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VTHDYHM R+  EL+ +   + FI YP+        S+I +I  +R+LL +Y+K L + +
Sbjct: 168 VTHDYHMWRSMRELKYLMPDIHFIAYPV--KKSNAESAIQQINQIRILLFQYIKTLQVYL 225

Query: 185 QLSL 188
           + + 
Sbjct: 226 RTAF 229


>gi|288962085|ref|YP_003452380.1| hypothetical protein AZL_d00100 [Azospirillum sp. B510]
 gi|288914351|dbj|BAI75836.1| hypothetical protein AZL_d00100 [Azospirillum sp. B510]
          Length = 213

 Score =  121 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 81/169 (47%), Gaps = 3/169 (1%)

Query: 20  ISFIRYVKQMHI---PDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSK 76
             +   + +             AIVVLTG   R+    ELL     +K+F+SGV+  V  
Sbjct: 36  FWYAADIPRSSPTGAEAERLTDAIVVLTGGRNRLSTGLELLAAGRAKKLFVSGVYDGVEV 95

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             LL+         ECCI +GY A +T GNA E + W     FH + +VT +YHM R+ L
Sbjct: 96  QELLKLSRHSPTEMECCITLGYSADSTIGNAYETADWMHDQGFHSLRLVTANYHMRRSLL 155

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           EL      V  +P+P+++  +  +          +L+ EY K+L++ ++
Sbjct: 156 ELSMAMPDVDLLPHPVVAPTVHLDDWWMWPGTANLLVTEYNKLLVVGLR 204


>gi|58038750|ref|YP_190714.1| hypothetical protein GOX0275 [Gluconobacter oxydans 621H]
 gi|58001164|gb|AAW60058.1| Hypothetical protein GOX0275 [Gluconobacter oxydans 621H]
          Length = 239

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 81/185 (43%), Gaps = 5/185 (2%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           M+            ++ GF  FI+   +  +   P    IV LTG   R++    LL   
Sbjct: 43  MKRLLLTCLALGGLWLAGFAWFIQDASKASV-TAPVCDGIVALTGGEQRVDTGITLLRGG 101

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLA-ECCIDIGYKALNTEGNAQEASAWAEKNNF 119
            G  + ISGV   V+   +L              I +G +A +T GNA E + WA  N+ 
Sbjct: 102 YGHLLLISGVGPHVTLQHILHLQQESLSSPLAERITLGRRATSTIGNAHETAQWARDNHL 161

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
           H +L+VT  YH+ R  LE+ R+   +  +PYP++   L+        + L ++  EY K 
Sbjct: 162 HRLLVVTAGYHIRRAVLEIHRVAPDLALVPYPVVPLALQAP---LSRRTLFLMFREYNKF 218

Query: 180 LLLSI 184
           L   I
Sbjct: 219 LGAEI 223


>gi|319407779|emb|CBI81430.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 233

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 63/171 (36%), Positives = 102/171 (59%), Gaps = 3/171 (1%)

Query: 19  FISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           F++F   V Q   P   P   AI+VLTG   RIE   +LL+ ++G ++ ISGV+     +
Sbjct: 62  FVAFTEKVGQFTPPHPLPKADAIIVLTGGKNRIETGLKLLQKKLGSRLLISGVNTRTHPN 121

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
            L++ + I   L  CC+DI ++A+NT GNA+E++ W +KN +  + IVT DYHM R+ LE
Sbjct: 122 KLIRIMNINPRLFSCCVDIDHQAINTRGNAEESAHWIKKNRYKTLYIVTDDYHMTRSLLE 181

Query: 138 LQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
            + +   + FI YPI       +S I ++  +R+L +EY+K + + I++ L
Sbjct: 182 FKYLMPDINFIAYPIKQD--VADSWIKQVNQIRLLALEYIKNISVKIRIIL 230


>gi|197119576|ref|YP_002140003.1| hypothetical protein Gbem_3208 [Geobacter bemidjiensis Bem]
 gi|197088936|gb|ACH40207.1| YdcF-like protein of unknown function DUF218 [Geobacter
           bemidjiensis Bem]
          Length = 196

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 77/191 (40%), Gaps = 9/191 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           ++  +  + + LI   + F+ F+     +         AIVVLTG   R+E   +L    
Sbjct: 4   LKGLFSLMVLILIVLSVLFVDFVYKTFSL-SQRDVHADAIVVLTGGRGRVEEGVKLYRAG 62

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+ +F+ GV   V K  L Q            + +   + NT  NA  A     K+   
Sbjct: 63  QGKLLFLIGVDPLVKKHELYQ------GAGAENVYLEKTSRNTLENAIYARDMIMKHKVS 116

Query: 121 HVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            + ++T  YHM R+ +  +      V   P+P+ S +L+E          ++L  E+ K 
Sbjct: 117 SIKLITSRYHMKRSTILFRNAFPKDVAIYPHPVDSSNLKEE-WWNHKGSFKLLFSEFYKY 175

Query: 180 LLLSIQLSLST 190
            +L +    + 
Sbjct: 176 CILRVFFLFAP 186


>gi|306842871|ref|ZP_07475508.1| Hypothetical protein BIBO2_2646 [Brucella sp. BO2]
 gi|306286958|gb|EFM58475.1| Hypothetical protein BIBO2_2646 [Brucella sp. BO2]
          Length = 162

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 54/148 (36%), Positives = 91/148 (61%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           +TG   R++    LL+ + G+++ ISGVH S +++ L +     + L  CCID+   ALN
Sbjct: 1   MTGGQSRVKAGINLLKEKRGKRLLISGVHPSTNEEALQRATHADKSLFACCIDLDRTALN 60

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           T GNA E+  W   N++H V++VT++YH+PR+ LE+      V+FIPYP+++ +  E S 
Sbjct: 61  TVGNAAESERWIRANDYHRVIVVTNNYHIPRSILEMSSRMKDVEFIPYPVVNGEKREQSW 120

Query: 163 IFKIKILRVLLIEYLKILLLSIQLSLST 190
           + +   LRVL  EY+K L   +++  ++
Sbjct: 121 VAEGDTLRVLFTEYVKYLGAIVRVGSAS 148


>gi|253699685|ref|YP_003020874.1| hypothetical protein GM21_1055 [Geobacter sp. M21]
 gi|251774535|gb|ACT17116.1| protein of unknown function DUF218 [Geobacter sp. M21]
          Length = 195

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 77/191 (40%), Gaps = 9/191 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           ++  +  + + LI   + F+ F+     +         AIVVLTG   R+E   +L    
Sbjct: 4   LKVLFSLIVLILIVLSVLFVDFVYKTFSL-SQRDVKTDAIVVLTGGRGRVEEGVKLYRGG 62

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G+ +F+ GV   V K  L +            + +   + NT  NA  A     K+   
Sbjct: 63  RGKLLFLIGVDPLVKKHELYR------GAGAENVYLEKTSRNTLENAIYARDMITKHRVS 116

Query: 121 HVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            + ++T  YHM R+ +  +      +   P+P+ S +L+E          ++L  E+ K 
Sbjct: 117 SIKLITSRYHMKRSTILFRNALPKDIAIYPHPVDSSNLKEE-WWNHKGSFKLLFSEFYKY 175

Query: 180 LLLSIQLSLST 190
            +L +    + 
Sbjct: 176 CILRLFFLFAP 186


>gi|304320133|ref|YP_003853776.1| hypothetical protein PB2503_02792 [Parvularcula bermudensis
           HTCC2503]
 gi|303299036|gb|ADM08635.1| hypothetical protein PB2503_02792 [Parvularcula bermudensis
           HTCC2503]
          Length = 194

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 51/195 (26%), Positives = 87/195 (44%), Gaps = 10/195 (5%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP----SVSA----IVVLTGEPIRIER 52
           MR+      +  +    GF  F+  + +           S  A    +++  G   RI+ 
Sbjct: 1   MRFVLKIAALMGLLCAAGFFVFVAALPRSSNEQAALRSLSADARTGMVILTGGAGRRIQH 60

Query: 53  AFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
             +L     G+++ ISG H  V K+ L  +    +D   CC+D+G +A  T GNA EA  
Sbjct: 61  GLDLFAQGYGDRVLISGTHPLVDKEDL--EGLGVRDSLHCCVDLGPRARTTIGNALEARD 118

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
           WA +  +  +L+VT D+H+PR  LEL+ +   +  I   + +      + +      RVL
Sbjct: 119 WARRRGYDTILLVTSDFHLPRALLELEAVAPELTVIGIAVDTRSAPSANWMRSPSAWRVL 178

Query: 173 LIEYLKILLLSIQLS 187
             EY+K +L   +  
Sbjct: 179 AEEYIKYILAWTRHR 193


>gi|197104094|ref|YP_002129471.1| hypothetical protein PHZ_c0628 [Phenylobacterium zucineum HLK1]
 gi|196477514|gb|ACG77042.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 211

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 94/187 (50%), Gaps = 5/187 (2%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTG--EPIRIERAFELLENQIGE 63
              V  + +  G  ++   V+Q       P    IV LTG     RI  A  LLE+  G 
Sbjct: 6   AFLVLALIWFAGLFAYAHRVQQSTPARLPPPADGIVALTGAGSKERIAAAIGLLEDGYGR 65

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ +SGV+   S++ +       + L +CC+D+G+ A +T GNA+E + W E   +  + 
Sbjct: 66  RVLVSGVNPEASREDIRNLSRAVRRLYDCCVDLGFTAADTVGNARETAEWTEAMRYRSLT 125

Query: 124 IVTHDYHMPRTFLELQRINS--TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           IVT DYHMPR  LEL+ +     V+   Y + +  L+ +    + +  R++++EY K L 
Sbjct: 126 IVTADYHMPRAMLELRAVFHGTGVRLSTYAVPTPALKSSHWWRQPRAARLMVVEYCKYLA 185

Query: 182 LSIQLSL 188
           +  + ++
Sbjct: 186 ILGREAV 192


>gi|121602686|ref|YP_988436.1| hypothetical protein BARBAKC583_0098 [Bartonella bacilliformis
           KC583]
 gi|120614863|gb|ABM45464.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 202

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 105/186 (56%), Gaps = 3/186 (1%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIP-DHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
           + L    +     F+ F   V+Q++ P       AI+VLTG   RIE    LL+  +G +
Sbjct: 16  FCLLSLFLIMGTHFVIFSEKVEQLYPPVSLSKADAIIVLTGGERRIETGLRLLKQGLGSR 75

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ISGV+ +     LL+ + I   L ECC+D+GY+A NT+ NA+E++ W +K+++  + I
Sbjct: 76  LLISGVNATFHPKRLLRNMHIDPQLFECCVDLGYQATNTKSNAEESAVWIKKHHYKTLYI 135

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VTHDYH+ R+ LEL+ +   + FI YPI  +  +    + ++  +R+L  EY+K +   I
Sbjct: 136 VTHDYHIARSLLELRYLMPDINFIAYPIKENVTQNK--VKQLNKIRMLASEYIKNIGFQI 193

Query: 185 QLSLST 190
           +    +
Sbjct: 194 RSVFQS 199


>gi|161620495|ref|YP_001594381.1| hypothetical protein BCAN_B0429 [Brucella canis ATCC 23365]
 gi|163844593|ref|YP_001622248.1| hypothetical protein BSUIS_B0427 [Brucella suis ATCC 23445]
 gi|225686235|ref|YP_002734207.1| hypothetical protein BMEA_B0404 [Brucella melitensis ATCC 23457]
 gi|254699682|ref|ZP_05161510.1| hypothetical protein Bsuib55_02296 [Brucella suis bv. 5 str. 513]
 gi|254702819|ref|ZP_05164647.1| hypothetical protein Bsuib36_02539 [Brucella suis bv. 3 str. 686]
 gi|256015209|ref|YP_003105218.1| Bme2 protein [Brucella microti CCM 4915]
 gi|256043322|ref|ZP_05446257.1| hypothetical protein Bmelb1R_02479 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256111677|ref|ZP_05452661.1| hypothetical protein Bmelb3E_03418 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256262633|ref|ZP_05465165.1| Bme2 [Brucella melitensis bv. 2 str. 63/9]
 gi|260564530|ref|ZP_05835015.1| Bme2 protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568269|ref|ZP_05838738.1| Bme2 protein [Brucella suis bv. 4 str. 40]
 gi|261750147|ref|ZP_05993856.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753420|ref|ZP_05997129.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265989745|ref|ZP_06102302.1| Bme2 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993148|ref|ZP_06105705.1| Bme2 [Brucella melitensis bv. 3 str. Ether]
 gi|294853761|ref|ZP_06794433.1| hypothetical protein BAZG_02742 [Brucella sp. NVSL 07-0026]
 gi|297250207|ref|ZP_06933894.1| hypothetical protein BAYG_03205 [Brucella abortus bv. 5 str. B3196]
 gi|5478233|gb|AAD43833.1|AF076290_2 Bme2 [Brucella melitensis]
 gi|161337306|gb|ABX63610.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|163675316|gb|ABY39426.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|225642340|gb|ACO02253.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|255997869|gb|ACU49556.1| Bme2 protein [Brucella microti CCM 4915]
 gi|260152173|gb|EEW87266.1| Bme2 protein [Brucella melitensis bv. 1 str. 16M]
 gi|260154934|gb|EEW90015.1| Bme2 protein [Brucella suis bv. 4 str. 40]
 gi|261739900|gb|EEY27826.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743173|gb|EEY31099.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262764018|gb|EEZ10050.1| Bme2 [Brucella melitensis bv. 3 str. Ether]
 gi|263000414|gb|EEZ13104.1| Bme2 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092418|gb|EEZ16671.1| Bme2 [Brucella melitensis bv. 2 str. 63/9]
 gi|294819416|gb|EFG36416.1| hypothetical protein BAZG_02742 [Brucella sp. NVSL 07-0026]
 gi|297172960|gb|EFH32338.1| hypothetical protein BAYG_03205 [Brucella abortus bv. 5 str. B3196]
 gi|326410585|gb|ADZ67649.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326553876|gb|ADZ88515.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 205

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 70/197 (35%), Gaps = 7/197 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEK 64
              F C I   +  + F + +  +   D      I+V       R  +A +L ++     
Sbjct: 3   LYAFPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPY 61

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           I  +G    +    ++    + + +    I +  ++ +T  NA+ ++    + +    LI
Sbjct: 62  ILATGDGDCLLNKHIM----MAKGVPPSAILVECRSGSTWQNARFSAPLLRRLHAKSALI 117

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+ +H  R     +     + F   P+   D+          ++  ++ EY K+    I
Sbjct: 118 VTNWFHSRRAVASFRTACPQMHFTSSPVADADM-PGGFPGTPPVIEHVVKEYAKLGWYLI 176

Query: 185 QLSLSTQTASQFFITLI 201
              +  Q  +     + 
Sbjct: 177 SGRIRPQNLTDSGPAMA 193


>gi|256059361|ref|ZP_05449563.1| hypothetical protein Bneo5_03263 [Brucella neotomae 5K33]
 gi|261323321|ref|ZP_05962518.1| Bme2 [Brucella neotomae 5K33]
 gi|261299301|gb|EEY02798.1| Bme2 [Brucella neotomae 5K33]
          Length = 205

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 70/197 (35%), Gaps = 7/197 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEK 64
              F C I   +  + F + +  +   D      I+V       R  +A +L ++     
Sbjct: 3   LYAFPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGCSPY 61

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           I  +G    +    ++    + + +    I +  ++ +T  NA+ ++    + +    LI
Sbjct: 62  ILATGDGDCLLNKHIM----MAKGVPPSAILVECRSGSTWQNARFSAPLLRRLHAKSALI 117

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+ +H  R     +     + F   P+   D+          ++  ++ EY K+    I
Sbjct: 118 VTNWFHSRRAVASFRTACPQMHFTSSPVADADM-PGGFPGTPPVIEHVVKEYAKLGWYLI 176

Query: 185 QLSLSTQTASQFFITLI 201
              +  Q  +     + 
Sbjct: 177 SGRIRPQNLTDSGPAMA 193


>gi|148558293|ref|YP_001257412.1| Bme2 protein [Brucella ovis ATCC 25840]
 gi|148369578|gb|ABQ62450.1| Bme2 protein [Brucella ovis ATCC 25840]
          Length = 205

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 71/197 (36%), Gaps = 7/197 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEK 64
              F C I   +  + F + +  +   D      I+V       R  +A +L ++     
Sbjct: 3   LYAFPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPY 61

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           I  +G    +    ++    + + +    I +  ++ +T  NA+ ++    + +    LI
Sbjct: 62  ILATGDGDCLLNKHIM----MAKGVPPSAILVECRSGSTWQNARFSAPLLRRLHAKSALI 117

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+ +H  R     +     + F   P+   D+          +++ ++ EY K+    I
Sbjct: 118 VTNWFHSRRAVASFRTACPQMHFTSSPVADADM-PGGFPGIPPVIKHVVKEYAKLGWYLI 176

Query: 185 QLSLSTQTASQFFITLI 201
              +  Q  +     + 
Sbjct: 177 SGRIRPQNLTDSGPAMA 193


>gi|23500175|ref|NP_699615.1| Bme2 protein [Brucella suis 1330]
 gi|23463775|gb|AAN33620.1| Bme2 protein [Brucella suis 1330]
          Length = 205

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 70/197 (35%), Gaps = 7/197 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEK 64
              F C I   +  + F + +  +   D      I+V       R  +A +L ++     
Sbjct: 3   LYAFPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPY 61

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           I  +G    +    ++    + + +    I +  ++ +T  NA+ ++    + +    LI
Sbjct: 62  ILATGDGDCLLNKHIM----MAKGVPPSAILVECRSGSTWQNARFSAPLLRRLHAKSALI 117

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+ +H  R     +     + F   P+   D+          ++  ++ EY K+    I
Sbjct: 118 VTNWFHSRRAVASFRTACPQMHFTSSPVADADM-PGGFPGTPPVIEHVVKEYAKLGWYLI 176

Query: 185 QLSLSTQTASQFFITLI 201
              +  Q  +     + 
Sbjct: 177 SGRIRPQNLTDSGPAMA 193


>gi|306845690|ref|ZP_07478259.1| Bme2 protein [Brucella sp. BO1]
 gi|306274011|gb|EFM55838.1| Bme2 protein [Brucella sp. BO1]
          Length = 205

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 70/197 (35%), Gaps = 7/197 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEK 64
              F C I   +  + F + +  +   D      I+V       R  +A +L ++     
Sbjct: 3   LYAFPCAILLGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPY 61

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           I  +G    +    ++    I + +    I +  ++ +T  NA+ ++    + +    LI
Sbjct: 62  ILATGDGDCLLNKHIM----IAKGVPPSAILVECRSGSTWQNARFSAPLLRRLHAKSALI 117

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+ +H  R     +     + F   P+   D+          ++  ++ EY K+    I
Sbjct: 118 VTNWFHSRRAVASFRTACPQMHFASSPVADADM-PGGLSGTPPVIEHVVKEYAKLGWYLI 176

Query: 185 QLSLSTQTASQFFITLI 201
              +  Q  +     + 
Sbjct: 177 SGRIRPQNLTDSGPAMA 193


>gi|17989186|ref|NP_541819.1| hypothetical protein BMEII0841 [Brucella melitensis bv. 1 str. 16M]
 gi|17985041|gb|AAL54083.1| hypothetical protein BMEII0841 [Brucella melitensis bv. 1 str. 16M]
          Length = 180

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 61/171 (35%), Gaps = 6/171 (3%)

Query: 32  PDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLA 90
            D      I+V       R  +A +L ++     I  +G    +    ++    + + + 
Sbjct: 3   DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILATGDGDCLLNKHIM----MAKGVP 58

Query: 91  ECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
              I +  ++ +T  NA+ ++    + +    LIVT+ +H  R     +     + F   
Sbjct: 59  PSAILVECRSGSTWQNARFSAPLLRRLHAKSALIVTNWFHSRRAVASFRTACPQMHFTSS 118

Query: 151 PIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
           P+   D+          ++  ++ EY K+    I   +  Q  +     + 
Sbjct: 119 PVADADM-PGGFPGTPPVIEHVVKEYAKLGWYLISGRIRPQNLTDSGPAMA 168


>gi|312116073|ref|YP_004013669.1| hypothetical protein Rvan_3387 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221202|gb|ADP72570.1| protein of unknown function DUF218 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 197

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/193 (26%), Positives = 84/193 (43%), Gaps = 6/193 (3%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
           GF  F   V  M         AIV LTG+  RI  A  LL      ++ ISGVH +    
Sbjct: 3   GFFIFAYSVSIMPSTRLKDADAIVALTGDEERIAAAVRLLSEGKARRLLISGVHKTTRAP 62

Query: 78  ILLQ----KIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR 133
            ++     +      L  CC+D+     NTE NA E + W  K  +  +++VT  YHMPR
Sbjct: 63  QIMSLTTSRGSRSWSLFSCCVDLDNAH-NTEANAAETTNWVRKRGYRSIIVVTSTYHMPR 121

Query: 134 TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTA 193
             +EL +    V+ +PYP+ +  L+        +   VL  EY+K +    +   ++ + 
Sbjct: 122 ALIELHQAMRDVELVPYPVRAPRLD-ERWWRDSRTAWVLWKEYMKYITAMARYGANSISN 180

Query: 194 SQFFITLIEEITV 206
           +   +    ++  
Sbjct: 181 ASARVEHEPQLIN 193


>gi|225628868|ref|ZP_03786902.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|254706062|ref|ZP_05167890.1| hypothetical protein BpinM_03433 [Brucella pinnipedialis
           M163/99/10]
 gi|254712252|ref|ZP_05174063.1| hypothetical protein BcetM6_02514 [Brucella ceti M644/93/1]
 gi|254715323|ref|ZP_05177134.1| hypothetical protein BcetM_02529 [Brucella ceti M13/05/1]
 gi|256029727|ref|ZP_05443341.1| hypothetical protein BpinM2_03558 [Brucella pinnipedialis
           M292/94/1]
 gi|256157879|ref|ZP_05455797.1| hypothetical protein BcetM4_03368 [Brucella ceti M490/95/1]
 gi|256253159|ref|ZP_05458695.1| hypothetical protein BcetB_02424 [Brucella ceti B1/94]
 gi|260167184|ref|ZP_05753995.1| Bme2 protein [Brucella sp. F5/99]
 gi|261217053|ref|ZP_05931334.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220265|ref|ZP_05934546.1| Bme2 [Brucella ceti B1/94]
 gi|261313499|ref|ZP_05952696.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261319923|ref|ZP_05959120.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261756588|ref|ZP_06000297.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265986738|ref|ZP_06099295.1| Bme2 [Brucella pinnipedialis M292/94/1]
 gi|265996388|ref|ZP_06108945.1| Bme2 [Brucella ceti M490/95/1]
 gi|225616714|gb|EEH13762.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260918849|gb|EEX85502.1| Bme2 [Brucella ceti B1/94]
 gi|260922142|gb|EEX88710.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292613|gb|EEX96109.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261302525|gb|EEY06022.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261736572|gb|EEY24568.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|262550685|gb|EEZ06846.1| Bme2 [Brucella ceti M490/95/1]
 gi|264658935|gb|EEZ29196.1| Bme2 [Brucella pinnipedialis M292/94/1]
          Length = 205

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 70/197 (35%), Gaps = 7/197 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEK 64
              F C I   +  + F + +  +   D      I+V       R  +A +L ++     
Sbjct: 3   LYAFPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPY 61

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           I  +G    +    ++    + + +    I +  ++ +T  NA+ ++    + +    LI
Sbjct: 62  ILATGDGDCLLNKHIM----MAKGVPPSAILVECRSGSTWQNARFSAPLLRRLHAKSALI 117

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+ +H  R     +     + F   P+   D+          ++  ++ EY K+    I
Sbjct: 118 VTNWFHSRRAVASFRTACPQMHFTSSPMADADM-PGGFPGTPPVIEHVVKEYAKLGWYLI 176

Query: 185 QLSLSTQTASQFFITLI 201
              +  Q  +     + 
Sbjct: 177 SGRIRPQNLTDSGPAMA 193


>gi|254711639|ref|ZP_05173450.1| hypothetical protein BpinB_15584 [Brucella pinnipedialis B2/94]
 gi|261319263|ref|ZP_05958460.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298486|gb|EEY01983.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 205

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 70/197 (35%), Gaps = 7/197 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEK 64
              F C I   +  + F + +  +   D      I+V       R  +A +L ++     
Sbjct: 3   LYAFPCAILVGLAAMFFSQPLLTLQ-DDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPY 61

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           I  +G    +    ++    + + +    I +  +A +T  NA+ ++    + +    LI
Sbjct: 62  ILATGDGDCLLNKHIM----MAKGVPPSAILVECRAGSTWQNARFSAPLLRRLHAKSALI 117

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+ +H  R     +     + F   P+   D+          ++  ++ EY K+    I
Sbjct: 118 VTNWFHSRRAVASFRTACPQMHFTSSPMADADM-PGGFPGTPPVIEHVVKEYAKLGWYLI 176

Query: 185 QLSLSTQTASQFFITLI 201
              +  Q  +     + 
Sbjct: 177 SGRIRPQNLTDSGPAMA 193


>gi|114326797|ref|YP_743954.1| hypothetical protein GbCGDNIH1_0133 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314971|gb|ABI61031.1| hypothetical protein GbCGDNIH1_0133 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 216

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 57/184 (30%), Positives = 78/184 (42%), Gaps = 6/184 (3%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
           F       L+    GF+ F     Q  +        IVVLTG   R+    +LL    G 
Sbjct: 31  FGLLGGFALLVLSGGFLWFAWQ-SQHVLRAPSHADGIVVLTGGAERVATGLKLLAAGRGS 89

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
            + ISGV    S   L +   I     E  + +GY+A  T GNA E + WA + +   V+
Sbjct: 90  VLLISGVAKGASLGTLARVAGIDPTPLEGRVMLGYEAATTRGNALETADWAHERHLRSVI 149

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT  YHMPR   EL+R    V   P  +             + IL++L  EYLK L   
Sbjct: 150 VVTAGYHMPRALAELRRAMPDVILYPETVHPDQGGSL-----LNILKLLSSEYLKWLGAE 204

Query: 184 IQLS 187
           + LS
Sbjct: 205 LHLS 208


>gi|148265185|ref|YP_001231891.1| hypothetical protein Gura_3157 [Geobacter uraniireducens Rf4]
 gi|146398685|gb|ABQ27318.1| protein of unknown function DUF218 [Geobacter uraniireducens Rf4]
          Length = 199

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 44/191 (23%), Positives = 77/191 (40%), Gaps = 5/191 (2%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           R  +  L + L+   + F+ F      +   D     AIVVL G   RIE    L     
Sbjct: 5   RGIFSLLVISLVVIAVLFVDFTYKTFSLRQRDV-KSDAIVVLAGGRGRIEEGVRLYRENR 63

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
              +F+ GV  +V K  L  +    +  +   + +   + NT  NA  A     ++N   
Sbjct: 64  ARWLFLIGVDPAVRKGELFTERRGER--SGEGVFLENVSRNTLENALYAREMIVRHNVSS 121

Query: 122 VLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           + ++T  YHM R  L  +++    +   P+P+ S +L+E          R+L  E+ K  
Sbjct: 122 IKLITSRYHMKRATLIFRQVLPKDIAIYPHPVDSKNLKEE-WWSHGGSFRLLFSEFYKYC 180

Query: 181 LLSIQLSLSTQ 191
           L  +    ++ 
Sbjct: 181 LFRLFFLFASS 191


>gi|306840763|ref|ZP_07473510.1| Bme2 protein [Brucella sp. BO2]
 gi|306289158|gb|EFM60407.1| Bme2 protein [Brucella sp. BO2]
          Length = 189

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 62/181 (34%), Gaps = 6/181 (3%)

Query: 22  FIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILL 80
           F          D      I+V       R  +A +L ++     I  +G    +    ++
Sbjct: 2   FFSQPLLTLQDDGRPADVIIVPGGDGAPRAAQAAQLWKDGRSPYILATGDGDCLLNKHIM 61

Query: 81  QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQR 140
               + + +    I +  ++ +T  NA+ ++    + +    LIVT+ +H  R     + 
Sbjct: 62  ----MAKGVPPSAILVECRSGSTWQNARFSAPLLRRLHAKSALIVTNWFHSRRAVASFRT 117

Query: 141 INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITL 200
               + F   P+   D+          ++  ++ EY K+    I   +  Q  +     +
Sbjct: 118 ACPQMHFASSPVADADM-PGGFPGTPPVIEHVVKEYAKLGWYLISDRIRPQNLTDSGPAM 176

Query: 201 I 201
            
Sbjct: 177 A 177


>gi|148262062|ref|YP_001236189.1| hypothetical protein Acry_3082 [Acidiphilium cryptum JF-5]
 gi|146403743|gb|ABQ32270.1| protein of unknown function DUF218 [Acidiphilium cryptum JF-5]
          Length = 218

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 85/171 (49%), Gaps = 4/171 (2%)

Query: 18  GFISFIRYV-KQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSK 76
           GF  F+  + ++  I   P    IVVLTG   R++   ELL      ++ ISG  +    
Sbjct: 40  GFAWFLGDIAEERPINPMPHAGGIVVLTGGADRVKAGLELLMAGAAPRLLISGAGNGTYL 99

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
                +  I  +     I +G+ A  T GNA+E +AWA +++   +++VT DYHMPR  L
Sbjct: 100 GDFTARDGIDANAKATDITVGHAAATTRGNARETAAWASRHHIGSLVVVTADYHMPRALL 159

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           EL R    V  IP P+    +       +  +L++L+ E+ K +++ ++L 
Sbjct: 160 ELHRALPGVTLIPEPVRPPAMTNPG---QPHMLKILVTEFCKYIVVRLRLG 207


>gi|326405574|ref|YP_004285656.1| hypothetical protein ACMV_34270 [Acidiphilium multivorum AIU301]
 gi|325052436|dbj|BAJ82774.1| hypothetical protein ACMV_34270 [Acidiphilium multivorum AIU301]
          Length = 218

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 85/171 (49%), Gaps = 4/171 (2%)

Query: 18  GFISFIRYV-KQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSK 76
           GF  F+  + ++  I   P    IVVLTG   R++   ELL      ++ ISG  +    
Sbjct: 40  GFAWFLGDIAEERPINPMPHAGGIVVLTGGADRVKAGLELLMAGAAPRLLISGAGNGTYL 99

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
                +  I  +     I +G+ A  T GNA+E +AWA +++   +++VT DYHMPR  L
Sbjct: 100 GDFTARDGIDANAKATDITVGHAAATTRGNARETAAWASRHHIGSLVVVTADYHMPRALL 159

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           EL R    V  IP P+    +       +  +L++L+ E+ K +++ ++L 
Sbjct: 160 ELHRALPGVTLIPEPVRPPAMTNPG---QPHMLKILVTEFCKYIVVRLRLG 207


>gi|153010699|ref|YP_001371913.1| hypothetical protein Oant_3378 [Ochrobactrum anthropi ATCC 49188]
 gi|151562587|gb|ABS16084.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 206

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 70/189 (37%), Gaps = 7/189 (3%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKI 65
            +  C + F +  + F   V  +   D      IVV     P R   A  L +      I
Sbjct: 5   IILPCAVLFGLVAMFFSEPVLTLQ-DDGGRADVIVVPGGDGPPRAAEAARLWKEGRSPVI 63

Query: 66  FISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
            ++G    +S   ++    +R+ +    I +  ++ +T  NA+ ++    +      LIV
Sbjct: 64  LVTGDGDCLSNKRIM----VRKGVTPSAIFVECQSGSTWQNARFSAPLMREIQARSALIV 119

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T+ YH  R     +     ++FI  PI   D            + +++ EY+K+    I 
Sbjct: 120 TNWYHSRRAIASFRAACPQMRFISSPIGGDDGRP-GFPTTPTDMELVVKEYVKLGWYLIS 178

Query: 186 LSLSTQTAS 194
             +     S
Sbjct: 179 GRIFPHDLS 187


>gi|258542112|ref|YP_003187545.1| hypothetical protein APA01_10160 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633190|dbj|BAH99165.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636247|dbj|BAI02216.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639302|dbj|BAI05264.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642356|dbj|BAI08311.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645411|dbj|BAI11359.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648466|dbj|BAI14407.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651519|dbj|BAI17453.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654510|dbj|BAI20437.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 194

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 59/183 (32%), Positives = 83/183 (45%), Gaps = 6/183 (3%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R  +  + +    F  GF  F+    +      P    IV LTG   RI+ +  LL   
Sbjct: 4   IRLSFRLILLACFAFAGGFGWFVNDALR-PPGYLPHADGIVALTGGAGRIDTSLNLLARN 62

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            GEK+ ISGV    +   LL   P         I +GY+A +T GNA E + W   N+  
Sbjct: 63  QGEKLLISGVDTQTTLGELLP--PTAPPALAERITLGYQARSTIGNATETAVWVADNHIT 120

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            +++VT  YHM R  LEL R    V   PYP++   +E      +   LR+L +EYLK L
Sbjct: 121 SLIVVTASYHMRRALLELSRTLPDVTLYPYPVLPPAMEHP---LRRSSLRLLALEYLKWL 177

Query: 181 LLS 183
              
Sbjct: 178 GAL 180


>gi|254292607|ref|YP_003058630.1| hypothetical protein Hbal_0231 [Hirschia baltica ATCC 49814]
 gi|254041138|gb|ACT57933.1| protein of unknown function DUF218 [Hirschia baltica ATCC 49814]
          Length = 197

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 3/186 (1%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIP--DHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
            L  CL      F+SF     Q+  P  D  +  A++ LTG   RI  A E+ ++Q    
Sbjct: 12  FLVFCLFLIGYDFVSFSYRAAQLATPQFDTSNPHAVIALTGGSNRIAFAAEIAKDQNLPL 71

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
              SGV+     D +     +     ECC  +GYKA  T  N  E + W+ K+ +  ++I
Sbjct: 72  FI-SGVNREAKPDEVAIAAGVDTAFFECCTTLGYKARTTYENGLEVAQWSTKSGYTRLII 130

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT +YHM R  LEL+R    V      + S  ++ ++    ++  + + IE++K  ++  
Sbjct: 131 VTSNYHMERALLELERAMPNVTLTGLAVASPAIKADAWWTDMRSAKRMGIEWVKWRIIKT 190

Query: 185 QLSLST 190
           +    +
Sbjct: 191 RRLFQS 196


>gi|296536740|ref|ZP_06898797.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296262933|gb|EFH09501.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 200

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/185 (25%), Positives = 75/185 (40%), Gaps = 13/185 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
             W    +  I  + GF  F    +            I VLTG P R++    LL     
Sbjct: 14  RLWLLPALLAILVVAGFALFTGQSRARPELPLRQTDGIAVLTGGPQRVDAGLRLLAEGHA 73

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAE---CCIDIGYKALNTEGNAQEASAWAEKNNF 119
             + ISG     + + L ++  +   L E     + +G +A +T GN QE + WAE    
Sbjct: 74  RALIISGTGRDATLEELARRAGLPDPLPEGFAARVTLGREATSTRGNGQEVAEWAEARQI 133

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             + +VT  +HMPR  LEL+R    V  +P+P+ +                +LL EY K 
Sbjct: 134 GSLRVVTAAFHMPRALLELRRTLPGVALVPHPVQAAGPRPG----------LLLREYGKF 183

Query: 180 LLLSI 184
           +   +
Sbjct: 184 IGAML 188


>gi|296283193|ref|ZP_06861191.1| hypothetical protein CbatJ_06211 [Citromicrobium bathyomarinum
           JL354]
          Length = 176

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 84/182 (46%), Gaps = 14/182 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
             W      ++ +++GFI F  ++            A++V TG   RIER  E+++    
Sbjct: 1   MIWRVGLAIVLVWVLGFIWFAGWLPG--PAPMERTDAVIVPTGYAGRIERGLEVVQTDSA 58

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           + + ++GV   V       +  + +D+ ECC+ +G+ A +T GNAQE   WAE +    +
Sbjct: 59  DTLLVTGVDPEVKPGEFAAQFKVPEDVMECCVTLGFAATDTRGNAQETREWAEAHGIKSL 118

Query: 123 LIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +VT D+HM R   EL+R     V+ I   +                L +LLIEY K L+
Sbjct: 119 RLVTSDWHMRRAATELRRQLPGDVKLIKDAV-----------RSEPSLWLLLIEYHKWLV 167

Query: 182 LS 183
             
Sbjct: 168 SR 169


>gi|78223525|ref|YP_385272.1| hypothetical protein Gmet_2322 [Geobacter metallireducens GS-15]
 gi|78194780|gb|ABB32547.1| protein of unknown function DUF218 [Geobacter metallireducens
           GS-15]
          Length = 200

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/195 (23%), Positives = 80/195 (41%), Gaps = 9/195 (4%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFEL 56
           M  F+ GLF  L+ F++     F+ F      +   D     AIVVL G   R+E    L
Sbjct: 1   MALFFRGLFSLLVIFLVVATVLFVDFAYKTFSVRQRDIA-TDAIVVLAGGRGRVEEGIRL 59

Query: 57  LENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
              + G+ +F+ GV   V K  L Q+   + +     + +   + NT  NA       ++
Sbjct: 60  FRAKKGKYLFLIGVDPMVRKQELFQE--RKGESLADRVVLENASRNTLENALYGREIIDR 117

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            +   + ++T  YHM R  L  +      +   P+P+ + +L+  +        R+L  E
Sbjct: 118 KDIRSISLITSRYHMKRATLIFRSTLPRDIAIYPHPVDTINLK-EAWWRDQGSFRLLFSE 176

Query: 176 YLKILLLSIQLSLST 190
           + K  L       ++
Sbjct: 177 FYKYCLFRFFFLFAS 191


>gi|239833683|ref|ZP_04682011.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239821746|gb|EEQ93315.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 206

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 69/191 (36%), Gaps = 7/191 (3%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGE 63
              +  C I F +  + F + V  +   D      IVV     P R  +A  L +     
Sbjct: 3   LLVVLPCAILFGIAAMFFSQPVLTLQ-DDGGRADVIVVPGGDGPPRAAQAARLWKEGRSP 61

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
            I ++G    +    ++    +R  +    I +  ++ +T  NAQ ++    +      L
Sbjct: 62  VILVTGDGDCLYNKRIM----VRNGVNPSAIFVECQSGSTWQNAQFSAPVLREIRARSAL 117

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT+ YH  R     +     ++FI  PI   D            + ++  EY+K+    
Sbjct: 118 VVTNWYHSRRAIASFRAACPQMRFISSPIGGDDGRP-GFPATPADMELVAKEYVKLGWYL 176

Query: 184 IQLSLSTQTAS 194
           +   +     S
Sbjct: 177 VSGRIFPHDLS 187


>gi|295703757|ref|YP_003596832.1| hypothetical protein BMD_1626 [Bacillus megaterium DSM 319]
 gi|294801416|gb|ADF38482.1| conserved hypothetical protein [Bacillus megaterium DSM 319]
          Length = 198

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 61/184 (33%), Gaps = 10/184 (5%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           +     +F+  +  I  F  F    + +          I+VL+G+  R+E+  EL +   
Sbjct: 7   KRIKISIFMLGLGII--FFLFAGK-ELVVNEKPVKSDVIIVLSGDNDRLEKGIELYKKGY 63

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
              + +S    +               + E  I +   A +T  NA+         +F  
Sbjct: 64  ASHLILSNGQENNFYHQ-----AKESGIPEDSIILENHATSTTENAKFTKRLMMNYHFQS 118

Query: 122 VLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            ++V+ +YHM R      +      +Q       S               +V   EY+K+
Sbjct: 119 AIVVSSNYHMKRVEKNFNKEFKDTQIQLTYCSSGSRYYNPQRWWETALNRKVTYTEYVKL 178

Query: 180 LLLS 183
           +   
Sbjct: 179 IGNY 182


>gi|294498420|ref|YP_003562120.1| hypothetical protein BMQ_1655 [Bacillus megaterium QM B1551]
 gi|294348357|gb|ADE68686.1| conserved hypothetical protein [Bacillus megaterium QM B1551]
          Length = 198

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 61/184 (33%), Gaps = 10/184 (5%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           +     +F+  +  I  F  F    + +          I+VL+G+  R+E+  EL +   
Sbjct: 7   KRIKISIFMLGLGII--FFLFAGK-ELVVNEKPVKSDVIIVLSGDNDRLEKGIELYKKGY 63

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
              + +S    +               + E  I +   A +T  NA+         +F  
Sbjct: 64  AAHLILSNGQENNFYHQ-----AKESGIPEDSIILENHATSTTENAKFTKRLMMNYHFQS 118

Query: 122 VLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            ++V+ +YHM R      +      +Q       S               +V   EY+K+
Sbjct: 119 AIVVSSNYHMKRAEKNFNKEFKDTQIQLTYCSSGSRYYNPQRWWETALNRKVTYTEYVKL 178

Query: 180 LLLS 183
           +   
Sbjct: 179 IGNY 182


>gi|222055241|ref|YP_002537603.1| protein of unknown function DUF218 [Geobacter sp. FRC-32]
 gi|221564530|gb|ACM20502.1| protein of unknown function DUF218 [Geobacter sp. FRC-32]
          Length = 198

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/161 (23%), Positives = 63/161 (39%), Gaps = 4/161 (2%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID 95
           +  AIVVL G   RIE    L        +F+ GV  SV K  L ++    +  +   + 
Sbjct: 38  NCDAIVVLAGGRGRIEEGSRLYRENHARWLFLIGVDPSVRKSDLFRERKGER--SGEGVY 95

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIIS 154
           +   + NT  NA  A       N   + ++T  YHM R  L  + +    +   P+P+ +
Sbjct: 96  LEKVSRNTLENALYAREMIVGRNIDSIELITSRYHMKRATLIFRHVLPKDIAIYPHPVDT 155

Query: 155 HDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQ 195
            +L+E          R+L  E+ K  L  +    +      
Sbjct: 156 KNLKEE-WWNHSGSFRLLFSEFYKYCLFRVFFLFAPTELQS 195


>gi|189425340|ref|YP_001952517.1| hypothetical protein Glov_2281 [Geobacter lovleyi SZ]
 gi|189421599|gb|ACD95997.1| protein of unknown function DUF218 [Geobacter lovleyi SZ]
          Length = 198

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/178 (23%), Positives = 69/178 (38%), Gaps = 5/178 (2%)

Query: 14  FFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHS 73
                F+ F         P      AIVVL G   R+E    L   + G  +F+ GV  +
Sbjct: 17  IVTALFVDFTYKTFSAR-PRQVQADAIVVLAGGKGRVEEGVRLFRERRGTWLFLVGVDPT 75

Query: 74  VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR 133
           V K  L +  P   D     + +   + NT  NA        ++    VL++T  YH+ R
Sbjct: 76  VRKSDLYR--PKPGDPPADNVVLEKLSRNTLENAIYGRDILAEHKVRSVLLITSRYHLKR 133

Query: 134 TFLELQRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           + +  +      V   PYP+ S +++E      +   R+L  E+ K  +  +    S 
Sbjct: 134 SAILFRNALAPDVALYPYPVDSSNVKEE-WWHHLGTFRLLFSEFYKYCIFRVFFLFSP 190


>gi|322420740|ref|YP_004199963.1| hypothetical protein GM18_3250 [Geobacter sp. M18]
 gi|320127127|gb|ADW14687.1| protein of unknown function DUF218 [Geobacter sp. M18]
          Length = 195

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 71/173 (41%), Gaps = 9/173 (5%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
           F+ F+     +  P      AIVVLTG   R+E    L     G+K+F+ GV  SV K  
Sbjct: 22  FVDFVYKTFSL-SPRDTQADAIVVLTGGRGRVEEGVRLYRAGQGKKLFLIGVDPSVKKRE 80

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           L Q         E  + +   + NT  NA  A     K+    + ++T  YHM R+ +  
Sbjct: 81  LFQ------GDGEGGVYLEQNSRNTLENAIYARDLIMKHKVRSIKLITSRYHMKRSTILF 134

Query: 139 QRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
           +      V   P+P+ S +L+           ++L  E+ K  +L     L+ 
Sbjct: 135 RNALPRYVAIYPHPVDSSNLK-EQWWRHSGSFKLLFSEFYKYCILRFFFMLAP 186


>gi|169830663|ref|YP_001716645.1| hypothetical protein Daud_0467 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637507|gb|ACA59013.1| protein of unknown function DUF218 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 264

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 74/183 (40%), Gaps = 5/183 (2%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R    G  V      +   +  R++     P    V  +V+      R+E AF L +  
Sbjct: 32  LRNLALGTLVLAAVVWLSLPAVGRFLVVADKPAPAEV-LVVLSGDRGERLEYAFRLYQEG 90

Query: 61  IGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
           + +++ +SG   +  +++  LL++  +   + E  I +  +A NT  NA  +    E   
Sbjct: 91  LADRLLLSGGPLYADLTEADLLRRHALMLGVPEYKIIMEPRATNTYQNALYSREMMEYYG 150

Query: 119 FHHVLIVTHDYHMPRTFLELQRI--NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
               ++++  YHM R       +   S ++ +  P+     +           RV+L EY
Sbjct: 151 LDSAIVISSPYHMRRVRALFDEVYRGSDIRLVYLPVEDSWFDPERWWESAAGRRVVLAEY 210

Query: 177 LKI 179
           L++
Sbjct: 211 LRL 213


>gi|329114135|ref|ZP_08242897.1| Hypothetical protein APO_0915 [Acetobacter pomorum DM001]
 gi|326696211|gb|EGE47890.1| Hypothetical protein APO_0915 [Acetobacter pomorum DM001]
          Length = 216

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 56/171 (32%), Positives = 77/171 (45%), Gaps = 6/171 (3%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHH 72
             F  GF  F+    +      P    IV LTG   RI+ +  LL    GE++ ISGV  
Sbjct: 38  FAFAGGFGWFVNDALR-PPGYLPHADGIVALTGGAGRIDTSLNLLARNQGERLLISGVDT 96

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
             +   LL             I +GY+A +T GNA E + W   N+   +++VT  YHM 
Sbjct: 97  QTTLAALLPSTAPPA--LAERITLGYQARSTIGNATETAVWVADNHITSLIVVTASYHMR 154

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           R  LEL R    V   PYP++   +E      +   LR+L +EYLK L   
Sbjct: 155 RALLELSRTLPDVTLYPYPVLPPAMEHP---LRRSSLRLLALEYLKWLGAL 202


>gi|118580810|ref|YP_902060.1| hypothetical protein Ppro_2396 [Pelobacter propionicus DSM 2379]
 gi|118503520|gb|ABL00003.1| protein of unknown function DUF218 [Pelobacter propionicus DSM
           2379]
          Length = 198

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/156 (23%), Positives = 61/156 (39%), Gaps = 4/156 (2%)

Query: 36  SVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID 95
              AIVVL G   R++    L     G  +F  GV  +V +  L +  P   D     + 
Sbjct: 38  RADAIVVLAGGKGRVDEGVRLFRQGKGHWLFFIGVDPTVRRSDLYR--PRPGDPPASGVI 95

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIIS 154
           +   + NT  NA        + N   +L++T  YHM R  + L+      V   PYP+ +
Sbjct: 96  LEKASRNTLENAVYGRDVIMERNVRSILLITSRYHMKRASILLRNALPKDVAIYPYPVDT 155

Query: 155 HDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
            +L+  +         +L  E+ K  +      L+ 
Sbjct: 156 ANLK-EAWWSHRSSFHLLFGEFYKYCMFRAFFLLAP 190


>gi|39997331|ref|NP_953282.1| hypothetical protein GSU2233 [Geobacter sulfurreducens PCA]
 gi|39984222|gb|AAR35609.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506268|gb|ADI84991.1| YdcF-like protein of unknown function DUF218 [Geobacter
           sulfurreducens KN400]
          Length = 199

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 73/191 (38%), Gaps = 6/191 (3%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS--VSAIVVLTGEPIRIERAFELLENQ 60
           +F   + + ++  I+  + F+ +  +            AIVVL G   R+E    L   +
Sbjct: 4   FFRGIISLLIVVLIIVAVLFVDFAYKTFSLRQRDVTTDAIVVLAGGRGRVEEGVRLFRER 63

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
            G  +++ GV   V K  L +     +      + +   + NT  NA        +    
Sbjct: 64  KGTYLYLIGVDPVVKKRDLFRDREGER--LADRVFLENLSRNTLENALYGREIIMRKEVR 121

Query: 121 HVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            + ++T  YHM R  L  +++    +   P+P+ + +L+           R+L  E+ K 
Sbjct: 122 SIRLITSRYHMKRATLLFRQVLPRDIAIYPHPVDTTNLK-ERWWDDKGSFRLLFSEFYKY 180

Query: 180 LLLSIQLSLST 190
            L       ++
Sbjct: 181 CLFRFFFLFAS 191


>gi|307293520|ref|ZP_07573364.1| protein of unknown function DUF218 [Sphingobium chlorophenolicum
           L-1]
 gi|306879671|gb|EFN10888.1| protein of unknown function DUF218 [Sphingobium chlorophenolicum
           L-1]
          Length = 176

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 88/188 (46%), Gaps = 14/188 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                + + L+ +++GF  F   + Q    D     AIVVLTG   RI+R   LL++   
Sbjct: 1   MIVRFIALTLLAWMLGFAWFAILLPQ--PLDGRQTDAIVVLTGGAGRIDRGLSLLQDGAA 58

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGV  SV    L  +    + L  CCI +G +A++T  NA E + W E+ +F  V
Sbjct: 59  KRMLISGVDRSVRPAELAAQYDAPERLFACCITLGREAIDTRSNAIETAHWLERRDFKTV 118

Query: 123 LIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            ++T D+HM R+ LEL++     V  +   +                L +L+ EY K LL
Sbjct: 119 RLITTDWHMRRSALELRQALPGRVTLVYDAVP-----------SRPSLMMLVREYNKYLL 167

Query: 182 LSIQLSLS 189
                 + 
Sbjct: 168 RRAAALIG 175


>gi|85375113|ref|YP_459175.1| hypothetical protein ELI_11430 [Erythrobacter litoralis HTCC2594]
 gi|84788196|gb|ABC64378.1| hypothetical protein ELI_11430 [Erythrobacter litoralis HTCC2594]
          Length = 176

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 14/184 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
             W    + ++ + +GF+ F   + Q          A++V TG   RI+R  E+L+    
Sbjct: 1   MIWRLFLLVVVAYALGFMWFAAALPQPRFEGE--TDAVIVPTGAAGRIDRGLEVLDGGKA 58

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
             + ++GV   V       +  +  +   CC+ +G+ A++T GNA E + W  +N    +
Sbjct: 59  RMMLVTGVDPEVRPAEFAAEFEVSMERMRCCVSLGFDAVDTRGNAAETADWVAENRIRSL 118

Query: 123 LIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +VT D+HM R   EL++     ++ +   + S              L +L +EY K+L 
Sbjct: 119 RLVTTDWHMRRASGELRQKLPTNIRIVEDAVASE-----------PSLGILFLEYNKLLA 167

Query: 182 LSIQ 185
               
Sbjct: 168 TWAS 171


>gi|162149067|ref|YP_001603528.1| hypothetical protein GDI_3297 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161787644|emb|CAP57240.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 197

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 10/176 (5%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           +  GF  F R   +      P    IV LTG   RIE +  LL    G ++ ISGV    
Sbjct: 15  WGAGFAWFFRDALR-PPAMPPIADGIVALTGGQGRIEASLRLLAQGRGRQLLISGVAPHA 73

Query: 75  SKDILLQKIPIRQD------LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           +   +  ++  +             + +G  A +T GNA E + WA  N  H +++VT  
Sbjct: 74  TTGSVASRLQPQGGGDGIPAALWRHVTLGRHATSTIGNADETAEWAHANAIHSLIVVTAG 133

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           YH+ R  +E++R    +   PYPI    L+      ++  +R++  EY K ++ S+
Sbjct: 134 YHIRRATMEIRRTVPGIVLYPYPIQPPALQAP---LRVASVRLMATEYDKWIMASL 186


>gi|330993951|ref|ZP_08317881.1| hypothetical protein SXCC_03846 [Gluconacetobacter sp. SXCC-1]
 gi|329758897|gb|EGG75411.1| hypothetical protein SXCC_03846 [Gluconacetobacter sp. SXCC-1]
          Length = 201

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 79/173 (45%), Gaps = 5/173 (2%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
             + +  G   F+    +  +   P    IV LTG   RIE +  LL      ++ ISGV
Sbjct: 4   AALAWTAGLAWFVHDAMRPPV-LPPRADGIVALTGGQGRIEESVRLLVQGRAGRLLISGV 62

Query: 71  HHSVSKDILLQKIPIRQDLAECC-IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
               ++   L+ +P    LA      +G +A +T GNA E +AW  +   H +++VT  Y
Sbjct: 63  DPHATRGDFLRHLPPPVPLAAWTHTTLGSRATSTLGNADETAAWVREYGLHSLIVVTAGY 122

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           H+ R  LE+ R    V+    PI S  L      F    +R++++EY K LL 
Sbjct: 123 HIRRAMLEISRTVPGVRLYGDPIRSPALAHP---FHPATMRLMVVEYDKWLLA 172


>gi|209545186|ref|YP_002277415.1| hypothetical protein Gdia_3070 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532863|gb|ACI52800.1| protein of unknown function DUF218 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 213

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 10/176 (5%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           +  GF  F R   +      P    IV LTG   RIE +  LL    G ++ ISGV    
Sbjct: 31  WGAGFAWFFRDALR-PPAMPPIADGIVALTGGQGRIEASLRLLAQGRGRQLLISGVAPHA 89

Query: 75  SKDILLQKIPIRQD------LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
           +   +  ++  +             + +G  A +T GNA E + WA  N  H +++VT  
Sbjct: 90  TTGSVASRLQPQGGGDGIPAALWRHVTLGRHATSTIGNADETAEWAHANAIHSLIVVTAG 149

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           YH+ R  +E++R    +   PYPI    L+      ++  +R++  EY K ++ S+
Sbjct: 150 YHIRRATMEIRRTVPGIVLYPYPIQPPALQAP---LRVASVRLMATEYDKWIMASL 202


>gi|94497844|ref|ZP_01304410.1| hypothetical protein SKA58_17288 [Sphingomonas sp. SKA58]
 gi|94422733|gb|EAT07768.1| hypothetical protein SKA58_17288 [Sphingomonas sp. SKA58]
          Length = 176

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 87/188 (46%), Gaps = 14/188 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                  + L+ +++GF  F  ++      D     AIVVLTG P RI+R   L++    
Sbjct: 1   MIVRLAALALLGWVLGFAWFAIFLP--EPLDGRRTDAIVVLTGGPGRIDRGIALMQQGAA 58

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++ ISGV  SV    L  +    + L +CCI +G +A++T  N  E + W  + ++  V
Sbjct: 59  RRMLISGVDRSVRPGELAAQYDAPEALFDCCITLGREAIDTRSNGLETARWLARRDYQTV 118

Query: 123 LIVTHDYHMPRTFLELQRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +VT D+HM R+ LEL +     +  +   + SH             L VL+ EY K LL
Sbjct: 119 RLVTTDWHMRRSALELTQALPPRIHIVYDAVPSH-----------PSLSVLMREYNKYLL 167

Query: 182 LSIQLSLS 189
             I   + 
Sbjct: 168 RRIAALIG 175


>gi|85710207|ref|ZP_01041272.1| hypothetical protein NAP1_15018 [Erythrobacter sp. NAP1]
 gi|85688917|gb|EAQ28921.1| hypothetical protein NAP1_15018 [Erythrobacter sp. NAP1]
          Length = 178

 Score = 99.9 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 84/187 (44%), Gaps = 14/187 (7%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
             Y L   ++ + +GF  F   + Q    +  S  A++V TG P RI +  ++LE    +
Sbjct: 4   IRYLLAASVLVWALGFFWFAAALPQ--PAEELSTDAVIVPTGGPGRIAQGLQVLEQGQAQ 61

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++ ++GV   V++D    +  + +   +CCI +G +A++T  NA E + W   N+   + 
Sbjct: 62  RMLVTGVDPEVTRDEFAAEFEVDEARMDCCITLGSEAVDTRSNATETAEWVAANDITSLR 121

Query: 124 IVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           +VT D+HM R   EL R    +V  +   +                L  L +EY K++  
Sbjct: 122 LVTTDWHMRRAAGELDRELPSSVTVVRDAVP-----------SQPSLASLFLEYHKLIAS 170

Query: 183 SIQLSLS 189
            I     
Sbjct: 171 FIAGLFG 177


>gi|149185075|ref|ZP_01863392.1| hypothetical protein ED21_18517 [Erythrobacter sp. SD-21]
 gi|148831186|gb|EDL49620.1| hypothetical protein ED21_18517 [Erythrobacter sp. SD-21]
          Length = 201

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 84/187 (44%), Gaps = 14/187 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                L    + +  GF+ F   +            A++VLTG P RI R  E++E  + 
Sbjct: 1   MILRLLAAIFLVYAFGFLGFAMTLP--APAAKTETDAVIVLTGGPGRIARGLEVVEQNMA 58

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++F+SGV   V  +   ++  +   L +CC+ +GY A++T  NA E + W ++  F   
Sbjct: 59  KEMFVSGVDPEVKPNEFAEQFEVSSRLMDCCVTLGYLAVDTRSNAGEVAQWMKEKEFTSA 118

Query: 123 LIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +VT ++HM R + E+       +  +   ++SH             L  L +EY K+L 
Sbjct: 119 RLVTTNWHMARAYSEVAGTLPAGISIVKDAVVSH-----------PDLATLFLEYNKLLA 167

Query: 182 LSIQLSL 188
             +   L
Sbjct: 168 SEVSQGL 174


>gi|294010104|ref|YP_003543564.1| hypothetical protein SJA_C1-01180 [Sphingobium japonicum UT26S]
 gi|292673434|dbj|BAI94952.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 176

 Score = 97.6 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 89/188 (47%), Gaps = 14/188 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                + V L+ +++GF  F  ++ Q    D     AIVVLTG   RI+R   LL++   
Sbjct: 1   MIVRFIAVTLLGWMLGFAWFAIFLPQ--PLDGRQTDAIVVLTGGAGRIDRGLALLQDGAA 58

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ ISGV  SV    L  +  + + L  CCI +G +A++T  NA E + W E+ +F  V
Sbjct: 59  KRMLISGVDRSVRPVELAAQYKVPERLFSCCITLGREAIDTRSNAIETAHWLERRDFKTV 118

Query: 123 LIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            ++T D+HM R+ LEL++     V  +   +                L +L  EY K LL
Sbjct: 119 RLITTDWHMRRSALELRQALPERVTLVYDAVP-----------SRPSLTMLAREYNKYLL 167

Query: 182 LSIQLSLS 189
                 + 
Sbjct: 168 RRAAALIG 175


>gi|33596348|ref|NP_883991.1| hypothetical protein BPP1716 [Bordetella parapertussis 12822]
 gi|33602366|ref|NP_889926.1| hypothetical protein BB3392 [Bordetella bronchiseptica RB50]
 gi|33566117|emb|CAE37017.1| conserved hypothetical membrane protein [Bordetella parapertussis]
 gi|33576805|emb|CAE33884.1| conserved hypothetical membrane protein [Bordetella bronchiseptica
           RB50]
          Length = 254

 Score = 97.2 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 68/211 (32%), Gaps = 27/211 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
           +           ++ G  +       +     P+  AIVVL G                 
Sbjct: 46  WALAWSLPATSLWLGG--ALESRYPHLPPDQSPTADAIVVLGGNTANGRANWFLPYDKET 103

Query: 48  --IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R++ A EL +     K+ +SG      +S+   +     +  + E  + +   +  T
Sbjct: 104 AVVRVDTATELFQAGRAPKVVLSGGALEGDISEARGMAYRMRQHGVPESALILENASRTT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLEEN 160
             NA        ++    VL+VT   HMPR      +        P P   +   D   +
Sbjct: 164 YENAALTEDTLRQHGIQKVLLVTSALHMPRAMAAFSKQGVQAIAAPAPPQIVAPADGSLS 223

Query: 161 SSI---FKIKILRVLLIEYLKILLLSIQLSL 188
             +         R ++ EY  + +  ++  +
Sbjct: 224 PWLPDQRSFDASRSIIKEYAGLFVYWLRGWV 254


>gi|163857424|ref|YP_001631722.1| hypothetical protein Bpet3112 [Bordetella petrii DSM 12804]
 gi|163261152|emb|CAP43454.1| conserved hypothetical protein [Bordetella petrii]
          Length = 252

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 80/213 (37%), Gaps = 31/213 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
           +           ++ G  +       + + + P+  AIVVL G                 
Sbjct: 44  WVLAWSLPATSLWLGG--ALESRYPHLPVAELPTADAIVVLGGNTANGRANWFLPYDKET 101

Query: 48  --IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R++ A +L +     K+ +SG      VS+   +  +  +Q + E  + +   +  T
Sbjct: 102 AVVRVDTAIKLYQAHRAPKVVLSGGALEGDVSEARGMAFLMKQQGVPEDALLLENSSRTT 161

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP-----IISHDLE 158
             NA       +++ F  +L+VT   HMPR      +    V  IP       ++  D  
Sbjct: 162 YENAMLTEEELKEHGFGKILLVTSALHMPRAMAAFSKQ--GVAAIPASTPPQIVLPPDGS 219

Query: 159 ENSSIFKIKIL---RVLLIEYLKILLLSIQLSL 188
            +  +  ++ L   R ++ EY  +L+  ++  +
Sbjct: 220 VSPWLPHMRTLDASRSIIKEYAGLLVYWLRGWV 252


>gi|33593317|ref|NP_880961.1| hypothetical protein BP2323 [Bordetella pertussis Tohama I]
 gi|33572673|emb|CAE42596.1| conserved hypothetical membrane protein [Bordetella pertussis
           Tohama I]
 gi|332382726|gb|AEE67573.1| hypothetical protein BPTD_2282 [Bordetella pertussis CS]
          Length = 254

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 68/211 (32%), Gaps = 27/211 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
           +           ++ G  +       +     P+  AIVVL G                 
Sbjct: 46  WALAWSLPATSLWLGG--ALESRYPHLPPDQSPTADAIVVLGGNTANGRANWFLPYDKET 103

Query: 48  --IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R++ A EL +     K+ +SG      +S+   +     +  + E  + +   +  T
Sbjct: 104 AVVRVDTATELFQAGRASKVVLSGGALEGDISEARGMAYRMRQHGVPESALILENASRTT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLEEN 160
             NA        ++    VL+VT   HMPR      +        P P   +   D   +
Sbjct: 164 YENAALTEDTLRQHGIQKVLLVTSALHMPRAMAAFSKQGVQAIAAPAPPQIVAPADGSLS 223

Query: 161 SSI---FKIKILRVLLIEYLKILLLSIQLSL 188
             +         R ++ EY  + +  ++  +
Sbjct: 224 PWLPDQRSFDASRSIIKEYAGLFVYWLRGWV 254


>gi|167957605|ref|ZP_02544679.1| hypothetical protein cdiviTM7_02994 [candidate division TM7
           single-cell isolate TM7c]
          Length = 204

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 70/199 (35%), Gaps = 15/199 (7%)

Query: 1   MRYFWYGLFVCLIFFIMGFIS---------FIRYVKQMHIPDHPSVSAIVVLTGEPI--R 49
           ++     +    +  ++G                 K+        V AIV ++G     R
Sbjct: 2   IKAIIAVIVFAFMVLLIGTYLSPDDLRGCDISLKGKESSNLACKRVDAIVAVSGGDTDAR 61

Query: 50  IERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
            + A +L +N     +  SG        S    ++K  +++ + +  I I   +  T+ N
Sbjct: 62  TDEAVKLYKNGWSNLLIFSGAAADKTGPSNAKAMRKHALKKGVPDSAIVIEENSNTTQEN 121

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ-RINSTVQFIPYPIISHDLEENSSIFK 165
           A+ +     +     +++VT  YH  R  +E +      V+ I +P+       N     
Sbjct: 122 ARLSRNVFSERKISRIILVTSAYHQRRAGIEFRLAAGGNVEVINHPVAQDKQWSNWWWIS 181

Query: 166 IKILRVLLIEYLKILLLSI 184
                + + E +KI+    
Sbjct: 182 PNGWWLAMSEIIKIIATYA 200


>gi|296116632|ref|ZP_06835242.1| hypothetical protein GXY_12533 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976844|gb|EFG83612.1| hypothetical protein GXY_12533 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 227

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 46/179 (25%), Positives = 78/179 (43%), Gaps = 5/179 (2%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
              + V ++ +  G   F+R  ++      P     V LTG   RIE + +L+      +
Sbjct: 23  LGVVCVLIMSWAAGLAWFVRDARRPPR-MPPPCDGAVALTGGQGRIEASLQLMAQHRARR 81

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAEC-CIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           + ISGV    +    L + P    L       +G +A +T GNA E + W    + H ++
Sbjct: 82  LLISGVDPHATLGDFLTRAPRVLPLEVWLRTTLGRQATSTLGNADETAQWVRAQDIHSLI 141

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           +VT  YH+ R  +E+ R    V   P+ +    L       ++   R+L++EY K LL 
Sbjct: 142 VVTAGYHIRRAMMEIARAAPGVTLYPFAVQPPALLHP---RRLATWRLLVVEYDKWLLA 197


>gi|110597117|ref|ZP_01385406.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
 gi|110341308|gb|EAT59773.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
          Length = 599

 Score = 95.3 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 61/198 (30%), Gaps = 13/198 (6%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERA 53
               L + L+ F      FI     +         AIVV +G             R   A
Sbjct: 401 LTVLLMLYLVIFHSPLFWFIGDQL-VVRHAPLKTDAIVVFSGNGESAYRNDSYQRRALDA 459

Query: 54  FELLENQIGEK-IFISGVHHSVSKDILLQKIPIRQDLAECCI-DIGYKALNTEGNAQEAS 111
                          SG    +S+  +++     + +A   I  +     +T  N +   
Sbjct: 460 VRFYRQGYAPHIFLSSGKEQDLSEVDVIKLYLEDKGVAASAIHILDKYPKSTSENVEMVM 519

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV 171
               +   H +L +T  YH  R     ++    +  +   ++     +      +  + V
Sbjct: 520 QQLRRQGVHSILFLTSPYHGRRALWTWRKQAPDITVLTPAVVDTPPADPQWGATVDQISV 579

Query: 172 LLIEYLKILLLSIQLSLS 189
           ++ EY+ I+    Q  L 
Sbjct: 580 IVYEYVAIVYNWFQGRLR 597


>gi|114566272|ref|YP_753426.1| hypothetical protein Swol_0732 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114337207|gb|ABI68055.1| hypothetical protein Swol_0732 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 211

 Score = 95.3 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 65/199 (32%), Gaps = 21/199 (10%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVV-LTGEPIRIERAFELLENQIGEK 64
             + + L+  +  F  +   V  +          I+V +   P RI  A EL E      
Sbjct: 9   LFICIILLALLAVFFRYAG-VGIVSSDSPEKADFIIVLMGSGPDRILGAVELYEKGYAPY 67

Query: 65  IFI------------SGVHHSVSKDILLQKIPIRQDLAECC-IDIGYKALNTEGNAQEAS 111
           I +            S          L   + ++  + E   I +   A +T+  A   +
Sbjct: 68  IMMVENWQPGYELLESRGVELPRDAELAASVGVQLGIPEEAFIILPGDARSTQDEALIVT 127

Query: 112 AWAEKN--NFHHVLIVTHDYHMPRTFLELQRIN----STVQFIPYPIISHDLEENSSIFK 165
            + ++       VL+V+  +H  R               V+ +  P    D    +    
Sbjct: 128 QYLKEQQAGVDMVLLVSSKFHSKRAAKIFCWALADSGQDVKVLSCPTPYDDFNAAAWWQS 187

Query: 166 IKILRVLLIEYLKILLLSI 184
            +  + ++ EY+K++   +
Sbjct: 188 REDAKRVVSEYVKLVNFYV 206


>gi|317055190|ref|YP_004103657.1| hypothetical protein Rumal_0470 [Ruminococcus albus 7]
 gi|315447459|gb|ADU21023.1| protein of unknown function DUF218 [Ruminococcus albus 7]
          Length = 198

 Score = 94.9 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/167 (19%), Positives = 58/167 (34%), Gaps = 12/167 (7%)

Query: 33  DHPSVSAIVVLTGEP---IRIERAFELLENQIGEKIFISGVH------HSVSKDILLQKI 83
           D  S   I+VL        R+  A  L        I +SG         ++++   ++K 
Sbjct: 27  DGSSADLIMVLGSRKACDYRVPEAVRLYNEGKAPLILLSGGQVQDTSLGNMAEWESMKKA 86

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMPRTFLELQRI 141
            +   ++E  I     + NT  N   +             +++VT  YHM R      + 
Sbjct: 87  ALALGISESDILAEKLSKNTAENFMYSDELLIGYLPLGSKIILVTTAYHMRRALCMAHKF 146

Query: 142 NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                FIP P+      + +     K  +  L E+ K L   I+  +
Sbjct: 147 MPGYDFIPCPVQKGSATKENWYKTDKGRQTALDEWRK-LSYYIKDGI 192


>gi|148555918|ref|YP_001263500.1| hypothetical protein Swit_3011 [Sphingomonas wittichii RW1]
 gi|148501108|gb|ABQ69362.1| protein of unknown function DUF218 [Sphingomonas wittichii RW1]
          Length = 177

 Score = 94.5 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 82/176 (46%), Gaps = 13/176 (7%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSV 74
           +I GF++F  ++ Q           IVV+TG   R+ER   LLE +  +++ ISG    V
Sbjct: 13  WIAGFMAFALFLPQPAPDGIA-TDGIVVMTGGRGRVERGLRLLEAKRAKRLLISGADRRV 71

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT 134
               L  +      L ECC+D+G+++++T  NA EA+ W  +  +  + +VT D+HM R 
Sbjct: 72  RPHELAAQFKAPMALVECCVDLGHESVDTRSNAAEAADWIARRRYRSIRLVTSDWHMVRA 131

Query: 135 FLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
             +L+      ++ +   + +              L  L+ EY K LL  +   + 
Sbjct: 132 RFDLRNATGDKLEIVADAVPTE-----------PGLVDLVREYNKYLLRRVAALIG 176


>gi|119356675|ref|YP_911319.1| hypothetical protein Cpha266_0844 [Chlorobium phaeobacteroides DSM
           266]
 gi|119354024|gb|ABL64895.1| protein of unknown function DUF218 [Chlorobium phaeobacteroides DSM
           266]
          Length = 219

 Score = 94.5 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 70/193 (36%), Gaps = 9/193 (4%)

Query: 1   MRYFW--YGLFVCLIFFIMGFISF-IRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFEL 56
           M+  +    LFV       G     + Y+  ++         I+VL G+   R+++  EL
Sbjct: 24  MKALFKLISLFVLTACTSAGIFFISLGYLVSLYAEKPKPADVIIVLGGDNGLRVKKGAEL 83

Query: 57  LENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
             +    ++ ++G+             ++      + +  I I  ++ ++   A  +S  
Sbjct: 84  YNDGYAPRVILTGIDARFYRPSHPDWRERRMRALGVPKKSIRIDTRSASSWEEALNSSRL 143

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRV 171
            EK  +   ++V+   H+ R     ++  S    QFI  P               K    
Sbjct: 144 MEKKGWKTAIVVSDPPHLFRLHRTWKKAFSGSAKQFILVPTKPQWWNPLLWWKNKKSYSF 203

Query: 172 LLIEYLKILLLSI 184
           ++ E+ K L  S+
Sbjct: 204 VISEFQKSLYYSV 216


>gi|148255961|ref|YP_001240546.1| hypothetical protein BBta_4612 [Bradyrhizobium sp. BTAi1]
 gi|146408134|gb|ABQ36640.1| hypothetical protein BBta_4612 [Bradyrhizobium sp. BTAi1]
          Length = 262

 Score = 94.5 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 72/211 (34%), Gaps = 28/211 (13%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEP 47
                + L       +S +        P   +   I+VL                     
Sbjct: 47  LLLAVLGLTPLGSLMLSPLESRFPKWDPAKGAPDGIIVLGGPVDPDLSIMYGMPVTVAGA 106

Query: 48  IRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKALN 102
            R+ +A  L       +I  +G   ++      +  +   I +   +A+  + +  ++ N
Sbjct: 107 DRLIQAAALARRYPNARIVFTGGSANLISTDAREADVAADILLSLGVAKERLTLERESRN 166

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---SHDLEE 159
           T  NA  + A          L+VT  +HMPR+    ++        PYP+       L+ 
Sbjct: 167 TYENAVFSKAMVAPKPGERWLLVTSAFHMPRSVGLFRKA--GFPVEPYPVDWRVGRVLDV 224

Query: 160 NS-SIFKIKILRVLLIEYLKILLLSIQLSLS 189
           +  S+  ++   + + E++ ++   ++  + 
Sbjct: 225 DGVSLLGLRRADIAVREWVGLVAYRLRGRID 255


>gi|205374987|ref|ZP_03227778.1| hypothetical protein Bcoam_18347 [Bacillus coahuilensis m4-4]
          Length = 200

 Score = 94.5 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 68/192 (35%), Gaps = 8/192 (4%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP-SVSAIVVLTGEPI--RIERAFELLE 58
           +  W+     ++  +   + F R    +   + P     I+VL+G     R   A +L  
Sbjct: 10  KMVWFLFIFVMVLVLAMILLFKRSHTLLVEKNPPVPADVILVLSGGAQGEREAEAAKLYH 69

Query: 59  NQIGEKIFIS--GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
               + I +S   V  +     ++++  I   + +  I       +T   A++A    E+
Sbjct: 70  EGYTDTIVVSMAKVGWNTYTGDIMREHLIHLGVPDNAILTYGDVTSTREEAEQAVPLLEE 129

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
                +++ T  +H  R     +R      ++ I  P+   +   +      +  +    
Sbjct: 130 LAVRKMILTTSSFHSGRAKWIFERTLKEKGIEVISVPVREEEFGSD-WWQTHETRKQGAS 188

Query: 175 EYLKILLLSIQL 186
           E LK +    +L
Sbjct: 189 ELLKYVWEWFRL 200


>gi|87198723|ref|YP_495980.1| hypothetical protein Saro_0699 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134404|gb|ABD25146.1| protein of unknown function DUF218 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 182

 Score = 94.1 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 82/186 (44%), Gaps = 16/186 (8%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
            F   L + +I + +GFI F  ++ +    +      IVVLTG   RI  A  LL+   G
Sbjct: 6   IFRRLLSLLMIAWALGFIWFAVFLPR-PAAEPARTDGIVVLTGGSGRIPHALRLLQTGAG 64

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            K+ +SGV   V       +  +   L  CCI +GY A++T  NA E++ W + N    V
Sbjct: 65  RKLLVSGVDREVRPREFAVEYDVPSRLMTCCIVLGYDAVDTRSNAVESARWMQTNRIRSV 124

Query: 123 LIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI-- 179
            +VT D+HM R   +L +     +  +   ++                R+L IEY K+  
Sbjct: 125 RLVTTDWHMRRAAFDLAQEAPKDLVIVEDAVV-----------SRPSFRILFIEYNKLVA 173

Query: 180 -LLLSI 184
            L   +
Sbjct: 174 RLAAWL 179


>gi|332715738|ref|YP_004443204.1| hypothetical protein AGROH133_10165 [Agrobacterium sp. H13-3]
 gi|325062423|gb|ADY66113.1| hypothetical protein AGROH133_10165 [Agrobacterium sp. H13-3]
          Length = 232

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/187 (17%), Positives = 60/187 (32%), Gaps = 9/187 (4%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIG 62
              GL +     + G          +          IVVL    P R  +A +L      
Sbjct: 40  ILLGLMMLTAIGLYGLALVSAGSLLVVEDPPAQADVIVVLGGDGPPRAAQAAKLWHEGRA 99

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
             + ++G          ++ + +R  +    +     +L+T  NA  A            
Sbjct: 100 PLVLVTGYGDC----DFIRDMLVRLGVDSAVVSTECLSLSTWENATFAQPILTGMGAKSA 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV-LLIEYLKILL 181
           ++VT  +H  R     + +   +++I  P        +     I    V +  EY K LL
Sbjct: 156 ILVTSWFHSRRAVKRFRFVMPQIEWISLPAQR---TVSLWRLAIDGDGVQVFKEYAKALL 212

Query: 182 LSIQLSL 188
             I+ S 
Sbjct: 213 YDIRSSF 219


>gi|296133679|ref|YP_003640926.1| protein of unknown function DUF218 [Thermincola sp. JR]
 gi|296032257|gb|ADG83025.1| protein of unknown function DUF218 [Thermincola potens JR]
          Length = 202

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/196 (14%), Positives = 72/196 (36%), Gaps = 15/196 (7%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RI 50
           R     LF   +  +   +        +         AIVVL+G              R 
Sbjct: 6   RNLVITLFTGFLILLYTPLIQYAASPLIVKDPLQKADAIVVLSGGWKAKGVLGTSTLERY 65

Query: 51  ERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           +   +L + +    I  SG +     ++   +  + +        +     + +T  N  
Sbjct: 66  QYGIKLFQKKFAPVIIFSGGNLLGRPAEADAMADMALSAGFPYEAVISENASASTYENVL 125

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             +   ++     +++VT  YH  R     +  +  V+    P+ + + E+ + + ++K+
Sbjct: 126 FTTKILQEKRLKSIILVTSPYHTYRAKKMFE--DKQVKVTAAPVPNGEFEKANGLERLKL 183

Query: 169 LRVLLIEYLKILLLSI 184
            + +++EY K+L+  +
Sbjct: 184 AKNIVLEYGKLLVYEV 199


>gi|187478721|ref|YP_786745.1| membrane protein [Bordetella avium 197N]
 gi|115423307|emb|CAJ49841.1| putative membrane protein [Bordetella avium 197N]
          Length = 254

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 74/211 (35%), Gaps = 27/211 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
           +           ++ G  +       +     P+  AIVVL G                 
Sbjct: 46  WVLVWSLPATSLWLGG--ALEHRYPYLEPDSAPTADAIVVLGGNTANGRANWFLPYDKDT 103

Query: 48  --IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R++ A +L       K+ +SG     +VS+   +     ++ + +  + +   + NT
Sbjct: 104 AVVRVDTATDLYLADRAPKVVLSGGALEGNVSEAQGMAHRMRQRGVPDSALVLENASRNT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLEEN 160
             NA         N+   VL+VT   HMPR      +        P P   +   D   +
Sbjct: 164 YENAALTEDTLRANHISKVLLVTSALHMPRAMAAFSKQGVEAIAAPTPPQIVPPTDGSLS 223

Query: 161 SSIFKIKIL---RVLLIEYLKILLLSIQLSL 188
             +  ++ L   R ++ EY  +L+  ++  +
Sbjct: 224 PWMPDMRTLDASRSIIKEYAGLLVYWLRGWV 254


>gi|183220138|ref|YP_001838134.1| hypothetical protein LEPBI_I0726 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910258|ref|YP_001961813.1| hypothetical protein LBF_0703 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774934|gb|ABZ93235.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778560|gb|ABZ96858.1| Conserved hypothetical protein; putative membrane protein
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 258

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 74/222 (33%), Gaps = 37/222 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFIS------FIRYVKQMHIPDHPSVSAIVVLT----------- 44
           ++ ++ + + L      FI+        +    + + D P V   +VL            
Sbjct: 39  KFLFFIICLFLYLASSSFIANRLVTELEKEYPPVSLQDAPKVDVAIVLGGMIQTISSVKA 98

Query: 45  -----GEPIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCI 94
                    RI  A  L +    +KI  +G        +  +  L + + I   + E  I
Sbjct: 99  RPELTDSADRITDAIRLYKAGKVKKILFTGGSGLLLSDTYREADLAKSLFIDLGVKEEDI 158

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +   + NT  NA E      + NF   L++T  +HM R+    Q+    +   P+P   
Sbjct: 159 ILENNSRNTHENAVETKKILMEKNFQSFLLITSAFHMKRSLGCFQKQ--NLNVFPFPTDY 216

Query: 155 HDLEENS--SIFKIKILRVL------LIEYLKILLLSIQLSL 188
                +S      +     L      + E++   +   +  L
Sbjct: 217 RSFNTDSGAFELYLPSAGYLDLTTLSIKEWVGYFVYRTKSYL 258


>gi|153009344|ref|YP_001370559.1| hypothetical protein Oant_2014 [Ochrobactrum anthropi ATCC 49188]
 gi|151561232|gb|ABS14730.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 235

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 59/210 (28%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
                F          ++ +             V  IVVL                    
Sbjct: 17  IAILFFAAFTTLGSVLLAPLEDRFAKPDAMPQHVDGIVVLGGYMNGDINAGRKGFELNSA 76

Query: 47  PIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             RI  A  L       ++ +SG        +  +    +++ I    +        K+ 
Sbjct: 77  ADRIFEAMRLARLYPDARVIVSGGDGAFFEEAAKEADSTRQMLIDLGFSGERYIYENKSR 136

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  +   A+       L+VT  YHMPR+    ++       + +P+         
Sbjct: 137 NTVENAIFSKELAQPKPGETWLLVTSAYHMPRSVGCFRKA--DFDVVAWPVDYKTRARER 194

Query: 162 SIFKIKI-------LRVLLIEYLKILLLSI 184
               ++          V + E++ +    +
Sbjct: 195 FALYLESPNEALSRFSVAMREWVGLAAYWL 224


>gi|332188414|ref|ZP_08390138.1| hypothetical protein SUS17_3520 [Sphingomonas sp. S17]
 gi|332011560|gb|EGI53641.1| hypothetical protein SUS17_3520 [Sphingomonas sp. S17]
          Length = 177

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/181 (26%), Positives = 85/181 (46%), Gaps = 14/181 (7%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
              + +  + + +GF +F+  +      ++ +  AIVV TG   RI+R   LL+    ++
Sbjct: 2   LRLIGLVALGWCLGFAAFMLSLPH--PLENNTTDAIVVPTGGAGRIDRGIALLQAHQAKR 59

Query: 65  IFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           + ++GV   V    L +       L  CCID+G +A++T  NA+E + W  ++ +  V +
Sbjct: 60  MLVTGVAPGVRPIDLARTYRTAPSLFSCCIDLGLEAVDTRSNAEETARWVREHGYRTVRL 119

Query: 125 VTHDYHMPRTFLELQRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           VT D+H+PR  +EL       V  +   + S              L  L+ EY K++L  
Sbjct: 120 VTSDWHLPRARMELVAALGPQVVVLGDGVPSE-----------PRLGTLVNEYNKLILRR 168

Query: 184 I 184
           I
Sbjct: 169 I 169


>gi|317407644|gb|EFV87583.1| hypothetical protein HMPREF0005_04608 [Achromobacter xylosoxidans
           C54]
          Length = 254

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 73/223 (32%), Gaps = 35/223 (15%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFI----------RYVKQMHIPDHPSVSAIVVLTGEP--- 47
           +R     L +  + + + +   +               +   + P+  AIVVL G     
Sbjct: 32  LRKTGGALILAGLLWALAWSLPVTSLWLGGALENRYPHLPPAESPTADAIVVLGGNTANG 91

Query: 48  --------------IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAE 91
                         +R++ A +L       K+ +SG      VS+   +     +Q + E
Sbjct: 92  RANWFLPYDKDTAVVRVDTAAQLYLAGRAPKVVLSGGALEGDVSEARGMAHAIRQQGVPE 151

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             + +   +  T  NA       +      VL+VT   HMPR      +        P P
Sbjct: 152 SALILENASRTTYENAALTEDQLKTRGIGKVLLVTSALHMPRAMAAFSKQGVIAIAAPAP 211

Query: 152 ---IISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQLSL 188
              +   D   N  +   +     R ++ EY  + +  ++  +
Sbjct: 212 PQIVAPADGSLNPWLPDQRTFDASRSIIKEYAGLFVYWLRGWV 254


>gi|146341164|ref|YP_001206212.1| hypothetical protein BRADO4236 [Bradyrhizobium sp. ORS278]
 gi|146193970|emb|CAL77987.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 262

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 66/209 (31%), Gaps = 28/209 (13%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEP 47
                V L       +  +        P   +   I+VL                     
Sbjct: 47  LLLAIVGLTPLGSLMLYPLESRFPKWDPAKGAPDGIIVLGGPVDSDLSAIYGMPVTVAGA 106

Query: 48  IRIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKALN 102
            R+ +A  L       ++  +G   ++      +  +  +I     +A+  + +  ++ N
Sbjct: 107 DRVIQAAVLARRYPNARVLFTGGSANLIATDAKEADVGAEILESLGVAKQRLLLERQSRN 166

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           T  NA  + A          L+VT  YHMPR+    ++        PYP+          
Sbjct: 167 TYENAIFSKAMIAPKPGERWLLVTSAYHMPRSVGLFRKA--GFPVEPYPVDWRVGRVLDF 224

Query: 163 ----IFKIKILRVLLIEYLKILLLSIQLS 187
               +  ++   + + E++ ++   ++  
Sbjct: 225 DGVSLQGLRRADIAVREWVGLVAYRLRGR 253


>gi|194336436|ref|YP_002018230.1| protein of unknown function DUF218 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308913|gb|ACF43613.1| protein of unknown function DUF218 [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 196

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 62/191 (32%), Gaps = 9/191 (4%)

Query: 1   MRYFW---YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFEL 56
           MR F       F+ L       +S +  +   H  D      I+VL G+   R+ +  EL
Sbjct: 1   MRLFVKITLIFFLSLTTAAALLLSCLGILVSQHAADPEKCDVIIVLGGDNGLRVRKGAEL 60

Query: 57  LENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
                   + ++G+             ++  I   + +  I I  K+  T   A+  S  
Sbjct: 61  YNAGYASHVILTGIDERFYRPSHPNWRERRMIALGVPKKAIKIDTKSKTTWEEAENTSNT 120

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRV 171
            EK  +   +IV+   HM R      R        FI         +        +  + 
Sbjct: 121 MEKKGWKSAIIVSDPPHMLRLHQTWNRAFKGSSKTFILVSTTPSWWDRVLWWKNRQSYQF 180

Query: 172 LLIEYLKILLL 182
           ++ E  K L  
Sbjct: 181 VISEIKKNLFY 191


>gi|159186332|ref|NP_355852.2| hypothetical protein Atu4812 [Agrobacterium tumefaciens str. C58]
 gi|159141466|gb|AAK88637.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 232

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 59/187 (31%), Gaps = 9/187 (4%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIG 62
              G+ +     + G          +          IVVL    P R  +A +L      
Sbjct: 40  IVLGVIILGAIGLYGLALVSAGSLLVVEDPPAQADVIVVLGGDGPPRAAQAAKLWHEGKA 99

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
             + ++G          ++ + +R  +    +     +L+T  NA  A            
Sbjct: 100 PLVLVTGYGDC----DFIRDMLVRSGVDFAAVSTECLSLSTWENATFAQPILTGMGAKRA 155

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV-LLIEYLKILL 181
           ++VT  +H  R     + +   +Q+I  P        +     I    V +  EY K L 
Sbjct: 156 ILVTSWFHSRRAVKRFRFVMPQIQWISLPAQR---TVSLWRLAINGDGVQVFKEYAKALF 212

Query: 182 LSIQLSL 188
             ++ S 
Sbjct: 213 YDVRSSF 219


>gi|293604449|ref|ZP_06686856.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292817326|gb|EFF76400.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 254

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 69/211 (32%), Gaps = 27/211 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
           +           ++ G  +       +   D P+  AIVVL G                 
Sbjct: 46  WALAWSLPVTSLWLGG--ALENRYPHLAPADSPTADAIVVLGGNTANGRANWFLPYDKDT 103

Query: 48  --IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R++ A +L       K+ +SG      VS+   +     +Q + E  + +   +  T
Sbjct: 104 AVVRVDTAAQLYLAGRAPKVLLSGGALEGDVSEARGMAHAIRQQGVPESALILENSSRTT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLEEN 160
             NA       +      VL+VT   HMPR      +        P P   +   D   +
Sbjct: 164 YENAALTEDALKSRGITKVLLVTSALHMPRAMAAFSKQGVEAIAAPAPPQIVAPADGSLS 223

Query: 161 SSIFKIKIL---RVLLIEYLKILLLSIQLSL 188
             +   +     R ++ EY  + +  ++  +
Sbjct: 224 PWVPDQRTFDASRSIIKEYAGLFVYWLRGWV 254


>gi|311105207|ref|YP_003978060.1| hypothetical protein AXYL_02016 [Achromobacter xylosoxidans A8]
 gi|310759896|gb|ADP15345.1| hypothetical protein AXYL_02016 [Achromobacter xylosoxidans A8]
          Length = 254

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 68/211 (32%), Gaps = 27/211 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------------- 47
           +           ++ G  +       +   + P+  AIVVL G                 
Sbjct: 46  WALAWSLPATSLWLGG--ALESRYPHLAPSESPTADAIVVLGGNTANGRANWFLPYDKDT 103

Query: 48  --IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             +R++ A +L       K+ +SG      VS+   +     +Q + E  + +   +  T
Sbjct: 104 AVVRVDTAAQLYLAGRAPKVLLSGGALEGDVSEARGMAHAIRQQGVPETALILENSSRTT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLEEN 160
             NA       +      VL+VT   HMPR      +        P P   +   D    
Sbjct: 164 YENAALTEDQLKSRGIGKVLLVTSALHMPRAMAAFSKQGVEAVAAPAPPQIVAPADGSLP 223

Query: 161 SSIFKIKIL---RVLLIEYLKILLLSIQLSL 188
             +   +     R ++ EY  + +  ++  +
Sbjct: 224 LWLPDQRTFDASRSIIKEYAGLFVYWLRGWV 254


>gi|188996942|ref|YP_001931193.1| protein of unknown function DUF218 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932009|gb|ACD66639.1| protein of unknown function DUF218 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 242

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 74/211 (35%), Gaps = 25/211 (11%)

Query: 2   RYFWYGLFVCLIFFIMGF-----ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           R     L   +  +++               +   P + S   IVVL G           
Sbjct: 34  RVLTISLASAISIYLISIEPVKDFLLKPLEAKFQQPKNISGDVIVVLGGGSYNTGILTED 93

Query: 49  ---RIERAFELLENQIGEKIFISGV-HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
              R+   F L +      I   G    ++ +   ++ +     + +  I    ++ +T 
Sbjct: 94  SLKRVLTGFVLHKRLNVPIILSGGSAITNLPESEAMKSLLAELGIDKKMIFTDVQSRDTL 153

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            NA       +K  +  V++VT  YHMPR+++  ++    +  IPYP      ++ +   
Sbjct: 154 ENAFFTKKICKKYGYKTVILVTSAYHMPRSYMTFKQA--GLNVIPYPTDFKMDKKYTVYS 211

Query: 165 KIKILRVL------LIEYLKILLLSIQLSLS 189
               + VL      + EY+ +    ++ S  
Sbjct: 212 YFPKMNVLQDSTKAIREYIGLFAYYLRFSFR 242


>gi|220908126|ref|YP_002483437.1| hypothetical protein Cyan7425_2730 [Cyanothece sp. PCC 7425]
 gi|219864737|gb|ACL45076.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 279

 Score = 92.6 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 74/212 (34%), Gaps = 20/212 (9%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---IRIERAFELLENQ 60
                 +     ++   +++  V  +       V AIVVL   P    R   A EL +  
Sbjct: 78  LVVLALIATFPPVVTLANYLL-VSPLPQDTGARVDAIVVLGRGPISGDRAAVAAELWQAG 136

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
              K+F+SG   +      L+K      ++   +     +  TE NAQ  +   +     
Sbjct: 137 RAPKVFVSGRGDAPYLVKELRKY----GVSASALASEDCSQTTEENAQFTARLLQPQGVQ 192

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           H+L++T   HM R+++  +R+        + +I H       +   K    +  EY  ++
Sbjct: 193 HILLITDSPHMLRSWMTFERVG-------FQVIPHGNALPHWLSHRKHALTVYREYAGLI 245

Query: 181 LLSIQLSLST-----QTASQFFITLIEEITVK 207
             ++Q  +            +        T K
Sbjct: 246 SYTLQGRIQPFRIRLDPTDSYGQPPALPFTAK 277


>gi|325681016|ref|ZP_08160548.1| hypothetical protein CUS_5709 [Ruminococcus albus 8]
 gi|324107245|gb|EGC01529.1| hypothetical protein CUS_5709 [Ruminococcus albus 8]
          Length = 193

 Score = 92.2 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 33/167 (19%), Positives = 66/167 (39%), Gaps = 12/167 (7%)

Query: 33  DHPSVSAIVVLTGEP---IRIERAFELLENQIGEKIFISGVH------HSVSKDILLQKI 83
           D  +   I+VL        R+  A  L ++     +  SG          +++ + ++  
Sbjct: 27  DGSAADLIMVLGSRKACEYRVPEAVRLYKSGRAPMMLFSGGKVQKTALGEMAEWLSMETA 86

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEK--NNFHHVLIVTHDYHMPRTFLELQRI 141
            I   ++E  I +   ++NT  N   +     +   +   +++VT  YHM R  L  ++I
Sbjct: 87  AISLGVSERDILLEKCSMNTAENFSCSENLLREVLPDGGRIILVTTAYHMRRALLTAEKI 146

Query: 142 NSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
               +FI  P+      + +     K  R +L E+ K L   I+  +
Sbjct: 147 LPQYEFISCPVQKGSATKENWYKTDKGRRTVLDEWGK-LRYYIRAGI 192


>gi|254412764|ref|ZP_05026537.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196180499|gb|EDX75490.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 263

 Score = 92.2 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 69/225 (30%), Gaps = 39/225 (17%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------ 48
           +      L V    ++   +      + +   + P   AIV+L G               
Sbjct: 41  IALGLIILLVASNGWVANSMVQSLEWQHIPPTELPQAEAIVILGGATRSAIPPRPAPDLN 100

Query: 49  ----RIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYK 99
               R+    +L +      I  SG           +   + +I     +    I     
Sbjct: 101 EAGDRVFYGAQLYQQGKAPVIIASGGRIEWRGGGSPESADMAQILEMIGVPPSAILQDPA 160

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISH 155
           +LNT  NA       ++     VL+VT   H PR     QR    ++ IP P    +   
Sbjct: 161 SLNTHQNAVNVRRILQQEGIKKVLLVTSAMHTPRALRVFQRQ--GIEAIPAPTDFLVTQQ 218

Query: 156 DLEENSSI------------FKIKILRVLLIEYLKILLLSIQLSL 188
           +L E +S               + +    + EY+   +  ++  L
Sbjct: 219 ELNEPNSSLAAILLNGLPDAQNLDMTTRAIKEYIGTAVYWLRGWL 263


>gi|103488367|ref|YP_617928.1| hypothetical protein Sala_2890 [Sphingopyxis alaskensis RB2256]
 gi|98978444|gb|ABF54595.1| protein of unknown function DUF218 [Sphingopyxis alaskensis RB2256]
          Length = 176

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/174 (28%), Positives = 78/174 (44%), Gaps = 14/174 (8%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            + +  + +++GF  F   +            AIVV+TG P RI+RA E LE    +++ 
Sbjct: 5   LISLLFLVWVLGFAWFALLLPLPAP--PQKTDAIVVVTGGPGRIDRALERLEAGDAKRLL 62

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ISGV   V    L  +      L +CCI +G+ A +T  NA E +AWA++  +  + +VT
Sbjct: 63  ISGVAREVKPRELAAEYGRPVALFDCCIALGFDAEDTRSNATEVAAWAKRRKYKSIRLVT 122

Query: 127 HDYHMPRTFLEL-QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            D+HM R   E+ + +   V  +   +                L  L  EY K 
Sbjct: 123 TDWHMRRAEYEIGRAVGRDVTIVTDAV-----------RSQPNLATLFREYHKY 165


>gi|21673972|ref|NP_662037.1| hypothetical protein CT1146 [Chlorobium tepidum TLS]
 gi|21647116|gb|AAM72379.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 196

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 62/193 (32%), Gaps = 9/193 (4%)

Query: 1   MRYFW---YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFEL 56
           M+ F       F+            + ++  MH         IV+L G+   R+ +  +L
Sbjct: 1   MKIFLKISLLFFLISSALCASLYLGLGFLVSMHSTKPEKADIIVILGGDDGLRVSKGGDL 60

Query: 57  LENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
            +    + + ++G+             ++  + + +    I +   +  +   A+  S  
Sbjct: 61  YKAGYAKHVLLTGIDSRYYRPNHPNWRERKLMARGVPRKHIIVDTWSETSWEEAENTSDL 120

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ--FIPYPIISHDLEENSSIFKIKILRV 171
            +KN +   L+V+   HM R     ++  +     F                      R 
Sbjct: 121 MDKNGWKSALVVSDPPHMLRLNKTWKKAFAGTNKRFRLVATEPSWWNPLLWWRNPISYRF 180

Query: 172 LLIEYLKILLLSI 184
           ++ E  K +   +
Sbjct: 181 VINELKKNIYYLV 193


>gi|83814701|ref|YP_445779.1| hypothetical protein SRU_1660 [Salinibacter ruber DSM 13855]
 gi|83756095|gb|ABC44208.1| Uncharacterized ACR, COG1434 family [Salinibacter ruber DSM 13855]
          Length = 281

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 34/221 (15%), Positives = 65/221 (29%), Gaps = 33/221 (14%)

Query: 6   YGLFVCLIFFIMGFIS--FIRYVKQMHIPDHPSVSAIVVLTGE----------------P 47
             L+V     +  ++            +   PS  A VVL G                  
Sbjct: 46  LVLWVASAPLVSDWLRGRLEGQHPPTRVDSLPSAEAAVVLGGGVSPPRPPRIHPDLNDAA 105

Query: 48  IRIERAFELLENQIGEKIFISGVHHSVSKDILLQK-----IPIRQDLAECCIDIGYKALN 102
            R+  A  L        +  SG      +    +      +     +    I +  K+ N
Sbjct: 106 DRVWHAARLYHAGKVPLVIASGGTQPWKRPDAREAPATNVLLQDWGVPGDAILLESKSAN 165

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLE 158
           T  NA   +   ++   + VL+VT   HMPR     +     ++ +P P    +   +  
Sbjct: 166 TYENATRTAELLDRRGLNCVLLVTSALHMPRALAVFRSA--GIKAVPAPTDVQVGDRNYT 223

Query: 159 ENSSIFKIKILR---VLLIEYLKILLLSIQLSL-STQTASQ 195
               +     L      + EY+  L+   +  +     +  
Sbjct: 224 VLDVLPDAGALAGSTAAIREYVGYLVYDWRGWIDGPAGSPN 264


>gi|56551314|ref|YP_162153.1| hypothetical protein ZMO0418 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241760967|ref|ZP_04759056.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753066|ref|YP_003225959.1| hypothetical protein Za10_0828 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542888|gb|AAV89042.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374586|gb|EER64047.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552429|gb|ACV75375.1| protein of unknown function DUF218 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 203

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 58/184 (31%), Positives = 87/184 (47%), Gaps = 14/184 (7%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L    + ++ GF  F  Y    H  +      IVVLTG   RI+R   +LE    +K+ 
Sbjct: 13  FLICLFMLWLGGFWLF--YSFHAHPTNKQVTDGIVVLTGGAGRIDRGLMMLERHQAKKML 70

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           +SGV+  V  + L     I   L ECC+D+G +A++T  NAQE + W   N++H V ++T
Sbjct: 71  VSGVNRQVKAEELAALYDIPSHLIECCVDLGTQAVDTSSNAQETAEWITLNHYHSVRLIT 130

Query: 127 HDYHMPRTFLELQ-RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
            D+HM R   EL   I   ++ +   I SH              RV +IEY K L     
Sbjct: 131 TDWHMARARFELSLMIGKDIKVVEDAIPSH-----------AGWRVWIIEYCKYLWRRSS 179

Query: 186 LSLS 189
           +++ 
Sbjct: 180 VAIG 183


>gi|186681117|ref|YP_001864313.1| hypothetical protein Npun_F0616 [Nostoc punctiforme PCC 73102]
 gi|186463569|gb|ACC79370.1| protein of unknown function DUF218 [Nostoc punctiforme PCC 73102]
          Length = 263

 Score = 91.4 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 75/225 (33%), Gaps = 39/225 (17%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT---------------- 44
           + +    L  C   +I   +      + + +   P   AIVVL                 
Sbjct: 41  IAFALTLLLFCSNAWIAKSLVRSLEWQNLPLAQIPVAEAIVVLGGATKSAFPPRPTVDLS 100

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYK 99
               R+  A +L   +    I +SG           +   +  I     +    I    +
Sbjct: 101 ESGDRVIYAAQLYRQKRAPIIILSGGRIDWRGGGSPESADMATILTSIGIPSEAIVQEPE 160

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISH 155
           +LNT  NA       E    + VL+VT   HMPR+    QR    +  IP P    +   
Sbjct: 161 SLNTYQNAVNVRKILESRGINQVLLVTSAMHMPRSLNIFQRQ--GINVIPAPTDFLVSQG 218

Query: 156 DLEENSSIFKIKILRVL------------LIEYLKILLLSIQLSL 188
           +L+E     K  IL +L            L EY+  L+  ++  L
Sbjct: 219 ELQELGGTPKAAILNLLPDTDNLHQFTSALKEYIGSLIYRLRGWL 263


>gi|153873460|ref|ZP_02002036.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
 gi|152070073|gb|EDN67963.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
          Length = 195

 Score = 91.0 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 70/197 (35%), Gaps = 29/197 (14%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLT----------------GEPIRIERAFELLENQIG 62
            +S  RY     I D+P V AIVV+                     R+  A  L      
Sbjct: 1   MVSLERYHPSQDITDYPMVQAIVVIGGCLESAKPPRRTFNVGDAGDRVIHAARLYHAGKA 60

Query: 63  EKIFISGV----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
             I +SG          +   ++       +    +     ++ T  NA  +    +   
Sbjct: 61  PLILVSGGTLPWRKVPPEADAMRAFLEELGVPTKAVMSEPDSITTYENALFSKKLLDNKG 120

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK-IKILRVL----- 172
            H +L+VT  +HM R+    +++    + IP P     ++   S+F  +  +R L     
Sbjct: 121 IHKILLVTSAFHMRRSAAVFRKV--GFEVIPAPTDFRVVKNPPSLFDYLPDVRYLHQTTI 178

Query: 173 -LIEYLKILLLSIQLSL 188
            + EY+ +   +++  L
Sbjct: 179 AIKEYIGLEYYALKQRL 195


>gi|189500318|ref|YP_001959788.1| hypothetical protein Cphamn1_1378 [Chlorobium phaeobacteroides BS1]
 gi|189495759|gb|ACE04307.1| protein of unknown function DUF218 [Chlorobium phaeobacteroides
           BS1]
          Length = 196

 Score = 91.0 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 58/181 (32%), Gaps = 10/181 (5%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFIS 68
           V  +    G    +   +            I+VL   +  R+++   L        + ++
Sbjct: 17  VIGVLVFAGLGYLVSSYQS----KPEKADVIIVLGGDDGPRVDKGGSLFNAGYAPNVVLT 72

Query: 69  GVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           G+     +       ++      + +  I++   +  T   A  + A  ++  +++ ++V
Sbjct: 73  GIDSRYYRPSRPNWRERRLAEAGVPQTAINVDTTSETTWEEALNSVAMMQEKGWNNAIVV 132

Query: 126 THDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +   HM R     +R        FI         + +         R ++ E  K +   
Sbjct: 133 SDPPHMLRLHSTWKRAFKGSSKSFILVATSPEWWKPHLWWQNETSYRFVISEIKKNIYYR 192

Query: 184 I 184
           +
Sbjct: 193 V 193


>gi|332711315|ref|ZP_08431247.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
 gi|332349864|gb|EGJ29472.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
          Length = 281

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 76/239 (31%), Gaps = 57/239 (23%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------I 48
              L V    ++   +      + +   + P   AIV+L G                   
Sbjct: 45  LIVLLVSSNTWVTNSLIRSLEWQYIPNSELPEADAIVILGGATKPPFPPRPTPEVDEAGD 104

Query: 49  RIERAFELLENQIGEKIFISGVHHSV-----------------------SKDILLQKIPI 85
           R+    +L        +  +G                             +   + +I  
Sbjct: 105 RVLYGAQLYREGKAPWVIPAGGRIVWGSSSNNSSQRLSSESGQSSQRLAPESEDMAQILE 164

Query: 86  RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV 145
              +    I    ++LNT  NA       ++ +F  VL+VT   HMPR+ L  +R    +
Sbjct: 165 DLGVPRAAIIQESRSLNTHQNAVNVRKILDQRDFPKVLLVTSAIHMPRSVLVFRRQ--GI 222

Query: 146 QFIPYP----IISHDLEENSSIF------------KIKILRVLLIEYLKILLLSIQLSL 188
             IP P    +  H+L+E SS              ++  +   + EY+ I+   I+  +
Sbjct: 223 DVIPAPTDFLVSQHELDEPSSSSQAALLHSLPNAEQLSRITRAIKEYIGIVAYRIRGWV 281


>gi|282896704|ref|ZP_06304712.1| hypothetical protein CRD_01413 [Raphidiopsis brookii D9]
 gi|281198422|gb|EFA73310.1| hypothetical protein CRD_01413 [Raphidiopsis brookii D9]
          Length = 263

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 66/221 (29%), Gaps = 39/221 (17%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GEPI 48
              L +    ++   +      + +     P   AIVVL                     
Sbjct: 45  LAILMIAGNGWVSKALVGSLEWQNIPPGKIPEAEAIVVLGGATKPAAWPRSTVDLNESGD 104

Query: 49  RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+  A +L   +    I +SG           +   +  I I   +    I     +LNT
Sbjct: 105 RVIYAAQLYGQKKAPLIILSGGRIDWRGSGPPESADMAAILISLGIPPEVIIEEPNSLNT 164

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---------- 153
             NA       E      VL+VT   H PR+    QR    V+ IP P            
Sbjct: 165 YENAVNVRKILESRGIKKVLLVTSAMHTPRSLKIFQRQ--GVEVIPAPTDFIVSRSDLEE 222

Query: 154 ------SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                 S  L    S   +      L EY+  L+ +++  L
Sbjct: 223 LIATPKSTILNLFPSADNLNDFTNALKEYIGYLVYALRGWL 263


>gi|298492074|ref|YP_003722251.1| hypothetical protein Aazo_3520 ['Nostoc azollae' 0708]
 gi|298233992|gb|ADI65128.1| protein of unknown function DUF218 ['Nostoc azollae' 0708]
          Length = 263

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 64/219 (29%), Gaps = 39/219 (17%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GEPIRI 50
            L VC   ++   +      + + + + P   AIVVL                     R+
Sbjct: 47  LLLVCGNAWVAKNLVRSLEWQNIPLAEIPQAEAIVVLGGATKSGVWPRPTVDLSESGDRV 106

Query: 51  ERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
             A +L   +    I +SG           +   +  I     +    I     +LNT  
Sbjct: 107 IYAAQLYRQKKAPIIVLSGGRIDWRGSASQESTDMAAILTSIGIPSEAIIQEPDSLNTYQ 166

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII------------ 153
           NA       E      VL+VT   H PR     QR    +  IP P              
Sbjct: 167 NAVNVKETLENRGIKKVLLVTSAMHTPRALKIFQRQ--GIDVIPAPTDFLVSQGELQELT 224

Query: 154 ----SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                  L        +      L EY+  ++ S++  L
Sbjct: 225 SSPKGAILNLLPDTTNLYQFTNALKEYIGSVIYSLRGWL 263


>gi|189346479|ref|YP_001943008.1| hypothetical protein Clim_0953 [Chlorobium limicola DSM 245]
 gi|189340626|gb|ACD90029.1| protein of unknown function DUF218 [Chlorobium limicola DSM 245]
          Length = 197

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 61/189 (32%), Gaps = 7/189 (3%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQ 60
           RY    +   +      F+S + +              IVVL G+   R+E+  EL  N 
Sbjct: 7   RYLSIFILSVVTVTAAVFLS-LGFAVSYPAQKPEKADVIVVLGGDDGLRVEKGAELYNNG 65

Query: 61  IGEKIFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
               + ++G+     +       ++      + +  I +  ++  T   A  AS   +K 
Sbjct: 66  FAPNVLLTGIDARFYRPGRPNWRERRMRDLGVPKKAIRVDTESETTWEEAVNASETLQKQ 125

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            +   ++V+   HM R     +R+      + I                     R ++ E
Sbjct: 126 KWESAIVVSDPPHMLRIHQTWRRVFEGSSKKIILVSTEPDWWNALLWWKNKTSYRFVISE 185

Query: 176 YLKILLLSI 184
             K +    
Sbjct: 186 IKKNIYYYA 194


>gi|225025892|ref|ZP_03715084.1| hypothetical protein EUBHAL_00120 [Eubacterium hallii DSM 3353]
 gi|224956789|gb|EEG37998.1| hypothetical protein EUBHAL_00120 [Eubacterium hallii DSM 3353]
          Length = 213

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/167 (14%), Positives = 54/167 (32%), Gaps = 22/167 (13%)

Query: 32  PDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH------------------- 71
                  AI +         E A  L ++     +  SG +                   
Sbjct: 30  DKLEKADAIFIPGCARPEHTEEAARLYKDGYAPLLLPSGGYTKVQGSFQGVSKEGQKYGA 89

Query: 72  HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129
               +   L+ + I+  +    I    +A  T  NA++     EK +      ++    +
Sbjct: 90  DFACEADFLEAVLIQNGVPASAILKECEATYTLENAEKTKVLLEKKDIHLKKAILCCKAH 149

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
           H  R++L    +   ++ + YP++   +         +  +V+L E+
Sbjct: 150 HSRRSYLYYSMVFPEIEILVYPVVVDGISREDWYKTAEGRKVVLGEF 196


>gi|225849301|ref|YP_002729465.1| hypothetical protein SULAZ_1499 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644421|gb|ACN99471.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 242

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 77/205 (37%), Gaps = 32/205 (15%)

Query: 10  VCLIFFIMGFISFIRYVKQ------------MHIPDHPSVSAIVVLTGEPI--------- 48
           + ++ F+  F  ++  ++               IP+  +   IVVL G            
Sbjct: 35  IFIVSFLSAFFIYLLSIEPVKDSLLRPLETKYPIPNKLNGDVIVVLGGGSYNTGILTEDS 94

Query: 49  --RIERAFELLENQIGEKIFISGV-HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
             R+   F L +      I   G    ++ +  +++ I     + +  I     + +T G
Sbjct: 95  LKRVLTGFVLHKKLNLPIILSGGSAITNLPEAEVMKNILNELGVDKSMIYTDVNSRDTLG 154

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           NA       EKN F  +++VT  YHMPR+ +  Q+    +  IPYP      +  +    
Sbjct: 155 NAFFVKKICEKNGFKRIILVTSAYHMPRSVIVFQKA--GLDVIPYPTDFKMDKRYTVYSY 212

Query: 166 IKILRVL------LIEYLKILLLSI 184
              + VL      + EY+ ++   +
Sbjct: 213 FPKMNVLQDSTKAIREYVGLIAYQL 237


>gi|78357887|ref|YP_389336.1| hypothetical protein Dde_2846 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78220292|gb|ABB39641.1| hypothetical protein Dde_2846 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 280

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 57/198 (28%), Gaps = 18/198 (9%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
              +  +    G +         + P       +VVL G   R   A +L        ++
Sbjct: 83  AAILLCVLGAGGLLWIAGNATTEYPP--RKADVMVVLGGGLHRAMFAADLYNRGYAPVVY 140

Query: 67  ISG-------------VHHSVSKDILLQKIPIRQDLAECCI-DIGYKALNTEGNAQEASA 112
           +S               +    +  +  +I   + +    I   GY  ++T G A+  + 
Sbjct: 141 VSRTRPRREAGVMKQHGYRMPDEPEMYVRILTDKGVPMRDIRMYGYDLISTVGEAEALAG 200

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
                    VL+VT   H PR  +  +        +                     R L
Sbjct: 201 ILGDRKL-TVLVVTAPVHAPRAGMVFRHALPRCSILTAGSPYDPF-PQRWWNDQDAARNL 258

Query: 173 LIEYLKILLLSIQLSLST 190
           L+E +K L      +  T
Sbjct: 259 LLEGIKTLFYLAGGAFRT 276


>gi|75675900|ref|YP_318321.1| hypothetical protein Nwi_1708 [Nitrobacter winogradskyi Nb-255]
 gi|74420770|gb|ABA04969.1| Protein of unknown function DUF218 [Nitrobacter winogradskyi
           Nb-255]
          Length = 280

 Score = 89.9 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 66/218 (30%), Gaps = 36/218 (16%)

Query: 4   FWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVSAIVVLT-------------- 44
                   L+ F         +  +         D      I+VL               
Sbjct: 56  LLMAGIAALLIFGYSPLGNVLLLTLSERFPAWQHDGRDPDGIIVLGGAVDADISVSRGAV 115

Query: 45  ---GEPIRIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDI 96
                  R+  A EL       +I  SG   ++      +  ++ ++  +  +    I +
Sbjct: 116 ETNASAERVIAALELARRFPKARIVYSGGAGNLIAGLRAEAPVMGRLFEQFGIPRERIVL 175

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-SH 155
             ++  T+ NA+      +  +    L+VT  YHMPR+    ++        PYP+    
Sbjct: 176 ETRSRTTDENARFTRELVKPESGERWLLVTSAYHMPRSVGVFRKA--GFDVEPYPVDWRT 233

Query: 156 DLEENSSIF------KIKILRVLLIEYLKILLLSIQLS 187
               ++ +        +        E++ +L+  +   
Sbjct: 234 RGWIDAWMPFDKLSAGLARADTAAHEWVGLLVYRMTGR 271


>gi|326386450|ref|ZP_08208073.1| hypothetical protein Y88_2345 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209111|gb|EGD59905.1| hypothetical protein Y88_2345 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 194

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/183 (25%), Positives = 85/183 (46%), Gaps = 14/183 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
            F   L + ++ +++GF+ F  ++ +    DH    A++ LTG   RI+R  E+L     
Sbjct: 9   LFRRILSLMVLAWLLGFLWFALFLPR--PADHTRTDAVIALTGGSGRIQRGIEVLRADEA 66

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +++ +SGV   V       +  +   L  CC+ +GY++ +T  NA EA+ W  + +   V
Sbjct: 67  KRMLVSGVDSEVKPAEFEAEYGVPASLFACCMTLGYESFDTRSNALEAARWIARYDLRSV 126

Query: 123 LIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
            +VT D+HM R   +L       +  +   + SH             +R+L +EY K L 
Sbjct: 127 RLVTTDWHMRRAAFDLAVAAPKGLVIVEDAVPSH-----------PSMRILFVEYNKFLA 175

Query: 182 LSI 184
             +
Sbjct: 176 RML 178


>gi|309781486|ref|ZP_07676222.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308919899|gb|EFP65560.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 168

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 59/175 (33%), Gaps = 8/175 (4%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVH 71
           + F    +   +   +   P       IVVL      R+  A EL       ++F+SG  
Sbjct: 1   MVFSAVLVCGAKSWLR-EEPRLAHADVIVVLGGESGQRVIGAAELYHAGAAPRVFVSGQG 59

Query: 72  HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHM 131
             +    L+++  +   +    I     + +T  NA+              ++VT  YH 
Sbjct: 60  DCL----LIERRLVMAGVPAERIGHECVSGSTMENARMTRETLAGQQVQSAILVTSWYHT 115

Query: 132 PRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
            R     ++    + +    +   D    S          +L EY+K +  +++ 
Sbjct: 116 GRALAVFRKAWPEITWGAQGVFPGDTLAKSVPVYEAGS--ILAEYVKRVWYAVRY 168


>gi|148657753|ref|YP_001277958.1| hypothetical protein RoseRS_3653 [Roseiflexus sp. RS-1]
 gi|148569863|gb|ABQ92008.1| protein of unknown function DUF218 [Roseiflexus sp. RS-1]
          Length = 191

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 68/189 (35%), Gaps = 5/189 (2%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEK 64
             L +  +    G+                   AIVVL G  P+R + A +L       +
Sbjct: 1   MLLTIAALTVSAGWWLPALGGLLALEGRPAHADAIVVLGGGFPLRDQHAIDLYREGWARE 60

Query: 65  IFISGVHHSVSKD-ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           I+ +G     S      +++ ++Q + E          +T  + +E +  A++ +   +L
Sbjct: 61  IWRTGDLPGGSVVLQKARRLALQQGVPETAFVP-VATDSTWADGREIARMAQERHAQRLL 119

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPY--PIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           IVT   H  R    + R  +    + +           ++     +  R++  E LK + 
Sbjct: 120 IVTEWPHSRRAMCVINRHLAGTGVVAFYDGPRHPPYTPSNWWRDPEGRRIVSGEMLKTIY 179

Query: 182 LSIQLSLST 190
             ++  ++ 
Sbjct: 180 YLLRFGVTP 188


>gi|320161712|ref|YP_004174937.1| hypothetical protein ANT_23110 [Anaerolinea thermophila UNI-1]
 gi|319995566|dbj|BAJ64337.1| hypothetical protein ANT_23110 [Anaerolinea thermophila UNI-1]
          Length = 264

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 78/223 (34%), Gaps = 41/223 (18%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------I 48
            + L V    ++   ++     + +      S  A+VVL G                   
Sbjct: 44  LFILLVSSNRWVATTLARSLEWQYLPNEPISSAPAMVVLGGGTEPAFPPRSQPEVNSAGD 103

Query: 49  RIERAFELLENQIGEKIFISGVH------HSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
           R+  A  L +      + +SG +       S +    ++ +     +    I    ++ N
Sbjct: 104 RVLYAAALYQQGKAPLVIVSGGNVAFRGEQSSTPASDMRHLLKMLGVPPEAILEEDQSQN 163

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP------------- 149
           T  NA   +   ++ +   V++VT   HMPR+    ++    ++ IP             
Sbjct: 164 TYENALYCAKLLKERHIQRVILVTSALHMPRSVKLFEKQ--GIEVIPAPADFAVPFQEWE 221

Query: 150 ----YPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                PI +  +    S   +++   +L EY+ IL+  ++  L
Sbjct: 222 DLLHAPIPAQLVALLPSSSNLQLTTNVLHEYIGILVYWMRGWL 264


>gi|332283765|ref|YP_004415676.1| membrane protein [Pusillimonas sp. T7-7]
 gi|330427718|gb|AEC19052.1| membrane protein [Pusillimonas sp. T7-7]
          Length = 254

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/213 (17%), Positives = 78/213 (36%), Gaps = 27/213 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------ 48
           + +  +        +  G     +        + P+  AIVVL G               
Sbjct: 44  LSWALFWSLPASSLWAGG--RLEQLHPYEQAANAPTAQAIVVLGGHTANGRQNWFEPYDK 101

Query: 49  -----RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
                RI++A  L + Q    I +SG     +VS+  ++     + D+ E  I +  ++ 
Sbjct: 102 ATAIARIDKAANLYKAQRAPLIVVSGAALEGNVSEAQIMANALKQHDIPESAIIMESRSF 161

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHDLE 158
            T  NA   +    + +  ++L+VT   HMPR     ++        P     ++  D  
Sbjct: 162 TTHENAIYTAETLRQRHIQNILLVTSALHMPRAMAVFKKQGIAAIAAPLAPQIVVPDDPG 221

Query: 159 ENSS---IFKIKILRVLLIEYLKILLLSIQLSL 188
            +     +  +   R ++ EY+ +L+  ++  +
Sbjct: 222 FSFWQPDMRSLAASRSIVKEYVGLLVYWVRGWI 254


>gi|119485358|ref|ZP_01619686.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
 gi|119457114|gb|EAW38240.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
          Length = 263

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 78/225 (34%), Gaps = 42/225 (18%)

Query: 4   FWYGLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEP------------- 47
              GL V L     G    +      + +   + P  +AIVVL G               
Sbjct: 41  IALGLLVLLTSSNSGVSQSLVRSLEWQNIPNGELPKATAIVVLGGGTKAPTPPRPWVDVG 100

Query: 48  ---IRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYK 99
               RI     L +      + +SG           +   +++I +   + E  I     
Sbjct: 101 EAGDRILYGALLYKQDKAPWLILSGGRIQWDGKEPPESADMKEIAVEMGVRESAILQDPD 160

Query: 100 ALNTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IIS 154
           +LNT  NA        +NN    VL+VT   HMPR+ L  QR    ++ IP P    +  
Sbjct: 161 SLNTYQNAVNVRQILAENNLTGKVLLVTSALHMPRSLLVFQRQ--GIEVIPAPTDFLVSQ 218

Query: 155 HDLEEN-----------SSIFKIKILRVLLIEYLKILLLSIQLSL 188
            DL+ +                ++     L EY+ +++  ++  L
Sbjct: 219 QDLQPSTTIQGRILNLIPDTQSLQQFTQALKEYIGMIVYRLRGWL 263


>gi|13470862|ref|NP_102431.1| hypothetical protein mll0674 [Mesorhizobium loti MAFF303099]
 gi|14021605|dbj|BAB48217.1| mll0674 [Mesorhizobium loti MAFF303099]
          Length = 265

 Score = 89.1 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 69/223 (30%), Gaps = 33/223 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------- 47
           F               ++ +   +    P    V  IVVL G                  
Sbjct: 46  FLILALSTWTSLGAMMLNPLEE-RFPRPPLPQKVDGIVVLGGGFEGAINLARGGYELSSS 104

Query: 48  -IRIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKAL 101
             R+     L       K+ +SG H +             ++ +   ++   + +  K+ 
Sbjct: 105 GDRMVETAILARRFPLAKVVVSGGHGAFFIDAEGDADSASRMLVPLGVSADRLVLEDKSR 164

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH------ 155
           NT  NA  +    E       L+VT  +HMPR      +       +P+P+  H      
Sbjct: 165 NTYENAIFSRKLVEPKPGETWLLVTSAFHMPRAKALFDKA--GFPTVPWPVDYHTSGKEG 222

Query: 156 -DLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFF 197
             L  +++I  ++   + L E++ +    +   +  Q      
Sbjct: 223 VGLFRDNAIDSVQNTTIALREWIGLFAYWLSGRID-QPFPGPG 264


>gi|311032605|ref|ZP_07710695.1| hypothetical protein Bm3-1_19074 [Bacillus sp. m3-13]
          Length = 207

 Score = 89.1 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 64/169 (37%), Gaps = 12/169 (7%)

Query: 26  VKQMHIPDHPSVSAIVVLTGE---PIRIERAFELLENQIGEKIFISGVHHS----VSKDI 78
           + +    D+ +   I V         R+  A +L +     KI  SG        +S+  
Sbjct: 22  LFKNIKDDNRNGDCIFVPGSSKAVQYRLPPAIQLYQEGRAGKILFSGGVVWDGNQLSEAQ 81

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRT 134
           LL +  +   +    I I  ++L+T+ N   +    ++    +    +++VT  YHM R 
Sbjct: 82  LLAEKAMELGVPSEDILIENQSLHTKENVLASLLVLDRALHLHKISRLIVVTSHYHMRRM 141

Query: 135 FLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
            L+L+      + +   P+      E++        + +  E  K++  
Sbjct: 142 NLKLRTYMPDWIDYSLCPVNDRTTREDNWFLNPYGRQRVEAESAKLISY 190


>gi|147677433|ref|YP_001211648.1| hypothetical protein PTH_1098 [Pelotomaculum thermopropionicum SI]
 gi|146273530|dbj|BAF59279.1| uncharacterized conserved protein [Pelotomaculum thermopropionicum
           SI]
          Length = 148

 Score = 88.7 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 54/150 (36%), Gaps = 5/150 (3%)

Query: 40  IVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYK 99
           I+ L G+  R   A EL    +  +I +SG     S    +        + E  I +  K
Sbjct: 2   IIALGGDSERELYAAELYRRGLAPRIIMSG---CGSAAKQMAMKAAAAGVGEQDIIVENK 58

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS--TVQFIPYPIISHDL 157
           + +T  NA           F   ++VT  YHM R  L  +R+     V+       +   
Sbjct: 59  SGSTYQNALYTKDIVLSRGFKSAIVVTSPYHMRRARLVFERVFRNTGVKLFYCAAKNSGF 118

Query: 158 EENSSIFKIKILRVLLIEYLKILLLSIQLS 187
             +         ++ L E++K++    +  
Sbjct: 119 NADGRCSSKADRQITLREWIKLVYYWFRYW 148


>gi|75906624|ref|YP_320920.1| hypothetical protein Ava_0399 [Anabaena variabilis ATCC 29413]
 gi|75700349|gb|ABA20025.1| Protein of unknown function DUF218 [Anabaena variabilis ATCC 29413]
          Length = 263

 Score = 88.7 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 71/215 (33%), Gaps = 39/215 (18%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------IRIERAF 54
           C   ++  ++      + +     P+  AI+VL G                   R+  A 
Sbjct: 51  CSNAWVAKYLVRSLEWQNLPPAQLPNAEAIIVLGGATKSVFPPRITPDLSEQGDRVIYAA 110

Query: 55  ELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           +L        I +SG           +   +  I     +    +     +LNT  NA  
Sbjct: 111 QLYRQNKAPLIILSGGRIDWRGSGSSESTDMANILTSLGIPASVLIEEPDSLNTYQNAVN 170

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENSSIFK 165
                       VL+VT   HMPR+    QR    +  IP P    + + +L+E  +  K
Sbjct: 171 VKKILASRGIDKVLLVTSALHMPRSLKIFQRQ--GMNVIPAPTDFLVSAGELQELGNTPK 228

Query: 166 IKILRVL------------LIEYLKILLLSIQLSL 188
             IL +L            L EY+   +  ++  +
Sbjct: 229 AAILNLLPDTYNLHLFTNALKEYVGSFIYWLRGWV 263


>gi|156740504|ref|YP_001430633.1| hypothetical protein Rcas_0485 [Roseiflexus castenholzii DSM 13941]
 gi|156231832|gb|ABU56615.1| protein of unknown function DUF218 [Roseiflexus castenholzii DSM
           13941]
          Length = 225

 Score = 88.7 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 60/179 (33%), Gaps = 5/179 (2%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEKIFISGVHHSV 74
             G+                   AIVVL G  P+R + A +L       +I+ +G     
Sbjct: 45  SAGWWLPALGSLLALPGRTARADAIVVLGGGFPLRDQHAIDLYREGWAREIWRTGEMPGG 104

Query: 75  SK-DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR 133
           S      +++ I+Q +            +T  + +E +  A +     V+IVT   H  R
Sbjct: 105 SAVVQKARRLAIQQGVPAAAFVP-LITDSTWTDGREIARMARERKVERVIIVTDWSHSRR 163

Query: 134 TFLELQR--INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLST 190
               ++     S ++       +            +  R++  E LK     ++  ++ 
Sbjct: 164 ALCVIKHHLAGSGIEAFYDGPRNPPYTPFDWWHHPEGRRIVAGELLKTFYYLLRFGVTP 222


>gi|110597465|ref|ZP_01385752.1| Protein of unknown function DUF218 [Chlorobium ferrooxidans DSM
           13031]
 gi|110341009|gb|EAT59480.1| Protein of unknown function DUF218 [Chlorobium ferrooxidans DSM
           13031]
          Length = 196

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 63/188 (33%), Gaps = 8/188 (4%)

Query: 3   YFWYGLFVCLIFFIMGFISFI--RYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLEN 59
           +    LF  L         F+   ++  ++  +      I+VL G+   R+ +  EL  +
Sbjct: 4   FLKLTLFALLSVCGAASAIFLTLGFLVSLYAGNPEKTDVIIVLGGDSGLRVRKGAELYNS 63

Query: 60  QIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
                + ++G+             ++  I+  + +  I +  ++  T   A  A+   EK
Sbjct: 64  GYASHVILTGIDERFYRPAHPNWRERRMIKLGVPKKAIRVDTQSTTTWEEAVNAADTMEK 123

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             +   ++V+   HM R      +       +FI                  K  + ++ 
Sbjct: 124 KGWKSAIVVSDPPHMLRLHQTWSKAFKGSSKRFILVSTKPEWWRPFVWWKNKKSYQFVIN 183

Query: 175 EYLKILLL 182
           E  K L  
Sbjct: 184 EIKKNLYY 191


>gi|282900121|ref|ZP_06308078.1| protein of unknown function DUF218 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195003|gb|EFA69943.1| protein of unknown function DUF218 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 263

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 70/226 (30%), Gaps = 42/226 (18%)

Query: 3   YFWYGLFVCLIF---FIMGFISFIRYVKQMHIPDHPSVSAIVVLT--------------- 44
           +    L + +I    ++   +      + + +   P   AIVVL                
Sbjct: 40  WIGISLAILIISGNGWVSKSLVASLEWQNIPLEKIPQAEAIVVLGGATKPAAWPRSTVDL 99

Query: 45  -GEPIRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGY 98
                R+  A +L   +    I +SG           +   +  I I   +    I    
Sbjct: 100 NESGDRVIYAAQLYGQKKAPLIILSGGRIDWRGGGTPESADMATILISLGIPPEVIIEEP 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII----- 153
            +LNT  NA       E      VL+VT   H PR+    QR    V+ IP P       
Sbjct: 160 NSLNTYENAVNVKKILESRGIKKVLLVTSAMHTPRSLKIFQRQ--GVEVIPAPTDFIVSR 217

Query: 154 -----------SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                      S  L    S   +      L EY+  L+ +++  L
Sbjct: 218 SDLEELIATPKSTILNLFPSADNLNDFTNALKEYIGYLVYALRGWL 263


>gi|260459193|ref|ZP_05807448.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034747|gb|EEW36003.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
          Length = 265

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 66/215 (30%), Gaps = 32/215 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------- 47
           F               ++ +   +    P    V  IVVL G                  
Sbjct: 46  FLILALSAWTSLGAMMLNPLEE-RFARPPLPQKVDGIVVLGGGFEGAINLTRGGYELSSS 104

Query: 48  -IRIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKAL 101
             R+     L       K+ +SG + S+            ++     ++   + +  K+ 
Sbjct: 105 GDRMVETAILARRFPQAKVVVSGGNGSLFLDGEGDADTAPRLLGPLGVSADRLVLEDKSR 164

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH------ 155
           NT  NA  +    E       L+VT  +HMPR      +       +P+P+         
Sbjct: 165 NTYENAVFSRKLVEPKPGETWLLVTSAFHMPRAKALFDKA--GFPTVPWPVDYRTSGKEG 222

Query: 156 -DLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
             L  +++   ++   + + E++ +    +   + 
Sbjct: 223 VGLFRDNAADSLENTTMAIREWIGLFAYWLSGRID 257


>gi|241663925|ref|YP_002982285.1| hypothetical protein Rpic12D_2339 [Ralstonia pickettii 12D]
 gi|240865952|gb|ACS63613.1| protein of unknown function DUF218 [Ralstonia pickettii 12D]
          Length = 190

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 58/183 (31%), Gaps = 7/183 (3%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGE 63
           W G    +       +           P       IVVL      R+  A EL       
Sbjct: 14  WIGGCAIVAMAFSAVLVCGAKSWLREEPRLAHADVIVVLGGESGQRVIGAAELYHAGAAP 73

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++F+SG    +    L+++  +   +    I     + +T  NA+              +
Sbjct: 74  RVFVSGQGDCL----LIERRLVMAGVPAGRIGHECVSGSTMENARMTRQTLAGQQVQSAI 129

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT  YH  R     +++   + +    +   D    S          +L EY+K    +
Sbjct: 130 LVTSWYHTGRALAVFRKVWPEITWGAQGVFPGDTLAKSVPVYEAGS--ILAEYVKRAWYA 187

Query: 184 IQL 186
           ++ 
Sbjct: 188 VRY 190


>gi|37523632|ref|NP_927009.1| hypothetical protein gll4063 [Gloeobacter violaceus PCC 7421]
 gi|35214637|dbj|BAC92004.1| gll4063 [Gloeobacter violaceus PCC 7421]
          Length = 260

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 66/215 (30%), Gaps = 33/215 (15%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GEP 47
            W G F           S      ++ + ++PS  AIVVL                    
Sbjct: 47  LWLGSFSAPAVADALLWSLESQYPEVPVENNPSAQAIVVLGGALHLPNARHRTYELAESS 106

Query: 48  IRIERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIPIRQDLAECCIDIGYKA 100
            R+  A  L +      + +SG +           +   +        +    I    ++
Sbjct: 107 DRVLHAARLFKAGKAPVVLMSGGNPPFHTRPDQPPEATQMAAFARELGVPAGAILTEERS 166

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH----- 155
            NT  NA  ++   +      +L+VT   HMPR+    +R       I            
Sbjct: 167 WNTFQNAAFSAEVLKARRMTRILLVTSASHMPRSVAIFERA--GFAVIAASTDVRSGTDL 224

Query: 156 DLEENSSIFKIKILR---VLLIEYLKILLLSIQLS 187
           D    + +     L    + L E++ +L+  ++  
Sbjct: 225 DDWLLAWLPSAAALESSTLALKEWVGLLVYRLRGW 259


>gi|145219718|ref|YP_001130427.1| hypothetical protein Cvib_0911 [Prosthecochloris vibrioformis DSM
           265]
 gi|145205882|gb|ABP36925.1| protein of unknown function DUF218 [Chlorobium phaeovibrioides DSM
           265]
          Length = 196

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 61/182 (33%), Gaps = 7/182 (3%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-IRIERAFELLENQIGEKI 65
            L V      +GF+  + Y+   H         I+VL G+   R++    L +   G ++
Sbjct: 11  FLLVLSAIGALGFLG-LGYIVSFHAAPPVQSDVIIVLGGDSGRRVKHGAALYKEGYGARV 69

Query: 66  FISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++G+     +       ++      +    + +  ++  T   A  +SA  ++  +   
Sbjct: 70  VLTGIDRRFYRKGHLNWRERRMKALGVPLNAVLVDTRSETTWDEAVNSSALMKQRGWRTA 129

Query: 123 LIVTHDYHMPRTFLELQRINSTVQ--FIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           L+V+   HM R     +         F+         +           R ++ E  K L
Sbjct: 130 LVVSDPPHMLRLKKTWEAAFEGTDQTFVLTATKPGWWDPLLWWRNPISYRFVISEVKKNL 189

Query: 181 LL 182
             
Sbjct: 190 FY 191


>gi|182678647|ref|YP_001832793.1| hypothetical protein Bind_1673 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634530|gb|ACB95304.1| protein of unknown function DUF218 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 284

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 76/235 (32%), Gaps = 40/235 (17%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVK--QMHIPDHPSVS--AIVVLTGEPI--------- 48
           R     + +     +  F +F+      +   PD  ++    I+VL G            
Sbjct: 40  RLQAIAILLLAFVLLTPFGAFVVRPLEDRFPNPDLHAIDPAGIIVLGGGMDSRESKARGV 99

Query: 49  --------RIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCID 95
                   R+    EL       K+  +G          S+ I  +++     +    + 
Sbjct: 100 PILNTAGSRMTAGVELSRLFPQAKLIFTGGSGDLMGDQPSESIYARELWQNLGVPAEQMV 159

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               + NT  NA       +       L+VT   HMPR+    +++      IPY     
Sbjct: 160 FEGNSRNTWENAVFTRDLIKPKPEDRYLLVTSAAHMPRSVGIFRKV--GFNVIPYNANYM 217

Query: 156 DLEENSSIF-------KIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEE 203
            + +            ++++L   L E++ +L   +     T   S FF   +E+
Sbjct: 218 TIGDARDWSVTTLAHDRLRMLSFGLREWIGLLAYRL-----TGKTSDFFPGPVEQ 267


>gi|116329099|ref|YP_798819.1| hypothetical protein LBL_2520 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330291|ref|YP_800009.1| hypothetical protein LBJ_0560 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116121843|gb|ABJ79886.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123980|gb|ABJ75251.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 273

 Score = 87.9 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 77/224 (34%), Gaps = 36/224 (16%)

Query: 2   RYFWYGLFVCLIFFIMG------FISFIRYVKQMHIPDHPSVSAIVVLT----------- 44
           ++  +   + L              S   Y   + +   P    I+VL            
Sbjct: 39  KFSVWAPVLILWLLSTSNISQKLIQSLEIYYPPLPLEQVPRADVILVLGGMVSTLSIHNK 98

Query: 45  -----GEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCI 94
                    R+     L   +   KI  SG      + +V +     +   +  + +  +
Sbjct: 99  PVDLSNSAERLTETVRLYRAKKAPKILFSGGSGNLLYQTVPESEPAGRFLKQMGIPDSSL 158

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  K+ NT  N   A    +K+ +  V++VT  +HM R+    Q     +  IP+P   
Sbjct: 159 ILESKSRNTVENKNFAVELLKKHGWSSVILVTSSFHMKRSVEIFQE--KGITIIPFPTDF 216

Query: 155 HD----LEENSSIFK---IKILRVLLIEYLKILLLSIQLSLSTQ 191
                 L  ++       ++   + + E++ IL+  I+ ++S Q
Sbjct: 217 RTQKSVLTLDNFFPSTGCLENSTISIKEWIGILVHKIRTTISIQ 260


>gi|254479072|ref|ZP_05092426.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214034988|gb|EEB75708.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 192

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/199 (18%), Positives = 72/199 (36%), Gaps = 22/199 (11%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
           R+    + +    F +  I   + V            AI+VL               R+E
Sbjct: 3   RFLKLVVVLIFALFSIIAILAYQIVSFGFTEKPKKSDAIIVLGCAVYGDTPSPFFKERLE 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A +L +   G  I ISG      S+S+    ++  + + +A   I +  K+ +T  N  
Sbjct: 63  EALKLYKEGYGHYIIISGGKGPGESISEAEAGKRYLLEKGVASKNILLDNKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            +    EKN+    +IV++ +H+ R  +  +RI   +      +   +   +        
Sbjct: 123 FSKEIMEKNSLKTAIIVSNKFHLKRASVIAKRI--GIDASFSGVFVKEYVGDEVYG---- 176

Query: 169 LRVLLIEYLKILLLSIQLS 187
               L E L +L   ++  
Sbjct: 177 ---FLREVLALLYTYLRGW 192


>gi|163852418|ref|YP_001640461.1| hypothetical protein Mext_3001 [Methylobacterium extorquens PA1]
 gi|163664023|gb|ABY31390.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 278

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 65/210 (30%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
           F   L   L       ++ +         D   V+ IVVL                    
Sbjct: 60  FVGLLVAGLSPLSAWTLAPLENRFPSFTDDGTPVTGIVVLGGTVEADTSIGRDQITVNEA 119

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R     +L       ++  SG        +VS+  ++ +      +    + +  ++ 
Sbjct: 120 GERAIALADLARRYPQARLVFSGGAGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSR 179

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  ++   +       L+VT  +HMPR+    ++         YP+         
Sbjct: 180 NTHENAVFSARMVQPKPGERWLLVTSAWHMPRSMGCFRKA--GFDVTAYPVDYRTNWPRD 237

Query: 162 SIF-------KIKILRVLLIEYLKILLLSI 184
           +          +  L + + E++ ++   +
Sbjct: 238 AYRLASFASDGLGELDIGVKEWIGMIAYRL 267


>gi|322382281|ref|ZP_08056191.1| hypothetical protein PL1_3077 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153783|gb|EFX46154.1| hypothetical protein PL1_3077 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 195

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/164 (17%), Positives = 61/164 (37%), Gaps = 12/164 (7%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGE---PIRIERAFELLENQIGEKIFISGVHHSV----SK 76
           R +      D      I V   +     R+ +A EL +     KI  SG +        +
Sbjct: 13  RLLFHQIKDDGRQGDCIFVFGSQRSLAYRVPKAIELYKQGRAGKILFSGGNQWEGQEDVE 72

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS----AWAEKNNFHHVLIVTHDYHMP 132
            +++++  I + + E  I    ++ +T  N   +          +    +LIVT  +HM 
Sbjct: 73  ALVMKQGAINEGIPETDIITEIRSTSTRENVLSSLLELDRAMGLHRLKRILIVTTAFHMR 132

Query: 133 RTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           R +L ++      +++   P+      E++       ++ +  E
Sbjct: 133 RCYLNMRTYMPEWIEYSLCPVDDRKTREDNWFLHETGIQRVTDE 176


>gi|317485960|ref|ZP_07944815.1| DUF218 domain-containing protein [Bilophila wadsworthia 3_1_6]
 gi|316922733|gb|EFV43964.1| DUF218 domain-containing protein [Bilophila wadsworthia 3_1_6]
          Length = 185

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 64/183 (34%), Gaps = 10/183 (5%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIF 66
           L +  +      I        + +P       IVVL      R+  A EL    +  K+F
Sbjct: 12  LAIAALLIGAVLIWRAEAWLHVDVP-LEHADVIVVLGGESGQRVIGAAELYHQGVAPKVF 70

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           ++G         L+ +      + +       ++ +T  NA       E ++   V++VT
Sbjct: 71  VTGSGD----GGLIVRRLGMAGVPDAA--CESQSRSTYENAVLTKKALEASHPRSVMLVT 124

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
             +H  R     + +   V F  +P+ +              +  +  EY+K L   ++ 
Sbjct: 125 SWFHSRRALAVFRDVWPEVTFGVHPVYAGATFTARFRIYE--MGYIFSEYVKTLWYMVRY 182

Query: 187 SLS 189
            ++
Sbjct: 183 GIA 185


>gi|119512087|ref|ZP_01631180.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
 gi|119463245|gb|EAW44189.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
          Length = 263

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 72/219 (32%), Gaps = 39/219 (17%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------IRI 50
            L VC   ++   +      + +     P+  AIVVL G                   R+
Sbjct: 47  LLLVCSNAWVAKSLVRSLEWQYLPPNPVPNAEAIVVLGGATKSAYPPRPTVDLSETGDRV 106

Query: 51  ERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKALNTEG 105
             A +L        I +SG           +   +  +     +    I     +LNT  
Sbjct: 107 IYAAQLYRQNKAPIIILSGGRIDWRGGGESESADMANVLTSIGIPSEVIVQEPDSLNTYQ 166

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENS 161
           NA       E      VL+VT   HMPR+    QR    +  I  P    +   +L+E S
Sbjct: 167 NAVNVKKILESRGIGKVLLVTSAMHMPRSIQIFQRQ--GINAIAAPTDFLVSQGELQELS 224

Query: 162 SIFKIKILRVL------------LIEYLKILLLSIQLSL 188
           S  K  IL +L            L EY+   + S +  L
Sbjct: 225 STPKAAILNLLPDSNNLQQFTSALKEYIGSFVYSWRGWL 263


>gi|238021623|ref|ZP_04602049.1| hypothetical protein GCWU000324_01525 [Kingella oralis ATCC 51147]
 gi|237866237|gb|EEP67279.1| hypothetical protein GCWU000324_01525 [Kingella oralis ATCC 51147]
          Length = 213

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/197 (17%), Positives = 67/197 (34%), Gaps = 18/197 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           +RY +    + +          +               A VVL               RI
Sbjct: 10  LRYGFLLSILSIFALQAWCAWQVYQYAHAPAALPKHADAAVVLGAAAWGDKPSPVFRERI 69

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +++  EK+  +G        S+  + +K  ++Q +    I    ++ +T  N 
Sbjct: 70  NHAIALYQSERVEKLIFTGGTRKEGYPSEGEVARKFALKQGIPSHDIIYETRSKDTYQNL 129

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
                  +K+  HHV+IV+  YHM R     + +   +   P P  +    E S   +  
Sbjct: 130 VNTRLLMQKHKLHHVIIVSDPYHMARAIAIARDL--GIPATPSPTPTSRYTEAS---EQA 184

Query: 168 ILRVLLIEYLKILLLSI 184
             +  + E   + +  +
Sbjct: 185 RWKFFIEESYSLFIYRL 201


>gi|90419579|ref|ZP_01227489.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336516|gb|EAS50257.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 263

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 67/209 (32%), Gaps = 31/209 (14%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRI 50
           L VC +  +   ++ +   +       P++  I+VL                      R+
Sbjct: 49  LAVCSLTPLGLVMTAVLEDRFPRPDLPPAIDGIIVLGGAFDTRVARTRGMNELNDAADRV 108

Query: 51  ERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
               EL +     K+  SG         + +    + +     LA   + +  +A +T  
Sbjct: 109 TAGMELAQRYPKAKLLFSGGVAALLEEDIPETEAAEALYRGLGLAPDRLLLDGRARDTFE 168

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI-- 163
           NA  A   A+       ++VT   HMPR     +        +PYP+        +    
Sbjct: 169 NAVFAKELAQPKPGEVWVLVTSASHMPRAVGCFRVA--GFDIVPYPVDYRTPSGPALWRP 226

Query: 164 -----FKIKILRVLLIEYLKILLLSIQLS 187
                  ++ +   + EYL ++   +   
Sbjct: 227 SSTTTRNLEKVHFAIREYLGLVAYRLSGR 255


>gi|110633719|ref|YP_673927.1| hypothetical protein Meso_1366 [Mesorhizobium sp. BNC1]
 gi|110284703|gb|ABG62762.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 266

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 67/210 (31%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------- 47
           F          F    +  +        P    V  I+VL G                  
Sbjct: 46  FLVVALAGWTTFGAMLLHPLESRFARPDPAPQHVDGIIVLGGGFEGAVNLARGGYELNDS 105

Query: 48  -IRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R   A  L       ++ +SG                 ++     +A   I++  ++ 
Sbjct: 106 GDRFVEAAILARRYPEARLIVSGGSGSVFLPGEGDADTAPRLLTALGVAPERIELDNRSR 165

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS------- 154
           +T  NA+ + + AE       L+VT  +HMPR     ++       +P+P          
Sbjct: 166 DTFENARFSMSMAEPGPDETWLLVTSAFHMPRAVGAFRQA--GFPILPWPADYKTTGREK 223

Query: 155 HDLEENSSIFKIKILRVLLIEYLKILLLSI 184
             L +++ +  ++   + + E++ +L   +
Sbjct: 224 PGLTDDNVLDSLRNTSIGIREWVGLLAYRM 253


>gi|27380091|ref|NP_771620.1| hypothetical protein bll4980 [Bradyrhizobium japonicum USDA 110]
 gi|27353245|dbj|BAC50245.1| bll4980 [Bradyrhizobium japonicum USDA 110]
          Length = 301

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/213 (12%), Positives = 53/213 (24%), Gaps = 31/213 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------------- 46
                           +  +        P   +   I+VL G                  
Sbjct: 80  LVLLALAAFSPLGNLLLYPLESRFPKWDPSRGAPDGIIVLGGSVDTDLSAAHRTPVVASA 139

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+    EL       +I  +G   ++      +      I     + +  + +   + 
Sbjct: 140 ADRMLAPAELARRFPNARIVFTGGSANLVSTDAKEADYSAPILESLGIPKERLIVERDSR 199

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA               L+VT  +HMPR      +         YP+       + 
Sbjct: 200 NTWENAVFTKQLVSPKPGERWLLVTSAFHMPRAMGIFHKA--GFDVEAYPVDWRMGGRDD 257

Query: 162 SI-------FKIKILRVLLIEYLKILLLSIQLS 187
                      +    V + E++ +L   +   
Sbjct: 258 LFAFTHIGKEGLGRTDVAMREWIGLLTYRVMGR 290


>gi|78186865|ref|YP_374908.1| hypothetical protein Plut_1003 [Chlorobium luteolum DSM 273]
 gi|78166767|gb|ABB23865.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 196

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 61/184 (33%), Gaps = 7/184 (3%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-IRIERAFELLENQIGEKI 65
            L V  I    GF+S + ++             IV+L G+   R+ +  EL  N    ++
Sbjct: 11  ILLVAAILAGAGFLS-LGFLLSCQAGTPEKTDVIVILGGDSGRRVRKGAELYRNGYAPRV 69

Query: 66  FISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
            ++G+     +       QK  +   +    I +  ++  T   A   +   ++N +   
Sbjct: 70  ILTGIDERYYRPGKLNWRQKRMVALGVPLSAISVDSRSETTWEEAFNTAETMKRNGWKKA 129

Query: 123 LIVTHDYHMPRTFLELQRINSTV--QFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           L+V+   HM R      +        FI                     R +  E  K L
Sbjct: 130 LVVSDPPHMFRLKSTWMQAFRKTPRSFILIATSPEWWNPVLWWKNSISSRFVYSELKKNL 189

Query: 181 LLSI 184
             ++
Sbjct: 190 FYAL 193


>gi|218531176|ref|YP_002421992.1| hypothetical protein Mchl_3226 [Methylobacterium chloromethanicum
           CM4]
 gi|218523479|gb|ACK84064.1| protein of unknown function DUF218 [Methylobacterium
           chloromethanicum CM4]
          Length = 265

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 65/210 (30%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
           F   L   L       ++ +         D   V+ IVVL                    
Sbjct: 47  FVGLLVAGLSPLSAWTLAPLENRFPSFTDDGTPVTGIVVLGGTVEADTSIGRDQITVNEA 106

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R     +L       ++  SG        +VS+  ++ +      +    + +  ++ 
Sbjct: 107 GERAIALADLARRYPQARLVFSGGSGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSR 166

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  ++   +       L+VT  +HMPR+    ++         YP+         
Sbjct: 167 NTHENAVFSARMVQPKPGERWLLVTSAWHMPRSMGCFRKA--GFDVTAYPVDYRTNWPRD 224

Query: 162 SIF-------KIKILRVLLIEYLKILLLSI 184
           +          +  L + + E++ ++   +
Sbjct: 225 AYRLASFASDGLGELDIGVKEWIGMIAYRL 254


>gi|17229959|ref|NP_486507.1| hypothetical protein alr2467 [Nostoc sp. PCC 7120]
 gi|17131559|dbj|BAB74166.1| alr2467 [Nostoc sp. PCC 7120]
          Length = 263

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 71/215 (33%), Gaps = 39/215 (18%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------IRIERAF 54
           C   ++  ++      + + +   P+  AI+VL G                   R+  A 
Sbjct: 51  CSNAWVAKYLVRSLEWQNLPMAQLPNAEAIIVLGGATKSVFPPRITPDLSEQGDRVIYAA 110

Query: 55  ELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           +L        I +SG           +   +  I     +    +     +LNT  NA  
Sbjct: 111 QLYRQNKAPLIILSGGRIDWRGSGSSESTDMANILTSLGIPASVLIEEPDSLNTYQNAVN 170

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENSSIFK 165
                       VL+VT   HMPR+    QR    +  IP P    +   +L+E  +  K
Sbjct: 171 VKKILVSRGIDQVLLVTSALHMPRSLKIFQRQ--GMNVIPAPTDFLVSEGELQELGNTPK 228

Query: 166 IKILRVL------------LIEYLKILLLSIQLSL 188
             IL +L            L EY+   +  ++  +
Sbjct: 229 AAILNLLPDTYNLHLFTNALKEYVGSFVYWLRGWV 263


>gi|194334031|ref|YP_002015891.1| hypothetical protein Paes_1216 [Prosthecochloris aestuarii DSM 271]
 gi|194311849|gb|ACF46244.1| protein of unknown function DUF218 [Prosthecochloris aestuarii DSM
           271]
          Length = 196

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 56/183 (30%), Gaps = 6/183 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEK 64
             L     F        + Y+             I+VL G+   R+ +  EL      + 
Sbjct: 9   LALLATSAFLTAMIFLGLGYIVSWPAASPEKADVIIVLGGDDGLRVSKGAELYHAGFADD 68

Query: 65  IFISGVHHSVSKD---ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           + ++G+     +       ++  I   +    I +   + +T   A    +   KN +  
Sbjct: 69  LLLTGLDSRYYRPGKLNWRERKLISLGIPGEAIHVDIVSTSTWEEAANTLSAMNKNGWQR 128

Query: 122 VLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            L+++   HM R      ++ +    +F+                     R +L E  K 
Sbjct: 129 ALVISDPPHMLRLQHTWTKVFTGSSKRFVLIATKPEWWHPLLWWNNETGSRFVLSEIKKN 188

Query: 180 LLL 182
           L  
Sbjct: 189 LYY 191


>gi|20808561|ref|NP_623732.1| hypothetical protein TTE2177 [Thermoanaerobacter tengcongensis MB4]
 gi|20517188|gb|AAM25336.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 192

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 72/199 (36%), Gaps = 22/199 (11%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
           R+    + +    F +  I   + +            AI+VL               R+E
Sbjct: 3   RFLKLVVVLIFALFSIIAILAYQIISFGFTEKPKKSDAIIVLGCAVYGDAPSPFFKERLE 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A +L +   G  I ISG      S+S+    ++  + + +A   I +  K+ +T  N  
Sbjct: 63  EALKLYKEGYGRYIIISGGKGPGESISEAEAGKRYFLEKGVASKNILLDNKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            +    EKN+    +IV++ +H+ R  +  +RI   +      +   +   +        
Sbjct: 123 FSKEIMEKNSLKTAIIVSNKFHLKRASVIAKRI--GIDASFSGVFVKEYVGDEVYG---- 176

Query: 169 LRVLLIEYLKILLLSIQLS 187
               L E L +L   ++  
Sbjct: 177 ---FLREVLALLYTYLRGW 192


>gi|118591094|ref|ZP_01548493.1| hypothetical protein SIAM614_15747 [Stappia aggregata IAM 12614]
 gi|118436170|gb|EAV42812.1| hypothetical protein SIAM614_15747 [Stappia aggregata IAM 12614]
          Length = 265

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 63/212 (29%), Gaps = 30/212 (14%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-----------------EP 47
           + GL VC       ++      +        +   I++L G                   
Sbjct: 47  FAGLVVCAFSPAANWLIVPLEDRFQRPATLENYDGIIILGGAVDTVVTGVRGDTALTMSA 106

Query: 48  IRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKALN 102
            R+     L +     KI  +G    +     ++     ++     +A   I +  ++ N
Sbjct: 107 ERVTITARLAKALPAAKIIHTGGQGMIVSSQATEAEGAARLFRDFGIAPERIILEDQSQN 166

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           T  NA  A    +       L+VT  YHMPR+    ++         YP+         S
Sbjct: 167 TWQNAVYAKKIVQPQPGQRWLLVTSAYHMPRSMGVFEKAG-WTGVTAYPVDFRTRGPQDS 225

Query: 163 IFKIKILR-------VLLIEYLKILLLSIQLS 187
           +              +   E++ + +  +   
Sbjct: 226 MLGFDGASKGLRRFDIAFREWVGLAVYKLLGR 257


>gi|297567344|ref|YP_003686316.1| hypothetical protein Mesil_2970 [Meiothermus silvanus DSM 9946]
 gi|296851793|gb|ADH64808.1| protein of unknown function DUF218 [Meiothermus silvanus DSM 9946]
          Length = 211

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 64/201 (31%), Gaps = 17/201 (8%)

Query: 1   MRYFWYGLFVCLIF------FIMGFISFIRYVKQMHIPDHPSVS---AIVVLTGEPIRIE 51
           +R    GL +  +       ++ G  +++   + +   +        AIV L G   R+ 
Sbjct: 8   LRIPLVGLALVAVLGLAHGLWLPGIAAWLVVTEPLTSLEGLRSDPQAAIVPLAGGRERVL 67

Query: 52  RAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCI-DIGYKALNTEG 105
            A  L     G     + +             L+ +  + Q +    +         T  
Sbjct: 68  YAAALFRQGYGRWFLATDMPLDAPGIRERYAELVAREAVWQGVPRSAVVLSDLTVRTTYE 127

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEENSSI 163
            A+E    A    +  +L+VT  YH  R    L  +   S +               +  
Sbjct: 128 EAREILKVAHFRGWRSLLVVTSPYHTRRARWVLSEVFGTSGIAVHVVAAPEEGYTPQNWW 187

Query: 164 FKIKILRVLLIEYLKILLLSI 184
             +  LR    EYLK++L  +
Sbjct: 188 QSVDGLRNTWTEYLKLVLRLL 208


>gi|15606980|ref|NP_214362.1| hypothetical protein aq_1986 [Aquifex aeolicus VF5]
 gi|2984233|gb|AAC07762.1| hypothetical protein aq_1986 [Aquifex aeolicus VF5]
          Length = 241

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 72/211 (34%), Gaps = 26/211 (12%)

Query: 1   MRYFWYGLFVCLIFFIM----GFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +R F     + L    +      + +         P+     AIVVL G           
Sbjct: 34  LRRFALLCALSLYLISVEPIKDLLIYPLE-NYYKKPEVLKGDAIVVLGGGVYNNGRLKAS 92

Query: 49  ---RIERAFELLENQIGEKIFISGVH-HSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
              R+   F L +      I   G   + + +  +++++     + E  I    ++ +T 
Sbjct: 93  SFKRLITGFLLYKELKKPIILSGGASINVIPEAKVMKELLRSFGVPEEDIYTDVRSRDTF 152

Query: 105 GNAQEASAWAEK-NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII------SHDL 157
            NA+      EK      V++VT  +HMPR     ++    ++ IPYP         +  
Sbjct: 153 ENAKFVKEMCEKLLKCKEVILVTSGFHMPRAVGVFKKA--GLEVIPYPTDLKFEGKYNVY 210

Query: 158 EENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                        + + EY+ +L   ++  L
Sbjct: 211 SLFPKYSVFYDSSIAIREYIGLLFYKLKGLL 241


>gi|156741328|ref|YP_001431457.1| hypothetical protein Rcas_1343 [Roseiflexus castenholzii DSM 13941]
 gi|156232656|gb|ABU57439.1| protein of unknown function DUF218 [Roseiflexus castenholzii DSM
           13941]
          Length = 213

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 55/185 (29%), Gaps = 8/185 (4%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT---GEPIRIERAFELLENQIGEK 64
           L   ++   +  I F+     +      +  AI+VL      P R   A  L        
Sbjct: 22  LVALILVLAIITIPFLAAPWLIVDDAVDTADAIIVLGGEAYPPNRTIHALALYHQHRAPV 81

Query: 65  IFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
           +  +G          S   + +++ + + L      +   A +T   A         + +
Sbjct: 82  VVFTGGAPPGRPPETSSAQVARRLALARGLPPDVALLADGAQSTYDEAVLVRELVAAHGW 141

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             ++IVT  YH  R     + +                  +      +I R    E +K+
Sbjct: 142 RSLMIVTDPYHTRRAVRTFRTLIPNAHVTASAAPFLSPCADPWRCGARIWRYAASELVKM 201

Query: 180 LLLSI 184
               +
Sbjct: 202 GFYRL 206


>gi|254562167|ref|YP_003069262.1| hypothetical protein METDI3773 [Methylobacterium extorquens DM4]
 gi|254269445|emb|CAX25411.1| conserved hypothetical protein, DUF218; putative membrane protein
           precursor [Methylobacterium extorquens DM4]
          Length = 265

 Score = 86.0 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 65/210 (30%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
           F   L   L       ++ +         D   V+ IVVL                    
Sbjct: 47  FVGLLVAGLSPLSAWTLAPLENRFPSFTDDGTPVTGIVVLGGTVEADTSIGRDQITVNEA 106

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R     +L       ++  SG        +VS+  ++ +      +    + +  ++ 
Sbjct: 107 GERAIALADLARRYPQARLVFSGGAGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSR 166

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  ++   +       L+VT  +HMPR+    ++         YP+         
Sbjct: 167 NTHENAVFSARMVQPKPGERWLLVTSAWHMPRSMGCFRKA--GFDVTAYPVDYRTNWPRD 224

Query: 162 SIF-------KIKILRVLLIEYLKILLLSI 184
           +          +  L + + E++ ++   +
Sbjct: 225 AYRLASFASTGLGELDIGVKEWIGMIAYRL 254


>gi|240139755|ref|YP_002964232.1| hypothetical protein MexAM1_META1p3209 [Methylobacterium extorquens
           AM1]
 gi|240009729|gb|ACS40955.1| conserved hypothetical protein, DUF218; putative membrane protein
           precursor [Methylobacterium extorquens AM1]
          Length = 265

 Score = 86.0 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 67/210 (31%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
           F   LF  L       ++ +       I D   V+ IVVL                    
Sbjct: 47  FVGLLFGGLSPLSAWTLAPLENRFPNFIDDGTPVTGIVVLGGTVEADTSIGRDQITVNEA 106

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R     +L       ++  SG        +VS+  ++ +      +    + +  ++ 
Sbjct: 107 GERAIALADLARRYPQARLVFSGGAGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSR 166

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  ++   +       L+VT  +HMPR+    ++         YP+         
Sbjct: 167 NTHENAVFSARMVQPKPGERWLLVTSAWHMPRSMGCFRKA--GFDVTAYPVDYRTNWPRD 224

Query: 162 SIF-------KIKILRVLLIEYLKILLLSI 184
           +          +  L + + E++ ++   +
Sbjct: 225 AYRLASFASTGLGELDIGVKEWIGMIAYRL 254


>gi|254481130|ref|ZP_05094376.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
 gi|214038925|gb|EEB79586.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
          Length = 245

 Score = 86.0 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 73/210 (34%), Gaps = 29/210 (13%)

Query: 6   YGLFVCLIFFIMGFI--SFIRYVKQMHIPDHPSVSAIVVLT----------------GEP 47
             L+ C    +  F+  S     +   +   P V AIVVL                    
Sbjct: 38  VWLYACSTALVADFLMASLEDDFRPKAMSVVPKVDAIVVLGGATRGDTYWSSMADLNAAA 97

Query: 48  IRIERAFELLENQIGEKIFISGVHHS--VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
            R+  A  L + +    + +SG   +    +   L+   +   L +  + +  ++L+T+ 
Sbjct: 98  DRLTHAVSLYKAKKAPLVLLSGGSTTGSRPEAEQLRDYMVLMGLPDRALLMERQSLDTQQ 157

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL----EENS 161
           NA+ ++   +  +   +L+VT  YHM R     +R     + IP P     L        
Sbjct: 158 NARYSALILQGRDVRRILLVTSAYHMSRAVPLFERQ--GFEVIPAPTDYQRLVGKPAVPR 215

Query: 162 SIFKIKILRV---LLIEYLKILLLSIQLSL 188
            +     L      + EY+  L    Q  L
Sbjct: 216 WLPTADDLWRSTAAIKEYVGFLYYRAQGWL 245


>gi|254423832|ref|ZP_05037550.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
 gi|196191321|gb|EDX86285.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
          Length = 263

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/225 (18%), Positives = 74/225 (32%), Gaps = 40/225 (17%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------- 47
           +    + LF      +   +      +       P+  AIVVL G               
Sbjct: 40  IALALFILFFSSNPIVSNKLLSSLEWRYFPPDPVPTADAIVVLGGATVPAIAPRPWVEVS 99

Query: 48  ---IRIERAFELLENQIGEKIFISGVHHSVS------KDILLQKIPIRQDLAECCIDIGY 98
               RI  A  L       K+ +SG            +   ++   +  ++ E  I +  
Sbjct: 100 EAGDRILYAARLYNQGRAPKLILSGGRVQWRGGSDESEADDMKAFAMAMNVPEADIILEE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IIS 154
            +LNT  NA          +   VL+VT   HMPR+    Q++   +  IP P    + +
Sbjct: 160 TSLNTRQNAVNVKKILAAQSIDSVLLVTSAVHMPRSVAIFQKL--DIDVIPAPTDYLVTT 217

Query: 155 HDLEENSSIFKIKILRVL------------LIEYLKILLLSIQLS 187
              E      + +IL +L            + EY+  ++  ++  
Sbjct: 218 PSDESGEITIEGRILSLLPRAEATGRFTRAMKEYVGFVIYRLRGW 262


>gi|229824827|ref|ZP_04450896.1| hypothetical protein GCWU000182_00176 [Abiotrophia defectiva ATCC
           49176]
 gi|229790830|gb|EEP26944.1| hypothetical protein GCWU000182_00176 [Abiotrophia defectiva ATCC
           49176]
          Length = 211

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 58/169 (34%), Gaps = 22/169 (13%)

Query: 32  PDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVH------------------- 71
            +      I +         E A  L +     KI  SG++                   
Sbjct: 25  DEPQDSDIIFIPGSSNWVLAETAASLYKEGKANKIMPSGMYFYKIGRFLNERVTDERYKG 84

Query: 72  HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDY 129
           +  ++   L  + ++  +    I I  KA NT  NA  +    ++NN      +I    +
Sbjct: 85  NFRTEAEFLSSVLVKNGVENKDILIEEKATNTYENAIFSRDLLKENNLTVKKAIICPQAF 144

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           H  R F+    +   V+F   P  +  +  +S     + ++V+L E  K
Sbjct: 145 HARRAFMTYSHLFPDVEFYVVPTDTQGITADSWYKTERGIQVVLGELQK 193


>gi|209884886|ref|YP_002288743.1| hypothetical protein OCAR_5752 [Oligotropha carboxidovorans OM5]
 gi|209873082|gb|ACI92878.1| protein of unknown function [Oligotropha carboxidovorans OM5]
          Length = 264

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 58/213 (27%), Gaps = 37/213 (17%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
               L           +  +         D  +   IVVL                    
Sbjct: 46  IALLLVCGFSPLGNWLLLPLSERFPAWHDDGRAPDGIVVLGGAISPDLTAERGTAELNAS 105

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A EL       KI +SG      H   ++  + + +     +A   I    ++ 
Sbjct: 106 AERMTAAAELARRFPNAKIVLSGGNANVFHPLSTEAEVGRVLLENLGVAADRIVREDRSR 165

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA       +       L+VT  YHMPR     +          YPI   D   + 
Sbjct: 166 NTYENAIFTRDVVKPKPGERWLLVTSAYHMPRAIGVFRAA--NFPVEAYPI---DWRTSG 220

Query: 162 S----------IFKIKILRVLLIEYLKILLLSI 184
                         +  L     E++ ++   +
Sbjct: 221 WKEAGRPFLKLSAGLARLDTAAREWVGLIGYRL 253


>gi|163852963|ref|YP_001641006.1| hypothetical protein Mext_3555 [Methylobacterium extorquens PA1]
 gi|163664568|gb|ABY31935.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 275

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 67/213 (31%), Gaps = 33/213 (15%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------------- 48
              F  L       +  +       + D   V  I+VL+G                    
Sbjct: 35  LATFSGLTPLANWALLPLEQRFPAQVDDVRPVDGIIVLSGGIDLTTSRTRGRLELNDAGD 94

Query: 49  RIERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIPIRQDLAECCIDIGYKAL 101
           RI    +L       ++  +G     +       + +L         +A   I +  ++ 
Sbjct: 95  RITALIDLAHRYPQARLVYTGGDPYPTGGRARPTEAVLAAAYLEGIGIAPARITVEARSR 154

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA E     E +     L++T  +HMPR     +R+   ++  PYP+        +
Sbjct: 155 TTAENASEVRKLLEPHPGERWLLITSAWHMPRAMGAFRRV--GLELEPYPVDFRTAGPFA 212

Query: 162 SIFKIKI-------LRVLLIEYLKILLLSIQLS 187
           + F  +        L V   E+  +++  +   
Sbjct: 213 TRFTFRHAADGLHLLDVAAKEWAGLVVYRLTGR 245


>gi|319783692|ref|YP_004143168.1| hypothetical protein Mesci_4004 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169580|gb|ADV13118.1| protein of unknown function DUF218 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 263

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 62/215 (28%), Gaps = 32/215 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------- 47
           F               ++ +    Q   P    V  IVVL G                  
Sbjct: 46  FLILALSAWTSLGAMMLNPLEERFQ-RPPLPEKVDGIVVLGGGFEGAINLARGGYELNSS 104

Query: 48  -IRIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKAL 101
             R+     L       K+ +SG   ++            ++     +A   + +  K+ 
Sbjct: 105 GDRMVETAILARRFPTAKVVVSGGTGALFLDGEGDAATAPRLLTALGVAADRMILENKSR 164

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH------ 155
           NT  NA               L+VT  +HMPR      +       +P+P+         
Sbjct: 165 NTYENAVFTKELVTPKPGETWLLVTSAFHMPRAKALFDKA--GFATVPWPVDYRTSGREG 222

Query: 156 -DLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
             L  ++    ++   + + E++ +    +   + 
Sbjct: 223 VGLFRDNPADSLQATTMAIREWIGLFAYWLSGRID 257


>gi|299135177|ref|ZP_07028368.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
 gi|298590154|gb|EFI50358.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
          Length = 264

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 59/213 (27%), Gaps = 37/213 (17%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
               L           +  +            +   I+VL                    
Sbjct: 46  ILLLLVCGYSPLGNVLLLTLSERFPAWQESGRAPDGIIVLGGAINPDLTAVRGAPEMNSS 105

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A  L       KI +SG      H   ++  + +K      +A+  I +  ++ 
Sbjct: 106 AERMTAAAVLARRFPNAKIVLSGGNANPFHPLSTEAEVGRKFLEDLGVADDRIVMEGRSR 165

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            T  NA+             +L+VT  YHMPR     +          YP+   D     
Sbjct: 166 TTYENAEFTRPLIHPVAGERLLLVTSAYHMPRAMGVFRAA--GFNVEAYPV---DWRTRG 220

Query: 162 SIFKIKILRVL----------LIEYLKILLLSI 184
            +   +    L          + E++ ++   +
Sbjct: 221 WVDAERPFLTLSGGLGRLDTAVHEWVGLIGYRL 253


>gi|56965774|ref|YP_177508.1| hypothetical protein ABC4016 [Bacillus clausii KSM-K16]
 gi|56912020|dbj|BAD66547.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 201

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 63/169 (37%), Gaps = 12/169 (7%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEP---IRIERAFELLENQIGEKIFISGVHHS----VSKDI 78
           +      D  S   I V         R+ +A +L +     K+  SG          + +
Sbjct: 20  LYGYKKDDGKSGDCIFVPGSSKAVEYRVPKAVDLYKQGRARKLLFSGGVSWDETKTPEAV 79

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRT 134
           L++   +   +A   I +  ++L+T+ N   +    ++    +    +L+VT  YHMPR 
Sbjct: 80  LMKAKALSLGIAAKDILVEDRSLHTKENVLASLLVLDRAIDLHRIKRLLLVTASYHMPRV 139

Query: 135 FLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           +L ++      +++   P+        +        + +  E  K++  
Sbjct: 140 YLMMRTYMPSWIEYSLCPVDDKTTTAENWHLSPFGRKRVETEARKLISY 188


>gi|288817420|ref|YP_003431767.1| hypothetical protein HTH_0099 [Hydrogenobacter thermophilus TK-6]
 gi|288786819|dbj|BAI68566.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
 gi|308751027|gb|ADO44510.1| protein of unknown function DUF218 [Hydrogenobacter thermophilus
           TK-6]
          Length = 240

 Score = 84.9 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 72/178 (40%), Gaps = 20/178 (11%)

Query: 28  QMHIPDHPSVSAIVVLTGEPI-----------RIERAFELLENQIGEKIFISGVHHSVSK 76
           +  +P+     AIVVL G              R+  A  L +   G  I +SG   ++  
Sbjct: 65  KYSVPEKFQADAIVVLGGGSYSTGILKEDSMKRLLTALILHKR-TGLPIVLSGGAENLPD 123

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFL 136
             +++ + +   + +  I    ++ +TE NA       ++ N+  V++VT  YH+PR   
Sbjct: 124 AEIMKSLLVELGVDKRDIITEVRSRDTEENASYVREICQQRNYKSVVLVTSAYHLPRAVF 183

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL------LIEYLKILLLSIQLSL 188
             ++    +  IPYP         +    +  + VL      L EY+ +L L +   L
Sbjct: 184 LFKKE--GLSVIPYPTDFKRDLRYNLYSLLPKMSVLNDSVKALREYVALLSLRLPEWL 239


>gi|300865598|ref|ZP_07110374.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300336399|emb|CBN55524.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 236

 Score = 84.9 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 68/212 (32%), Gaps = 40/212 (18%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------IRIERAFELLE 58
           +I   +      + +     P   AIVVL G                   RI    +L  
Sbjct: 27  WIAQNLVRSLETQNLPPTPIPQTRAIVVLGGGIKPALPPRPWVEVGEAGDRILYGSQLYR 86

Query: 59  NQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
                 + +SG           +   + +I     +    I     +LNT  NA      
Sbjct: 87  QGKAPWLILSGGRVEWKGGGPPESADMAEIAQAMGVPTSAILQDPTSLNTYQNAVNVRKI 146

Query: 114 AEKNNF-HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN------------ 160
            + NN    +L+VT   HMPR+ L  QR    ++ IP P      +++            
Sbjct: 147 LKDNNILGPILLVTSALHMPRSLLIFQRQ--GIETIPAPTDFSITQQDMEASQSSFQAVL 204

Query: 161 ----SSIFKIKILRVLLIEYLKILLLSIQLSL 188
                  + ++     L EY+ + +  ++  +
Sbjct: 205 LNLLPDAYNLQQSTKALKEYIGLAVYRLRGWV 236


>gi|92117952|ref|YP_577681.1| hypothetical protein Nham_2431 [Nitrobacter hamburgensis X14]
 gi|91800846|gb|ABE63221.1| protein of unknown function DUF218 [Nitrobacter hamburgensis X14]
          Length = 267

 Score = 84.9 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 58/210 (27%), Gaps = 31/210 (14%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------------PIR 49
            L           +  +         D      I++L G                    R
Sbjct: 49  LLIFGYSPLGNVLLLTLSERFPAWHFDGREPDGIIILGGAIEPELSAARKAVEVNGAAER 108

Query: 50  IERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
           I    EL       ++  SG         VS+  +  ++     ++   I +  ++  T+
Sbjct: 109 IIGGLELARRFPRARVVYSGGSANLIADPVSEAPIAGRLLETFGISPERIVLESESRTTD 168

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            NA+              L+VT  YHMPR+    ++    +    YP+         +  
Sbjct: 169 ENARFTRKLVSPKPGERWLLVTSAYHMPRSIGVFRKA--GLDVEAYPVDWRTRGWIDAWT 226

Query: 165 KIKILR-------VLLIEYLKILLLSIQLS 187
               L          + E+  +L   +   
Sbjct: 227 PFDRLSAGLARADTAVHEWCGLLAYRLTGR 256


>gi|187929799|ref|YP_001900286.1| hypothetical protein Rpic_2729 [Ralstonia pickettii 12J]
 gi|187726689|gb|ACD27854.1| protein of unknown function DUF218 [Ralstonia pickettii 12J]
          Length = 192

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 61/184 (33%), Gaps = 7/184 (3%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGE 63
           W G    +   + G +           P       IVVL      R+  A EL    +  
Sbjct: 14  WIGGCAIVAVVVGGALVCGAKAWLREEPRLAQADVIVVLGGESGQRVIGAAELYHAGVAP 73

Query: 64  KIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++F+SG    +    L+++  +   +    I     + +T  NA+              +
Sbjct: 74  RVFVSGQGDCL----LIERRLVMAGVPAERIGHECVSGSTMENARMTRGTLAGQQVQSAI 129

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           +VT  YH  R     +++   V +    +   D    S          +L EY+K    +
Sbjct: 130 LVTSWYHTGRALAVFRKVWPEVTWGAQGVFPGDTLAKSVPIYEAGS--ILAEYVKRAWYA 187

Query: 184 IQLS 187
           ++  
Sbjct: 188 VRYR 191


>gi|188582432|ref|YP_001925877.1| hypothetical protein Mpop_3190 [Methylobacterium populi BJ001]
 gi|179345930|gb|ACB81342.1| protein of unknown function DUF218 [Methylobacterium populi BJ001]
          Length = 278

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 63/210 (30%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
           F   L   L       +  +         D   V+ IVVL                    
Sbjct: 60  FLGLLAAGLSPLSAWVLGPLENRFPAFADDERPVAGIVVLGGAVEADTSIGRNQITVNDA 119

Query: 47  PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R     +L       ++  SG        +VS+  ++ +      +    + +  ++ 
Sbjct: 120 GEREIALADLARRFPQARLVFSGGAGSLREDAVSEAEIVSRYADTLGVPRNRLILEQQSR 179

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  ++   +       L+VT  +HMPR     +R         YP+         
Sbjct: 180 NTHENAVFSARMVQPKPGERWLLVTSAWHMPRAVGCFRRA--GFDVTAYPVDYRTNWPRD 237

Query: 162 SIF-------KIKILRVLLIEYLKILLLSI 184
           +          +  L + + E++ ++   +
Sbjct: 238 ATRFASFASDGLGELDIGVKEWIGLIAYKL 267


>gi|239832066|ref|ZP_04680395.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824333|gb|EEQ95901.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 279

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 56/210 (26%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GE 46
                           ++ +             V  IVVL                    
Sbjct: 61  LATLFLAAFTTLGAVLLAPLEDRFAKPDAMPQRVDGIVVLGGYMNGEINAGRKGFELNSA 120

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDILL-----QKIPIRQDLAECCIDIGYKAL 101
             RI  A  L       K+ +SG   +  +         +++      +        K+ 
Sbjct: 121 ADRIFEAMRLARLYPDAKVIVSGGEGAFFEKSAKEADSTRQMLADLGFSGERYIFENKSR 180

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  +   A+       L+VT  YHMPR+    ++       + +P+         
Sbjct: 181 NTVENAVFSKELAQPKPGETWLLVTSAYHMPRSIGCFRKA--GFDVVAWPVDFKTRASEH 238

Query: 162 SIFKIKI-------LRVLLIEYLKILLLSI 184
               ++          V + E+  +    +
Sbjct: 239 FALYLESPNEALSRFSVAMREWGGLAAYWL 268


>gi|148658348|ref|YP_001278553.1| hypothetical protein RoseRS_4260 [Roseiflexus sp. RS-1]
 gi|148570458|gb|ABQ92603.1| protein of unknown function DUF218 [Roseiflexus sp. RS-1]
          Length = 193

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 62/188 (32%), Gaps = 9/188 (4%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLT---GEPIRIERAFELLENQIGEKI 65
             ++  I   I  +     + + D   +  AIVVL      P R   A  L + Q    +
Sbjct: 3   FGVLVLIASLILPLLVAPWLIVDDAGETADAIVVLGGEAYPPNRTIHALNLYKQQRAPVV 62

Query: 66  FISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
             +G         +S   +  +  + + L      +   A +T   A      A  + + 
Sbjct: 63  VFTGGALPGQPPEISSARVALRYALARGLPAEVALVVDTAQSTYDEATLVRDLAAHHGWR 122

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            ++IVT  YH  R     + I   VQ         D   +     +++ R    E +K+ 
Sbjct: 123 SLIIVTDPYHTRRAVRTFRSIIPDVQVTASVAPFLDTFADPLSRGVRVWRYAAAELIKMA 182

Query: 181 LLSIQLSL 188
              +   +
Sbjct: 183 FYRLHYGI 190


>gi|160913536|ref|ZP_02076227.1| hypothetical protein EUBDOL_00012 [Eubacterium dolichum DSM 3991]
 gi|158434088|gb|EDP12377.1| hypothetical protein EUBDOL_00012 [Eubacterium dolichum DSM 3991]
          Length = 185

 Score = 84.5 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 70/184 (38%), Gaps = 15/184 (8%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-----------EPIRIERAF 54
             + +  +FF+                 H      +VL             +  R++ A 
Sbjct: 1   MMIIIICLFFLFASCYPYHRFPLYIQQTHQGYDVCIVLGSPSNTDGSLSRIQKQRMDHAI 60

Query: 55  ELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L +    +KI ISG  V +   +  +++   I Q++ E  I +   A NT  N + A+ 
Sbjct: 61  TLYQKGSIQKILISGAAVANCFIEAEVMKDYAIAQNVPEKDILLEKYAKNTYENLKYAAD 120

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
              K++F   +IVT  +H+ R     Q+  +   F  YP+   + +       +++   L
Sbjct: 121 LCNKHHFSKTIIVTSGFHIRRAGFFAQKFLTD--FTFYPVSEKENQRYFITEYLRMWNTL 178

Query: 173 LIEY 176
             E+
Sbjct: 179 YYEW 182


>gi|114704894|ref|ZP_01437802.1| hypothetical protein FP2506_08156 [Fulvimarina pelagi HTCC2506]
 gi|114539679|gb|EAU42799.1| hypothetical protein FP2506_08156 [Fulvimarina pelagi HTCC2506]
          Length = 270

 Score = 84.5 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/217 (16%), Positives = 67/217 (30%), Gaps = 36/217 (16%)

Query: 2   RYFWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVSAIVVLT------------ 44
           + F+    + L    +        +++    +  +P    V  I+VL             
Sbjct: 39  KSFFVLAALSLAIVSVSPLGLAMTAYLENRFERPVPMPAEVDGIIVLGGAFDTRVARTRG 98

Query: 45  -----GEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCI 94
                    R   +  L     G  +  SG         + +    ++  +   L    +
Sbjct: 99  VIELNEAADRASVSVALARTYPGADVLFSGGVAAAFREDIPETQSAEQFYLGLGLDPNRL 158

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  KA +T  NA  A A A+       L+VT  YHMPR     + +      +PYP+  
Sbjct: 159 KLDGKARDTFENAVYAKALADPQPGETWLLVTSAYHMPRAMGCFRTV--GFDVVPYPVDY 216

Query: 155 HDLEENSSI-------FKIKILRVLLIEYLKILLLSI 184
              E              ++ +   + EY+ +     
Sbjct: 217 RTPEGADVWRPSTATTRNLEKVHFAIREYIGLAAYWA 253


>gi|217976941|ref|YP_002361088.1| protein of unknown function DUF218 [Methylocella silvestris BL2]
 gi|217502317|gb|ACK49726.1| protein of unknown function DUF218 [Methylocella silvestris BL2]
          Length = 264

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 57/154 (37%), Gaps = 14/154 (9%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILL-----QKIPIRQDLAECCIDIG 97
             G+  R+    EL +     ++  +G   ++ +  ++     +K  +   +    ++  
Sbjct: 102 FGGDGERLIAGIELSKRYPSARLVFTGGSGNLVEQTIVESTGVKKFWLDMGVPPDRMEFE 161

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
            ++ NT  NA               L+VT  +HMPR+    +R+      I YP+     
Sbjct: 162 SRSRNTWENALFTRDLLRPKPGETWLLVTSAWHMPRSMGIFRRL--GFDVIAYPVAYRTS 219

Query: 158 EENSSIFKIKILR-------VLLIEYLKILLLSI 184
            ++S    ++          +   E++ +L   +
Sbjct: 220 GDSSDWSFLRPAFERVPLVVLAFREWIGLLAYRL 253


>gi|255505150|ref|ZP_05344767.3| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
 gi|255269303|gb|EET62508.1| conserved hypothetical protein [Bryantella formatexigens DSM 14469]
          Length = 222

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/167 (13%), Positives = 52/167 (31%), Gaps = 20/167 (11%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG------------------ 69
                      I +       +  RA EL   ++  +I  SG                  
Sbjct: 38  FVEDAPQEADIIFIPGSGYGELALRAAELYHQKLAGQIVASGKYSILGDSFAGPLSPQEY 97

Query: 70  -VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
                 ++   L  + + + +    +    +A  T  NA   +   E       L+V   
Sbjct: 98  VGKSYETESDFLTAVLVERGVPRSAVLQEKQATYTYENAIYTAKLLEGRTIRRALLVCQA 157

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           +H  R+ L  + +    + +  P+ +  + +++       + ++L E
Sbjct: 158 FHARRSLLYYKILFPETEILVCPVQTRGITKDNWYLDADRIDIVLGE 204


>gi|270157480|ref|ZP_06186137.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289164131|ref|YP_003454269.1| hypothetical protein LLO_0787 [Legionella longbeachae NSW150]
 gi|269989505|gb|EEZ95759.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288857304|emb|CBJ11131.1| hypothetical protein LLO_0787 [Legionella longbeachae NSW150]
          Length = 197

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/198 (18%), Positives = 75/198 (37%), Gaps = 22/198 (11%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERA 53
           +    +           +I  ++     +      I+VL  +             R++ A
Sbjct: 8   FIFFLILSAGIYFSLALYI--IRNAEKDEKKHADVIIVLGTKSYHGDKYNPCLVARVQHA 65

Query: 54  FELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
            +L +     K+  SG   +    S+  ++++I +   ++E  I +   + +T  N   +
Sbjct: 66  VDLYKANYAPKLLFSGGKDTKNGPSEAQVMKEIALHLGVSEQDILLESASASTYENLLFS 125

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR 170
                   F+ +L+VT  +H+PR  L  Q++   ++    P I     + +S F     R
Sbjct: 126 EKIVSAKKFNSILLVTEPFHLPRAILVAQKL--GLKVSGSPAIQSLCWQKNSYFS----R 179

Query: 171 VLLIEYLKILLLSIQLSL 188
             L E L I+   I+  L
Sbjct: 180 HFLREPLAIIYYKIKNQL 197


>gi|193212745|ref|YP_001998698.1| hypothetical protein Cpar_1090 [Chlorobaculum parvum NCIB 8327]
 gi|193086222|gb|ACF11498.1| protein of unknown function DUF218 [Chlorobaculum parvum NCIB 8327]
          Length = 196

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 62/185 (33%), Gaps = 6/185 (3%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEK 64
              F+            + ++  +H         IVVL G+   R+E+  EL +    + 
Sbjct: 9   LLFFLITSTLFATVYLGLGFLVSLHSTKPEKADVIVVLGGDNGLRVEKGTELYKAGYAKN 68

Query: 65  IFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           I ++G+        +    ++  +   + +  I +   +  T   A+  S   +K  ++ 
Sbjct: 69  IVLTGIDSRYYSPSRPNWRERRMLEAGVPKKAITVDIWSETTWEEAENTSDLMDKKGWNS 128

Query: 122 VLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
            L+V+   HM R      +  +    QFI                     + ++ E  K 
Sbjct: 129 ALVVSDPPHMLRLHKTWTQAFAGSSKQFILVTTEPEWWHPLFWWRDPFSKQFVINEIKKN 188

Query: 180 LLLSI 184
           +   +
Sbjct: 189 IYYLL 193


>gi|22299705|ref|NP_682952.1| hypothetical protein tlr2162 [Thermosynechococcus elongatus BP-1]
 gi|22295889|dbj|BAC09714.1| tlr2162 [Thermosynechococcus elongatus BP-1]
          Length = 263

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 73/219 (33%), Gaps = 39/219 (17%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GEPIRI 50
            L +    ++   +      + +     P  +AIVVL                     RI
Sbjct: 47  ILLLSGNDYVAATLIASLERQYLPPHPMPKAAAIVVLGGAVVPQTAPRPWVEVTEGGDRI 106

Query: 51  ERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIPIRQDLAECCIDIGYKALNT 103
                L        + +SG   +        ++ + + +I     +    I +   +LNT
Sbjct: 107 LYGAHLFRQGSDPYLILSGGRINWLGETFQQAEAVDMAEIATTCGVPRDKILLETSSLNT 166

Query: 104 EGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDLEEN 160
             NA    A  EK+     +L+VT  YHMPR     +R+   +  IP P       +  +
Sbjct: 167 YQNAVNVKALLEKHQMQGKLLLVTSAYHMPRAVAIFRRL--GMDVIPAPTDYRYPTIARS 224

Query: 161 SSIFKI-----------KILRVLLIEYLKILLLSIQLSL 188
            +   +            I  + L EY  +L+  ++  L
Sbjct: 225 PTWQNLLLSLIPNPYNVDITTIALREYQGLLIYRLRGWL 263


>gi|304309671|ref|YP_003809269.1| hypothetical protein HDN1F_00190 [gamma proteobacterium HdN1]
 gi|301795404|emb|CBL43602.1| conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 256

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/210 (18%), Positives = 65/210 (30%), Gaps = 32/210 (15%)

Query: 4   FWYGLFVCLIFFIMGFI-SFIRYVKQMHIPDHPSVSAIVVLTGE---------------- 46
               +F  +    +G   S       +   + P    IVVL G                 
Sbjct: 44  LVVLVFASMPLVAVGLWKSLEGRYPILVPSEQPKADVIVVLGGGIALPEPPQVVPDLNDA 103

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A EL        + +SG           +    +K+  R  +    I +   + 
Sbjct: 104 ADRVWYAAELYHAGKAPWVVVSGGQVFPRSGLESEAEYHRKLLERMGVPAEAILVESASR 163

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN- 160
           +T GNA   +A   +  F   L+VT   HMPR  L  +     V  +P     H ++ + 
Sbjct: 164 DTAGNAMLTAALMRERKFQKALLVTSAAHMPRAVLLFEHA--GVDVVPASCDVHGVDMDV 221

Query: 161 -------SSIFKIKILRVLLIEYLKILLLS 183
                     +  +     L E+L  +   
Sbjct: 222 PLILKLLPVAWAFQDTERALHEWLAFVYYR 251


>gi|218288615|ref|ZP_03492892.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241272|gb|EED08447.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 199

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 62/207 (29%), Gaps = 29/207 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQM----HIPDHPSVSAIVVLTGEPI-------- 48
           M + W  L  C +  +      +R+ +++               VVL             
Sbjct: 1   MAWLWMCLLACGVAALGSLAFLLRFAERLKHEGRSHRPQKSDVGVVLGAYTDGYEPSHPL 60

Query: 49  --RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             R+  A  L        I +SG      +VS+   +++  +   +    +     + NT
Sbjct: 61  VARLRAAIALYRQGYIRAIIVSGGQGENETVSEARSMKRFLVMNGIPADAVHEERMSTNT 120

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             N   +SA      +   +I+T DYH+PR     +     +        S         
Sbjct: 121 WENLYHSSAIMRDRGYRTAVIITSDYHLPRALAVAR--MLGMDATGCGAAS--------- 169

Query: 164 FKIKILRVLLIEYLKILLLSIQLSLST 190
                 R  + E    +   ++   + 
Sbjct: 170 -TKGEFRAAVREVFAHIEYMLRGRQAP 195


>gi|257058358|ref|YP_003136246.1| hypothetical protein Cyan8802_0454 [Cyanothece sp. PCC 8802]
 gi|256588524|gb|ACU99410.1| protein of unknown function DUF218 [Cyanothece sp. PCC 8802]
          Length = 265

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 71/223 (31%), Gaps = 39/223 (17%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GE 46
           +    L +    ++   +      +       P    IVVL                   
Sbjct: 45  FALVILLISSNAWVSSALIQSLEQQISPPVIIPQAEVIVVLGGATKSPVKPRPMVDVNEH 104

Query: 47  PIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A +L  +Q    I  SG       +S  +   + ++     +    I     +L
Sbjct: 105 GDRLFYAAKLYLDQKAPLIIASGGRISWSGNSRPESEDMAQLLQMLGVPSQAIIQEPNSL 164

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS--HDLEE 159
           NT  NA       +      VL+VT  +H+PR  L  +++   +  I  P      +++E
Sbjct: 165 NTYENAINVKQILDNLGIKKVLLVTSAFHLPRARLIFEKL--GINVIGAPTDYFVTEIDE 222

Query: 160 NSSIFKIKILR--------------VLLIEYLKILLLSIQLSL 188
            ++   I+                 + L EY+   +  ++  L
Sbjct: 223 TNNQTSIEGFILGLLPDAHRLSLTTLALKEYIGTFIYRLKGWL 265


>gi|207723593|ref|YP_002253992.1| hypothetical protein RSMK00882 [Ralstonia solanacearum MolK2]
 gi|206588795|emb|CAQ35758.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 190

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 56/154 (36%), Gaps = 7/154 (4%)

Query: 34  HPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
                 IVVL      R+  A EL    +  ++F+SG    +    L+ +  +   +   
Sbjct: 43  PGHADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCL----LIVRRLVMAGVPAE 98

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I    ++ NT  NA+      +  +    ++VT  YH  R     +R+   V +    +
Sbjct: 99  RIGHECESGNTMENARMTRRMLDGQSVRSAVLVTSWYHTGRALRAFRRVWPEVAWGARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
              D    S          +L EYLK    +++ 
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYLKRAWYAVRY 190


>gi|242279972|ref|YP_002992101.1| hypothetical protein Desal_2506 [Desulfovibrio salexigens DSM 2638]
 gi|242122866|gb|ACS80562.1| protein of unknown function DUF218 [Desulfovibrio salexigens DSM
           2638]
          Length = 214

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 63/205 (30%), Gaps = 17/205 (8%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
             G            + F   V      +     AIVVL G   R   A +L       +
Sbjct: 10  LIGALTVAGILAAAVLFFFAPVLLQQEDELEKADAIVVLGGHYYRPLYAADLYNKGYAPR 69

Query: 65  IFISG-------------VHHSVSKDILLQKIPIRQDLAECCI-DIGYKALNTEGNAQEA 110
           I  S                H   +  + + + +++D+    I   G   ++T   A++ 
Sbjct: 70  ILASKPVITPEIEAVRDLDIHFPYQWEVFRDVLLKKDVPAERIEFFGKANISTLDEAEKL 129

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN-STVQFIPYPIISHDLEENSSIFKIKIL 169
                      +++VT   H  R  +  + I    V+ I      +++         +  
Sbjct: 130 RDKLTPQ-IKSIILVTSPMHTRRAGIIFREILPPNVKIIVVG-TPYEVTPERWWTNFRAA 187

Query: 170 RVLLIEYLKILLLSIQLSLSTQTAS 194
             +++E  K L      +  +  ++
Sbjct: 188 PFVVLEVAKTLYYEFGGAFRSSEST 212


>gi|207742563|ref|YP_002258955.1| hypothetical protein RSIPO_00752 [Ralstonia solanacearum IPO1609]
 gi|206593956|emb|CAQ60883.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 190

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 55/154 (35%), Gaps = 7/154 (4%)

Query: 34  HPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
                 IVVL      R+  A EL    +  ++F+SG    +    L+ +  +   +   
Sbjct: 43  PGHADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCL----LIVRRLVMAGVPAE 98

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I    ++ NT  NA+      +  +    ++VT  YH  R     +R+   V +    +
Sbjct: 99  RIGHECESGNTMENARMTRRMLDGQSVRSAVLVTSWYHTGRALRAFRRVWPEVAWGARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
              D    S          +L EYLK     ++ 
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYLKRAWYVVRY 190


>gi|85715468|ref|ZP_01046449.1| hypothetical protein NB311A_17224 [Nitrobacter sp. Nb-311A]
 gi|85697663|gb|EAQ35539.1| hypothetical protein NB311A_17224 [Nitrobacter sp. Nb-311A]
          Length = 266

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 64/218 (29%), Gaps = 42/218 (19%)

Query: 4   FWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVSAIVVLTGE------------ 46
                   L+ F         +  +         D  +   I++L G             
Sbjct: 41  LLTAGIAALLIFGYSPLSNVLLLTLSERFPPWHFDGRAPDGIIILGGSIQPPLSVARQTV 100

Query: 47  -----PIRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDI 96
                  R+    EL +     ++  SG    +      +  +   +  R  +    I +
Sbjct: 101 EIDGAAERVIGGLELAQRFPEARVVYSGGSGQLTEGSAREAPIAGSLFERFGITPERIVL 160

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++  T  NA+ +            L+VT  YHMPR+    ++     +  PYP+   D
Sbjct: 161 ENESRTTYENARFSRELVAPKPGERWLLVTSAYHMPRSIGVFRKA--GFEVEPYPV---D 215

Query: 157 LEENSSIFKIKILRVL----------LIEYLKILLLSI 184
                 I   +    L          + E++ +L   +
Sbjct: 216 WRTRGWIDAWRPFNRLTTGLACADIAVHEWVGLLAHWM 253


>gi|224542305|ref|ZP_03682844.1| hypothetical protein CATMIT_01484 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524754|gb|EEF93859.1| hypothetical protein CATMIT_01484 [Catenibacterium mitsuokai DSM
           15897]
          Length = 210

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 66/201 (32%), Gaps = 17/201 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +  +     F + +         D  +    +VL               RI
Sbjct: 11  MKILKKLIIIVALVICYVFSNAVSIYIYSFKDDARNADVAIVLGASTYNGHPSPVYQERI 70

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A +L    + +KI ++G +   + VS     +   + Q + E  +    ++  T  N 
Sbjct: 71  NHAVDLYNKHLVKKIIMTGGYGKGNPVSDAYNAKLYAVSQGVPEDDVLTEDQSTVTLENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             A    +  N+   LIV+   HM R  L+ +     +     P  S          K K
Sbjct: 131 INAKKIMDVYNYQTALIVSDPLHMKRAMLQAKDA--GIIAYTSPTHSSRFRTRD--TKFK 186

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
            L+  +I Y+      +  S 
Sbjct: 187 FLKREVINYIGYKWYRLFKSF 207


>gi|332968000|gb|EGK07087.1| protein of hypothetical function DUF218 [Desmospora sp. 8437]
          Length = 190

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 72/167 (43%), Gaps = 15/167 (8%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV-SAIVVLTGEPI----------RI 50
           R+ W G+ +CLIF ++    +++  +   +        A +VL               R+
Sbjct: 4   RWLWSGVILCLIFALLIIPFWVQASRYDDVRVADHPRDAALVLGAALWDSQPSPALRERL 63

Query: 51  ERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           + A  L      + I  SG      +S+   +++  + Q +    + +  ++ NT+ N Q
Sbjct: 64  QMALSLYHKGQVQWIICSGGVGDDGISEAEGMKRYLMEQGVPPKDLLLEEESTNTKENLQ 123

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
            +    + N+  ++ +VTHDYHM R+    ++    ++  P P+ S 
Sbjct: 124 YSKKLLKPNDIQNIYLVTHDYHMYRSLALARQA--GIRAEPAPVHSS 168


>gi|218245322|ref|YP_002370693.1| hypothetical protein PCC8801_0441 [Cyanothece sp. PCC 8801]
 gi|218165800|gb|ACK64537.1| protein of unknown function DUF218 [Cyanothece sp. PCC 8801]
          Length = 265

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 71/223 (31%), Gaps = 39/223 (17%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GE 46
           +    L +    ++   +      +       P    IVVL                   
Sbjct: 45  FALVILLISSNAWVSSALIQSLEQQISPPVIIPQAEVIVVLGGATKSPVKPRPMVDVNEH 104

Query: 47  PIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A +L  +Q    I  SG       +S  +   + ++     +    I     +L
Sbjct: 105 GDRLFYAAKLYLDQKAPLIIASGGRISWSGNSRPESEDMAQLLQMLGVPSQAIIQEPNSL 164

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS--HDLEE 159
           NT  NA       +      VL+VT  +H+PR  L  +++   +  I  P      +++E
Sbjct: 165 NTYENAINVKQILDNLGIKKVLLVTSAFHLPRARLIFEKL--GINVIGTPTDYFVTEIDE 222

Query: 160 NSSIFKIKILR--------------VLLIEYLKILLLSIQLSL 188
            ++   I+                 + L EY+   +  ++  L
Sbjct: 223 TNNQTSIEGFILGLLPDAHRLSLTTLALKEYIGTFIYRLKGWL 265


>gi|78045108|ref|YP_360909.1| hypothetical protein CHY_2090 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77997223|gb|ABB16122.1| conserved hypothetical protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 203

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 69/195 (35%), Gaps = 17/195 (8%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIRIE 51
           +F   L   +  +      ++  +      +     A+VVL+G              R+ 
Sbjct: 10  FFGLTLIFLIAAWFFPLNYYL-ALPLTIKENPQPADAVVVLSGGLTKKGDLGESTRERLN 68

Query: 52  RAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
               L +N  G  + +SG           L+ K  +++ +    + +   + NT  N   
Sbjct: 69  LGINLWKNDYGRYLLLSGGSFTREPKDASLMAKEALKKGVPAPALLLESSSENTYENVLL 128

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
            +    +N +  +L+VT  YH  R              +     + +L     + +++  
Sbjct: 129 TANIYYQNRWKRILVVTSAYHTLRVKKMYNDRGVNATVVY---PAGELPNARGLLRLRQT 185

Query: 170 RVLLIEYLKILLLSI 184
            V++ EYLK+L   I
Sbjct: 186 IVVVEEYLKLLYYFI 200


>gi|258511943|ref|YP_003185377.1| hypothetical protein Aaci_1976 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478669|gb|ACV58988.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 199

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 62/207 (29%), Gaps = 29/207 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQM----HIPDHPSVSAIVVLTGEPI-------- 48
           M + W  L  C +  +      +R+  ++               VVL             
Sbjct: 1   MAWLWMCLLACGVAALGSLAFLLRFAVRLKHEGRSHRPQKSDVGVVLGAYTDGYEPSHPL 60

Query: 49  --RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             R+  A  L        I +SG      +VS+   +++  +   +    +     + NT
Sbjct: 61  VARLRAAIALYRQGYIRAIIVSGGQGENETVSEARSMKRFLVMNGIPSDAVHEERMSTNT 120

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             N   +SA      +   +I+T DYH+PR     +     ++       S         
Sbjct: 121 WENLYHSSAIMRDRGYRTAVIITSDYHLPRALAVAR--MMGMEATGCGAAS--------- 169

Query: 164 FKIKILRVLLIEYLKILLLSIQLSLST 190
                 R  + E    +   ++   + 
Sbjct: 170 -TKGEFRAAVREVFAHIEYMLRGRQAP 195


>gi|254504841|ref|ZP_05116992.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222440912|gb|EEE47591.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 268

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 65/218 (29%), Gaps = 33/218 (15%)

Query: 2   RYFW---YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG------------- 45
           R+ W    GL +C        +      +     +  S + +++L G             
Sbjct: 41  RFIWVGALGLVICGFSPAANLLIQPLEDRFSRPAELGSFNGVIILGGAVDTVVTGARGET 100

Query: 46  ----EPIRIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDI 96
                  R+  A  L +      I  +G   ++      +     ++     +A   I +
Sbjct: 101 ALTVSGERLTIAARLAKQLPEALIIHTGGQGTIITGQATESEGASRLFDDFGIASQRIIL 160

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++ NT  NA       +       L+VT  YHMPR+    +          YP+    
Sbjct: 161 EDESRNTWENAVLTKELVDPKPGQTWLLVTSAYHMPRSMGVFEAAG-WTGVTAYPVDYRT 219

Query: 157 LEENSSIFKIK----ILRVL---LIEYLKILLLSIQLS 187
                           LR L   + E++ + +  +   
Sbjct: 220 RGGADWGLGFDGASKGLRRLDIGVREWIGLTVYWMTGR 257


>gi|45656706|ref|YP_000792.1| hypothetical protein LIC10815 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|294828296|ref|NP_713526.2| hypothetical protein LA_3345 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599942|gb|AAS69429.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|293386147|gb|AAN50544.2| conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 258

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 72/210 (34%), Gaps = 30/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GEP 47
            +  +            S   Y   + +   P    I+VL                    
Sbjct: 49  LFLWILSTSTVSQKLIQSLEMYYPPVSLEQLPKADVILVLGGMVSTLSIHDEPVDLFNSA 108

Query: 48  IRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
            R+     L   +   KI  SG      + +V +     +   +  + +  + +  K+ N
Sbjct: 109 ERLTETVRLYRAKKAPKILFSGGSGNLFYQTVPESEPAGRFLKQMGIPDSSLILESKSRN 168

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD----LE 158
           T  N   A    +++ ++ V++VT  +HM R+    Q   + +  IP+P         L 
Sbjct: 169 TAENKSFAVGLLKEHGWNSVILVTSSFHMKRSVEIFQE--NGITIIPFPTDFRSQKSVLT 226

Query: 159 ENSSIFK---IKILRVLLIEYLKILLLSIQ 185
            ++       ++   + + E++ IL+  I+
Sbjct: 227 LDNFFPSTGCLENSTISIKEWIGILVHKIR 256


>gi|150398639|ref|YP_001329106.1| hypothetical protein Smed_3453 [Sinorhizobium medicae WSM419]
 gi|150030154|gb|ABR62271.1| protein of unknown function DUF218 [Sinorhizobium medicae WSM419]
          Length = 262

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/215 (13%), Positives = 60/215 (27%), Gaps = 33/215 (15%)

Query: 4   FWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLT----------------- 44
           F   +    +F   G  F+  +        P+   ++ ++VL                  
Sbjct: 43  FGLAVLFITLFTTAGSYFLQILEDRFPRPSPEPAELACMIVLGGAFENVVMASRGGIEMN 102

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYK 99
               R      L     G +I +SG                        +    +    +
Sbjct: 103 QAAERFVETLRLARAHPGARILVSGGDGSLSGIYEGDAHASAAFFGTFGIGPERLIREGE 162

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH---- 155
           +  T  NA+       +N      +VT  YHMPR+    +   + ++  P+P+       
Sbjct: 163 SRTTFENARNTRHLLRENGLDRCALVTSAYHMPRSVGLFR--ANDIEVTPWPVDYRTSGK 220

Query: 156 ---DLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
               ++        ++      E+  +L   +   
Sbjct: 221 VRLGVDFTQPSLNAQLATTAAKEWTGLLAYYLLGR 255


>gi|78189450|ref|YP_379788.1| hypothetical protein Cag_1489 [Chlorobium chlorochromatii CaD3]
 gi|78171649|gb|ABB28745.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 235

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/188 (13%), Positives = 62/188 (32%), Gaps = 12/188 (6%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIF 66
               + F  +G +        +          IVVL G+   R+++  EL  +   +K+ 
Sbjct: 41  GIAAMSFVSIGLLL------SLPASKPQKADVIVVLGGDKGLRVQKGAELYNDGFSKKVL 94

Query: 67  ISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           ++G+        +    ++      + +  I +  K+  +   A   +A  E+  +   +
Sbjct: 95  LTGIDRRYYRPSRPNWRERRIRDLGVKKSAIVVDTKSQTSWEEAMNTAATMERRKWESAI 154

Query: 124 IVTHDYHMPRTFLELQRINSTV--QFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +V+   HM R +L      +    +F                      + ++ E  K + 
Sbjct: 155 VVSDPPHMLRLWLTWHHAFAGTSKRFTLVATKPDWWHPIFWWKHKTNYKFVVSELKKNIA 214

Query: 182 LSIQLSLS 189
             +   + 
Sbjct: 215 YVVFHYIK 222


>gi|23012908|ref|ZP_00052888.1| COG1434: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 266

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/221 (12%), Positives = 62/221 (28%), Gaps = 37/221 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYV----KQMHIPDHPSVSAIVV--------------- 42
           +     L       ++    +         +   P    V  I+V               
Sbjct: 40  KVLGVTLLTVTFMAVVPLEYWAETWMEARFRAPNPLPEKVDGIIVLGGAINPVVSEARGQ 99

Query: 43  --LTGEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCID 95
             + G   R+     L +     ++  SG      +  + +    +            I 
Sbjct: 100 VSVGGGVTRMTTLIPLAKRYPEARLVFSGGSGSPFNPELREADYAKIFYDDLGFDTDRIV 159

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               + NT  NA  +    +       L++T   HMPR+    + +      +P P+  +
Sbjct: 160 FERDSRNTRENATLSKELMQPRPGETWLLITSAGHMPRSVGCFRAV--GWPVVPIPVDYY 217

Query: 156 DLEEN-SSIFKIK--------ILRVLLIEYLKILLLSIQLS 187
               +     +++         L  L+ E L +++  +   
Sbjct: 218 TTGLDKPWWTELRFSPQKGIFGLAPLIHEGLGLVMYRLMGW 258


>gi|299065943|emb|CBJ37124.1| conserved protein of unknown function, DUF218 [Ralstonia
           solanacearum CMR15]
          Length = 180

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 53/154 (34%), Gaps = 7/154 (4%)

Query: 34  HPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
                 IVVL      R+  A EL    +  ++F+SG    +    L+ +      +   
Sbjct: 33  PGRADVIVVLGGESGQRVIGAAELYHAGVAPRMFVSGGGDCL----LIVRRLEMAGVPAE 88

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I    ++ +T  NA+              ++VT  YH  R     +R+   V +    +
Sbjct: 89  RIGHECESGSTMENARMTRRTLAGQPVRSAVLVTSWYHTGRALNVFRRVWPEVAWGARGV 148

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
              D    S          +L EY+K    +++ 
Sbjct: 149 FPGDTFAKSFPIYESGS--ILAEYIKRTWYAVRY 180


>gi|149915963|ref|ZP_01904486.1| hypothetical protein RAZWK3B_00010 [Roseobacter sp. AzwK-3b]
 gi|149810037|gb|EDM69885.1| hypothetical protein RAZWK3B_00010 [Roseobacter sp. AzwK-3b]
          Length = 266

 Score = 82.2 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 63/217 (29%), Gaps = 32/217 (14%)

Query: 4   FWYGLFVCLIFF-----IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI---------- 48
           FW    +  + F     +   I      +    PD    + I+VL G             
Sbjct: 44  FWVNGTLLFVLFMGFVPLGQLIMRPLEQRYPSAPDIAPPAGIIVLGGGEDGAMSAASGLP 103

Query: 49  -------RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDI 96
                  R+     L       K+  +G             I+ +       +    I +
Sbjct: 104 ETNGAGDRMSAGVALALAYPDAKLIFTGGSGQFLAGGVSGAIVAKAYFESLGVDPERIIL 163

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             +A NT  NA  +    +       ++VT  +HMPR+              P+P+    
Sbjct: 164 EGRARNTAENAAFSRELVDDPRIGPWVLVTSAFHMPRSLATFCAAG-WRDITPFPVDYRS 222

Query: 157 LE--ENSSIF--KIKILRVLLIEYLKILLLSIQLSLS 189
           +   E         + L + + E++ +L       + 
Sbjct: 223 ITDLEFKWDPTGNFEKLNLSIKEWIGLLAYEWTGRID 259


>gi|51891778|ref|YP_074469.1| hypothetical protein STH640 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855467|dbj|BAD39625.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 187

 Score = 82.2 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 65/171 (38%), Gaps = 9/171 (5%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP-IRIERAFELLENQIGEKIFISGVHHS---VSKDILLQK 82
                 +      I+V  G+   R ERA EL +  +  K+FI+G       V +   L+ 
Sbjct: 17  YLFVEDEPTPGDLILVFGGKRLERAERAAELYKAGLAPKVFITGGDKRGIGVCEAERLRD 76

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRTFLEL 138
             +   +    IDI  + LNT    Q +    E+     N  +VL+V+  +HM R    +
Sbjct: 77  HMVELSVPAEAIDIECEGLNTIEQVQYSVKRIEETIGWKNIKNVLLVSAPHHMRRVKRTI 136

Query: 139 QRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                   +    P    D+  ++        +++  E  K+   ++  +L
Sbjct: 137 ANYIPRETKITCCPDRRTDITRDNWWHTDDGQKLVYRELEKVRTYALHGNL 187


>gi|187778517|ref|ZP_02994990.1| hypothetical protein CLOSPO_02112 [Clostridium sporogenes ATCC
           15579]
 gi|187772142|gb|EDU35944.1| hypothetical protein CLOSPO_02112 [Clostridium sporogenes ATCC
           15579]
          Length = 181

 Score = 82.2 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 66/170 (38%), Gaps = 15/170 (8%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH-- 71
           + +             I++L  +            R++    L     G+ I +SG    
Sbjct: 14  KIIYFGVKSQPQKSDCIIILGCKVKGNDPTPFLQWRLDEGLRLYNEGYGKYIIVSGAKGP 73

Query: 72  -HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
             ++S+   ++K  + + + +  I +  K+ NT  N + +    E NN    +IV++ YH
Sbjct: 74  GENISEAEAMEKYLVEKGVDKNFIILEDKSKNTLENIKFSKKKMEDNNLKSSIIVSNKYH 133

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           + R  L  Q+    ++     +       +  +   + +  LL+ Y+K +
Sbjct: 134 LKRAELLCQK--EGIKASYSGVFVKPHMSHEIVGFFREIPALLVYYVKTI 181


>gi|269963292|ref|ZP_06177623.1| hypothetical protein VME_40070 [Vibrio harveyi 1DA3]
 gi|269831931|gb|EEZ86059.1| hypothetical protein VME_40070 [Vibrio harveyi 1DA3]
          Length = 207

 Score = 82.2 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 60/166 (36%), Gaps = 11/166 (6%)

Query: 26  VKQMHIPDHPSVSAIVVLTGE---PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
           V   H  +      +VVL        ++  A  L + +   K+ +SG +       +   
Sbjct: 36  VFPTHQDEFQHAEVLVVLGSYKATQYKMPTAVRLYKEKKVSKLLLSGGNLAIDQKPEFES 95

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLE 137
           +++  +   + +  I +   A NT  NAQ +S    ++      V I+T  +H+ R    
Sbjct: 96  MKEYALDNGVPDSDIILERHAKNTVENAQYSSEIILESEIAKRSVAILTTAFHIKRAKYL 155

Query: 138 LQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLL--IEYLKIL 180
            +      ++   Y +       ++       +  ++   E +K L
Sbjct: 156 FKNALPQYLELHSYFVNDRSTRRDNWWLTESAISRVMHSHEVIKRL 201


>gi|253578294|ref|ZP_04855566.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850612|gb|EES78570.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 199

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 51/169 (30%), Gaps = 22/169 (13%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG------------------ 69
                      I V      ++ E+A EL +  + + I  SG                  
Sbjct: 17  FAENKPEKSDIIFVPGNGYPQMAEKAAELFKKGMADWILPSGKYSVVNGKFSGVLEKSNV 76

Query: 70  -VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVT 126
                 ++   L+ + I+  + +  I    +A  T  NA  +    +         ++  
Sbjct: 77  YDKEYGTEWEFLRDVLIKNGVPDQKILKEDQATFTYENAIYSRQVTDHAELEIERAILCC 136

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
             YH  R  +  Q +    +F   P+ +  +   +     + +  +  E
Sbjct: 137 KSYHARRCLMYYQLLYPKTEFYVVPVNADGITRENWRKNEEGIDAVTGE 185


>gi|291531732|emb|CBK97317.1| Uncharacterized conserved protein [Eubacterium siraeum 70/3]
          Length = 201

 Score = 81.4 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/165 (15%), Positives = 51/165 (30%), Gaps = 22/165 (13%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSKD-------------- 77
           +   V AI +  G      E A EL    + + I  SG      +               
Sbjct: 18  EPQKVDAIFLPGGSHPEQPEYAAELYRQGLTDWIVPSGGVSVKEEKWHGVRSKAEIYSGD 77

Query: 78  -----ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYH 130
                     + ++  + +  I    K+ +T  NA  +    ++        +IV   +H
Sbjct: 78  YRSDCEFFTDVLVKNGVPQTAIIEESKSGHTRDNAFLSRKAVDEKGIMIKSGIIVCKAFH 137

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
             R  +  Q     V     P+  +++ + +     K    +L E
Sbjct: 138 ARRCLMLYQMAFPNVDMTVCPVHCYNITKENWYTTEKGTDRVLGE 182


>gi|153810184|ref|ZP_01962852.1| hypothetical protein RUMOBE_00565 [Ruminococcus obeum ATCC 29174]
 gi|149833363|gb|EDM88444.1| hypothetical protein RUMOBE_00565 [Ruminococcus obeum ATCC 29174]
          Length = 194

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 53/169 (31%), Gaps = 22/169 (13%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH---------------- 71
                      I V      ++ ERA +L   +    +  SG +                
Sbjct: 14  FAENKPEKADIIFVPGNGYSQMAERAAQLYAKKYALFVLPSGKYSISTGRFGGVLTGQKR 73

Query: 72  ---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVT 126
                 ++   L+ + ++  +    +    +A  T  NA+ +    ++        +I  
Sbjct: 74  YSGEYQTEWEFLKDVLMKNGVPADAVLKEDQATFTWENAKFSRKVTDQAGINIRKAIICC 133

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            +YH  R  +  QR     +F   P     +  ++     + ++ +L E
Sbjct: 134 KNYHARRALMYYQRAYPDTEFRVCPCCVDGITRDNWTESERGIKEVLAE 182


>gi|300703293|ref|YP_003744895.1| hypothetical protein RCFBP_10965 [Ralstonia solanacearum CFBP2957]
 gi|299070956|emb|CBJ42264.1| conserved protein of unknown function, DUF218 [Ralstonia
           solanacearum CFBP2957]
          Length = 190

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 55/154 (35%), Gaps = 7/154 (4%)

Query: 34  HPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
                 IVVL      R+  A EL    +  ++F+SG    +    L+ +  +   +   
Sbjct: 43  PGHADVIVVLGGESGQRVIGAAELYHAGVASRVFVSGEGDCL----LIVRRLVMAGVPAG 98

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I    ++ NT  NA+      +       ++VT  YH  R     +R+   V +    +
Sbjct: 99  RIGHECESGNTMENARMTRRMLDGQPVRSAVLVTSWYHTGRALHAFRRVWPEVAWRARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
              D    S          +L EYLK    +++ 
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYLKRAWYAVRY 190


>gi|291556712|emb|CBL33829.1| Uncharacterized conserved protein [Eubacterium siraeum V10Sc8a]
          Length = 201

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 26/165 (15%), Positives = 51/165 (30%), Gaps = 22/165 (13%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSKD-------------- 77
           +   V AI +  G      E A EL    + + I  SG      +               
Sbjct: 18  EPQKVDAIFLPGGSHPEQPEYAAELYRQGLTDWIVPSGGVSVKEEKWHGVRSKAEIYSGD 77

Query: 78  -----ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYH 130
                     + ++  + +  I    K+ +T  NA  +    ++        +IV   +H
Sbjct: 78  YRSDCEFFTDVLVKNGVPQTAIIEEGKSGHTRDNAFLSRKAVDEKGIMIKSGIIVCKAFH 137

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
             R  +  Q     V     P+  +++ + +     K    +L E
Sbjct: 138 ARRCLMLYQMAFPNVDMTVCPVHCYNITKENWYTTEKGTDRVLGE 182


>gi|144899829|emb|CAM76693.1| Protein of unknown function DUF218 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 261

 Score = 81.0 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 54/206 (26%), Gaps = 29/206 (14%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------------PIRIE 51
            V  + +    +  +             V  ++VL G                    R+ 
Sbjct: 50  IVAFVPWQAILVQPLENRFPGPSSLPQRVDGVIVLGGALDPVVSAARDQVAANGAVERVN 109

Query: 52  RAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
               L  +    ++  SG           +  + ++           I    ++ NT  N
Sbjct: 110 ALIWLGRHYPKARLVFSGGSGSVTTPDKKEAPVARRYLNELGFGTDGIVFEDQSRNTREN 169

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI--- 163
           A          N    L+VT   HMPR+             I YP+      E       
Sbjct: 170 AVYTKQLMAPKNGEVWLLVTSAMHMPRSMGAF--AAVDWPVIAYPVDYLTTGEGGGFAFD 227

Query: 164 --FKIKILRVLLIEYLKILLLSIQLS 187
                  +   L E+L +L   ++  
Sbjct: 228 LGSAFSSIGNGLHEWLGLLYYRMRGW 253


>gi|94266695|ref|ZP_01290369.1| Protein of unknown function DUF218 [delta proteobacterium MLMS-1]
 gi|93452658|gb|EAT03218.1| Protein of unknown function DUF218 [delta proteobacterium MLMS-1]
          Length = 254

 Score = 81.0 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 69/211 (32%), Gaps = 33/211 (15%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------------PI 48
           W   +   +      +S           + P+   IV+L G                   
Sbjct: 48  WLWFWSLPVVADALRLSLEGRFAPQRAEELPAADFIVLLGGGVRGVPADWPYPDLNAAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+  A  L        I +SG           +   ++++ +   + +  I +  ++ +T
Sbjct: 108 RVWHAPRLYHADKAPLIIVSGGGKEWHGERGSEAEAMRELLLAFGVPDGAIRLEDRSRST 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN-------STVQFIPYPIISHD 156
             NA   +    +      L+VT   HMPR+    + +        +  + IP P+ S  
Sbjct: 168 RENALYTAPLVGERPV---LLVTSAQHMPRSLATFRAVGINAVPAPTDFEVIPQPLHSLR 224

Query: 157 LEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
           L  ++           L EYL +L+  ++  
Sbjct: 225 LLPDAHSLHQSTS--ALKEYLGLLVYRLRGW 253


>gi|167751187|ref|ZP_02423314.1| hypothetical protein EUBSIR_02173 [Eubacterium siraeum DSM 15702]
 gi|167655902|gb|EDS00032.1| hypothetical protein EUBSIR_02173 [Eubacterium siraeum DSM 15702]
          Length = 201

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 52/165 (31%), Gaps = 22/165 (13%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSKD-------------- 77
           +   V AI +L G      E A EL    + + I  SG      +               
Sbjct: 18  EPQKVDAIFLLGGSHPEQPEYAAELYRQGLTDWIVPSGGVSVKEEKWHGVRSKAEIYSGD 77

Query: 78  -----ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYH 130
                     + ++  + +  I    K+ +T  NA  +    ++        +IV   +H
Sbjct: 78  YRSDCEFFTDVLVKNGVPQTAIIEESKSGHTRDNAFLSRKAVDEKGIMIKSGIIVCKAFH 137

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
             R  +  Q     V     P+  +++ + +     K    +L E
Sbjct: 138 ARRCLMLYQMAFPNVDMTVCPVHCYNITKENWYTTEKGTDRVLGE 182


>gi|331083076|ref|ZP_08332193.1| hypothetical protein HMPREF0992_01117 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330405078|gb|EGG84615.1| hypothetical protein HMPREF0992_01117 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 200

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 56/173 (32%), Gaps = 22/173 (12%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH---------------- 71
                      I +      ++ E A +L    +   I  SG +                
Sbjct: 14  FVEDKAEKSDMIFIPGSGFPQLAEEAAKLYHQGLAPYILPSGKYSILNGKFAGVQEKQEL 73

Query: 72  ---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE--KNNFHHVLIVT 126
                 ++   L+++  +  ++E  I    KA  T  NA  +    +         ++  
Sbjct: 74  YDGEYETEWEFLKEVLKKNQVSEEHILREDKATYTYENAIYSRKVTDCLGMEIKKAILCC 133

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             YH  R+ L  Q +    QF   PI   D++  +     K +R++  E  KI
Sbjct: 134 KPYHARRSLLYYQLLYPETQFFVRPIQDSDVKRENWYLTEKGIRLVFGEVQKI 186


>gi|260589645|ref|ZP_05855558.1| conserved hypothetical protein [Blautia hansenii DSM 20583]
 gi|260539885|gb|EEX20454.1| conserved hypothetical protein [Blautia hansenii DSM 20583]
          Length = 200

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 55/173 (31%), Gaps = 22/173 (12%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG------------------ 69
                      I +      ++ E A +L    +   I  SG                  
Sbjct: 14  FVEDKPEKSDVIFIPGSGFPQLAEEAAKLYHQGLVPYILPSGRYSVLNGKFAGVQEKKEL 73

Query: 70  -VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE--KNNFHHVLIVT 126
                 ++   L+++  +  ++E  I    KA  T  NA  +    +         ++  
Sbjct: 74  YDGEYETEWEFLKEVLKKNHVSEEHILREDKATYTYENAIYSRKVTDCLGMEIKKAILCC 133

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179
             YH  R+ L  Q +    QF   PI   D++  +     K +R++  E  KI
Sbjct: 134 KPYHARRSLLYYQLLYPETQFFVRPIQDSDVKRENWYLTEKGIRLVFGEVQKI 186


>gi|157364443|ref|YP_001471210.1| hypothetical protein Tlet_1592 [Thermotoga lettingae TMO]
 gi|157315047|gb|ABV34146.1| protein of unknown function DUF218 [Thermotoga lettingae TMO]
          Length = 245

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 65/210 (30%), Gaps = 29/210 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVK---QMHIPDHPSVSAIVVLTGEPI----------- 48
            F   L +C  FF  G  +    +       I     + A+VVL G  +           
Sbjct: 38  IFMIFLALCFYFFSSGLGALTLVLPLERSYEISIPKKIDAVVVLGGGIVKTPNGYQPSQS 97

Query: 49  ---RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALN 102
              R+     + ++     I   G+        + ++++ + I        I I   A  
Sbjct: 98  SIVRLLEGVRIAKDFDSFLIISGGMLPLLNQPPEAVVMRDLAISLGFPAEAIIIEPDAKT 157

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-HDLEENS 161
           T  NA   S    +  F +V++VT   HM R      +        P P    ++  +  
Sbjct: 158 TFENAIFTSQICREKGFQNVVVVTSAIHMKRAIYSFSKAR--FTVHPCPTGYLYNHSKLG 215

Query: 162 SIFKIKILRVL------LIEYLKILLLSIQ 185
               +     L      + E + IL    +
Sbjct: 216 WSDYLPNRDALTANLWAIHEIIGILWYRFK 245


>gi|158335605|ref|YP_001516777.1| hypothetical protein AM1_2455 [Acaryochloris marina MBIC11017]
 gi|158305846|gb|ABW27463.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 261

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 69/218 (31%), Gaps = 37/218 (16%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------------GEPI 48
              LF     ++   + +    +   +    +  AIVVL                     
Sbjct: 45  LGILFFSANGWVGDGLLYSLEHQYPPLKQDATADAIVVLGGCTRSAHPPRPWVEVSEAGD 104

Query: 49  RIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+  A +L       K+ ++G           + + + ++     + E  + +   +LNT
Sbjct: 105 RVLYAAKLYREGKAPKVVLAGGRIYWKGGGQAEALDMAELLKIMGVPESALLLEPDSLNT 164

Query: 104 EGNAQEASAWAEKNNFHHV-LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN-- 160
             NA       ++NN     L+VT  +HMPR+    +     +  I  P      E N  
Sbjct: 165 FENATNVKRVLKQNNIDGPLLLVTSAFHMPRSMAIFETQ--GLSVIAAPTDYQVTEVNEN 222

Query: 161 -----------SSIFKIKILRVLLIEYLKILLLSIQLS 187
                        I  +    +   E++  L+  ++  
Sbjct: 223 AGFLGFVLRLLPDIEALVNTTIAFKEWIGFLMYRLRGW 260


>gi|254282506|ref|ZP_04957474.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
 gi|219678709|gb|EED35058.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
          Length = 253

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 62/216 (28%), Gaps = 30/216 (13%)

Query: 3   YFWYGLFVCLIFFIMG-------FISFIRYVKQMHIPDHPSVSAIVVLT----------- 44
           + W  L   L++F                        + P    IVVL            
Sbjct: 38  FLWSFLAFALVYFCSTEFGANTLMEPLEARYPAFAPEELPKAEVIVVLGGAIDGESRFGR 97

Query: 45  -----GEPIRIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAECCIDIG 97
                    R+  A EL   ++   + +SG        +  L+ +      +    + + 
Sbjct: 98  GGDATHAADRLLTAAELYARKMAPYMLLSGGAPSGQRPEADLMAEKLEFMGVPRSAMLLE 157

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP--YPIISH 155
             +  T  NA  ++      N+ H+L+VT   HM R     +     V  +   + I  +
Sbjct: 158 PASRTTFDNAVNSADMLNARNYRHILLVTSGAHMRRAVALFEAFGLQVTAVATDHQIPRY 217

Query: 156 DLEENSSIFKIKILR---VLLIEYLKILLLSIQLSL 188
                  +     L      + E++   +  +    
Sbjct: 218 APTVPGWLPTADRLARSTRAVHEWVGYWVYDLTGKF 253


>gi|227824083|ref|YP_002828056.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227343085|gb|ACP27303.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 261

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 57/215 (26%), Gaps = 33/215 (15%)

Query: 4   FWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLT----------------- 44
               +    +F   G  F+  +        P    ++ I+VL                  
Sbjct: 43  LGLIVLFLSLFTTTGPYFLQMLEDRFPRPSPPPAEIACIIVLGGAFENVVIASRGGMEFN 102

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYK 99
               R   A  L +     +I +SG                Q       +    +     
Sbjct: 103 QAADRFVEAVRLAKAYPAARILVSGGDGSISGAYEGDARASQGFFNAFGIGADRVIREED 162

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH---- 155
           +  T  NA+        N      +VT  YHMPR+    +   + +  +P+P        
Sbjct: 163 SRTTFENARYTKDLLAANGLERCALVTSAYHMPRSVGLFR--ANGIAVVPWPADYRTSGK 220

Query: 156 ---DLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
                + +      ++      E+  +L   +   
Sbjct: 221 VRLGFDFSQPSLNAQLATTAAKEWTGLLAYYLLGR 255


>gi|16330498|ref|NP_441226.1| hypothetical protein sll1606 [Synechocystis sp. PCC 6803]
 gi|1652989|dbj|BAA17906.1| sll1606 [Synechocystis sp. PCC 6803]
          Length = 262

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 73/210 (34%), Gaps = 38/210 (18%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLE 58
           ++   +      + + + D P    IVVL G                   R+    ++ +
Sbjct: 55  WVSDALLRTLEYQYLPMEDFPQAPVIVVLGGGLYQATYPRQFPEVAEAGDRVIYGAQIYQ 114

Query: 59  NQIGEKIFISGVHHSV------SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
                 I  +G           S+   +  +  R D+    I    K+LNT  NA     
Sbjct: 115 EGKAPYIITTGGRIPWLGTVATSEAEDMALLLQRLDVPREAIIKEEKSLNTRQNAVFTQK 174

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDLEENSS-------- 162
             ++   + +++VT  YHMPR     +++   +  IP      S  L  N+         
Sbjct: 175 ILQQRGINTIILVTSGYHMPRAKRVFEKL--GIIVIPAATDFLSQPLGRNNFNLANVILG 232

Query: 163 ----IFKIKILRVLLIEYLKILLLSIQLSL 188
                  +++  + L EYL +++  +Q  +
Sbjct: 233 LMPDAKSLQMTTMALKEYLGLVIYKLQGWV 262


>gi|298291473|ref|YP_003693412.1| hypothetical protein Snov_1483 [Starkeya novella DSM 506]
 gi|296927984|gb|ADH88793.1| protein of unknown function DUF218 [Starkeya novella DSM 506]
          Length = 274

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 65/224 (29%), Gaps = 35/224 (15%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------------IR 49
            L   L       +  +      ++ +   V  ++VL G                    R
Sbjct: 48  LLVAGLSPIGRMLMVPLENRFPAYVDEGSPVDGVIVLGGAELAGITAARGQSSFQEAGER 107

Query: 50  IERAFELLENQIGEKIFISGVHHSVSKDILLQKI------PIRQDLAECCIDIGYKALNT 103
           +    EL     G +I  +G   ++ +   +Q+         +  +    ++    + NT
Sbjct: 108 MLAMGELARRYPGARIVFAGGSSNLVEASPMQEADVVRLALPQIGVDPARVEFERYSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA+ A    +       L+VT  +HMPR     +        IPYP+    +      
Sbjct: 168 AENARLARELVKPQPDQRWLLVTSAFHMPRAIGCFRAA--GFPVIPYPVDYRTIGRPELF 225

Query: 164 FKIKILR-------VLLIEYLKILLLSIQLS---LSTQTASQFF 197
                +        +   E++ ++   +      L         
Sbjct: 226 RLFGTVADGLSFVDLATREWMGLVAYYLAGRTDALFPAPDQPPG 269


>gi|312793878|ref|YP_004026801.1| hypothetical protein Calkr_1698 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181018|gb|ADQ41188.1| protein of unknown function DUF218 [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 195

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 63/192 (32%), Gaps = 15/192 (7%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           ++    +       ++  ++    +             I+VL               R+ 
Sbjct: 3   KFLKISICTLATVILIFAVTEASIIIFGISSKPKKSDCIIVLGCAVYGDFPSPFFRERLN 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           RAFEL +      I + G      ++S+    ++  + + +    I    K+ +T  N  
Sbjct: 63  RAFELYKKGYARYIIVCGAKGPGENISEAEAGKRYLVERGVLPELILKEDKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            +     K  F   +IV++ +H+ R  L  +++     F    +             ++ 
Sbjct: 123 YSKKIMNKKGFKSTIIVSNMFHLRRASLIAKKLKMNASF--SGVYVKQYLHEEYYGFVRE 180

Query: 169 LRVLLIEYLKIL 180
              +  E LK L
Sbjct: 181 SVAMWYEILKTL 192


>gi|34499583|ref|NP_903798.1| hypothetical protein CV_4128 [Chromobacterium violaceum ATCC 12472]
 gi|34105434|gb|AAQ61789.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 190

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 62/171 (36%), Gaps = 10/171 (5%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKD 77
            I + +       P  P    IVVL      R+  A EL        +F+SG    +   
Sbjct: 25  LIRYSKSWLVAETPQ-PRADWIVVLGGESGERVIGAAELYHQGRAPFVFVSGEGDCLLIV 83

Query: 78  ILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLE 137
             LQ       +    I     + +T  NA              + +VT  +H  R    
Sbjct: 84  RRLQMA----GVPRGKIGYECLSKSTWQNAVLTRQALASRQPRRITLVTSWFHSRRALET 139

Query: 138 LQRINSTVQFIPYPIIS-HDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            ++    V++  + +   +DL  + + ++      +L EYLKIL+ S++  
Sbjct: 140 FRQAWPEVEWGMHIVYPGNDLYHSLAWYEAGA---VLTEYLKILVYSVRYW 187


>gi|160881431|ref|YP_001560399.1| hypothetical protein Cphy_3306 [Clostridium phytofermentans ISDg]
 gi|160430097|gb|ABX43660.1| protein of unknown function DUF218 [Clostridium phytofermentans
           ISDg]
          Length = 189

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 57/150 (38%), Gaps = 10/150 (6%)

Query: 36  SVSAIVVLTGEPIRIER-AFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDL 89
               I++  G   ++   A +LLE  + + I  SG          ++   L+ I I++ +
Sbjct: 20  PCDIILIPGGSHPQLMEKAVDLLEMGMAKYILPSGGKNKKLPDYPNEADFLKTIAIKRGI 79

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFH--HVLIVTHDYHMPRTFLELQRINS-TVQ 146
           +   I    KA NT  NA  +             V++V   YH  R     Q++      
Sbjct: 80  SSDIIICENKATNTYENALFSYELLMGKCIDITKVILVCKAYHSRRALFSYQKVFPANTT 139

Query: 147 FIPYPIISH-DLEENSSIFKIKILRVLLIE 175
           F   P+  +  + + +   +   + +++ E
Sbjct: 140 FFVCPVTDNRGITKENWFTRNDYIELIMRE 169


>gi|312144373|ref|YP_003995819.1| protein of unknown function DUF218 [Halanaerobium sp.
           'sapolanicus']
 gi|311905024|gb|ADQ15465.1| protein of unknown function DUF218 [Halanaerobium sp.
           'sapolanicus']
          Length = 252

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 75/217 (34%), Gaps = 31/217 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA-----IVVLTGE--------- 46
           +++      + LIF    F   +  +   +  +  SV       IVVL G          
Sbjct: 38  IKFLATATLIFLIFISTAFGVKVLLLPLENYAEEISVDLEEDHPIVVLGGGNYYKTDGSA 97

Query: 47  ------PIRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIG 97
                   R+ +A+EL      + I+  G    H + S+    ++      L     +  
Sbjct: 98  EPSVHSKQRLAKAYELHRTLNTKIIYSGGVGLGHDNFSEADAAKEFLSGLGLESEKYESE 157

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
            +A +T  NA     W  +N    + +VT  YHM R+    +     + F+ +       
Sbjct: 158 DQARSTYENALYIKKWLNENEIERIYLVTSAYHMYRSARAFRAQ--EIDFLAHHSGFIYD 215

Query: 158 EENSSIFKIKILRVL------LIEYLKILLLSIQLSL 188
            + S +  +     L      L E++ I+   ++  +
Sbjct: 216 HKFSWLNYLPNRGALQVNLSALHEWVGIVWYYLRARI 252


>gi|209964476|ref|YP_002297391.1| hypothetical protein RC1_1164 [Rhodospirillum centenum SW]
 gi|209957942|gb|ACI98578.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 271

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 56/197 (28%), Gaps = 30/197 (15%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELL 57
                +  +             V  I+VL                      R+     L 
Sbjct: 57  VGAWMLWSLESRFPSPATLPGRVDGIIVLGGAVRPILTADRGQPALNEHAERLTEIPALA 116

Query: 58  ENQIGEKIFISGVHHSVSKDIL-----LQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
                 +I  +G    V +  L      +    R       +    ++ NT  NA  +  
Sbjct: 117 RRYPDARIVFTGGSGLVFEQDLKEAPVARAAWERMGFDTARVLFEQESRNTWENALLSRD 176

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK----- 167
            A        L+VT   HMPR+    +RI      +PYP+  H  + +            
Sbjct: 177 LAHPVEGEAWLLVTSAMHMPRSVGIFRRI--GWNVVPYPVDFHVPDRSLYRIGFDLTDGL 234

Query: 168 -ILRVLLIEYLKILLLS 183
             L   L EY+ +++  
Sbjct: 235 RSLSYALHEYIGLVVYR 251


>gi|167039302|ref|YP_001662287.1| hypothetical protein Teth514_0643 [Thermoanaerobacter sp. X514]
 gi|256752180|ref|ZP_05493045.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913942|ref|ZP_07131259.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X561]
 gi|307725373|ref|YP_003905124.1| hypothetical protein Thet_2282 [Thermoanaerobacter sp. X513]
 gi|166853542|gb|ABY91951.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X514]
 gi|256748908|gb|EEU61947.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300890627|gb|EFK85772.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X561]
 gi|307582434|gb|ADN55833.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X513]
          Length = 192

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 63/158 (39%), Gaps = 14/158 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIVVLTGE----------PIR 49
           M+     + V ++ F+   I+    +    +         I+VL               R
Sbjct: 1   MKLLLRFIGVLIVIFVTVVITLEYQIISFALYEKPKKSDVIIVLGCAVYGKTPSPFFKER 60

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++ A  L +   G+ I +SG      ++S+    ++  ++  + E  I    K+L+T  N
Sbjct: 61  LDEALRLYKEGYGKYIIVSGGKGPGENISEAEAGKEYLLKNGIPEKIILTDNKSLSTYEN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST 144
              +    +KN+    +I+++ +H+ R  +  +RI   
Sbjct: 121 LFFSKEIMDKNSLKTAIIISNKFHLKRASVIAKRIGID 158


>gi|312877810|ref|ZP_07737760.1| protein of unknown function DUF218 [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795436|gb|EFR11815.1| protein of unknown function DUF218 [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 195

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 63/192 (32%), Gaps = 15/192 (7%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           ++    +       ++  ++    +             I+VL               R+ 
Sbjct: 3   KFLKISICTLATVILIFAVTEASIIIFGISSKPKKSDCIIVLGCAVYGDFPSPFFRERLN 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           RAFEL +      I + G      ++S+    ++  + + +    I    K+ +T  N  
Sbjct: 63  RAFELYKKGYARYIIVCGAKGPGENISEAEAGKRYLVERGVLPELILKEDKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            +     K  F   +IV++ +H+ R  L  +++     F    +             ++ 
Sbjct: 123 YSKRIMNKKGFKSAIIVSNMFHLRRASLIAKKLKMNASF--SGVYVKQYLHEEYYGFVRE 180

Query: 169 LRVLLIEYLKIL 180
              +  E LK L
Sbjct: 181 SVAVWYEILKTL 192


>gi|115380347|ref|ZP_01467350.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115362646|gb|EAU61878.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 233

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 71/215 (33%), Gaps = 28/215 (13%)

Query: 1   MRYFWYGLFVCLIF--FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------------ 46
           ++     +           G + ++    +          A++VL G             
Sbjct: 16  LQVLGLAVLYTFSIEPVAGGLMRWVESGAKETYRPEVVYDAVIVLGGGLDPDATERSGRP 75

Query: 47  -----PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDI 96
                  RI R +ELL       + +SG        +V +  +LQ+  +   +A   I +
Sbjct: 76  EYNAAVERILRGYELLREGRARHVLLSGGSLDTRPEAVIEATVLQRQLLAWGIAPERIVV 135

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-SH 155
              + NT  NA ++    E+  +  +L++T   H+PR +     +      +   +  S 
Sbjct: 136 EGHSRNTRENALDSKKLIEERGWKTLLLITSAAHLPRAYGCFAAVGLRPDTLAADVRASD 195

Query: 156 DLEENSSIFKIKILRV---LLIEYLKILLLSIQLS 187
                S + +   L      L E    ++  ++  
Sbjct: 196 GKRPPSWLPRANHLSASTDALRELAGRVVYRLRGW 230


>gi|326390031|ref|ZP_08211593.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993896|gb|EGD52326.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 192

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 64/161 (39%), Gaps = 14/161 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIVVLTGE----------PIR 49
           M+     + + ++ F+   I+    +    +         I+VL               R
Sbjct: 1   MKLLLRFIGILIVIFVTVVITLEYQIISFALYEKPKKSDVIIVLGCAVYGKTPSPFFKER 60

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++ A  L +   G+ I +SG      ++S+    ++  ++  + E  I    K+ +T  N
Sbjct: 61  LDEALRLYKEGYGKYIIVSGGKGPGENISEAEAGKEYLLKNGIPEKIILTDDKSFSTYEN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
              +    +KN+    +I+++ +H+ R  +  +RI+    F
Sbjct: 121 LLFSKEIMDKNSLKTAIIISNKFHLKRASVIAKRIDINASF 161


>gi|300021971|ref|YP_003754582.1| hypothetical protein Hden_0439 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523792|gb|ADJ22261.1| protein of unknown function DUF218 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 264

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 64/211 (30%), Gaps = 32/211 (15%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP--SVSAIVVLT----------------- 44
           F +      +      +  +    +   P  P   ++ I+VL                  
Sbjct: 45  FSWLAVAGFLPLGNALVLPLEQRFEQRQPPLPDGHLTGIIVLGGFEDGWVTSNRGGLAIN 104

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHHSVS----KDILLQKIPIRQDLAECCIDIGYKA 100
               R+  A  +   +   KI  +G    +         +++  +   +A   + I   +
Sbjct: 105 ESAERLTEAIRIARQRPELKIVFTGGVGDLFGGFEASEAIRQYVVDAGIAPERVIIENGS 164

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            +T  NA               L+VT  YHMPR     ++    +   P+P+     +  
Sbjct: 165 RDTYENAVLTLQTLNPAPDDRWLLVTSAYHMPRAVGAFRQA--GLNISPFPVDFRTRDAG 222

Query: 161 SSIFKI-------KILRVLLIEYLKILLLSI 184
             +          +   + + E++ ++   I
Sbjct: 223 DILRFPISVAAGLQRADLAVREWIGLVAYRI 253


>gi|332975337|gb|EGK12233.1| hypothetical protein HMPREF9373_1599 [Psychrobacter sp. 1501(2011)]
          Length = 260

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 64/204 (31%), Gaps = 30/204 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQM---HIPDHPSVSAIVVLTGE----------P 47
           +R  W  L+     +++ F+ F   +             V AI++L G            
Sbjct: 63  LRKIWKTLWAGFGIWLVSFLVFAFTLHSHVRQPNEPFEKVDAIIILGGGIQDGLPTPTLA 122

Query: 48  IRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQ-DLAECCIDIGYKALNT 103
            R++ A  L+  Q    +  SG      + S+   + +       +    I    K+ +T
Sbjct: 123 SRLDTAVPLIREQPEAIVITSGGVGIGETRSEGEAMAQYLHALYGIPLDDIYQEKKSTST 182

Query: 104 EGNAQEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
           E N   +       N      + IVT D+HMPR+    +        +     +      
Sbjct: 183 EENFLFSQKILTDKNISLKDPIAIVTSDFHMPRSKAIAEHQGY-TNLVTVASPTPLETRY 241

Query: 161 SSIFKIKILRVLLIEYLKILLLSI 184
           ++            EY   +   I
Sbjct: 242 NAW---------FREYFAYISGWI 256


>gi|182416855|ref|ZP_02948241.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237668114|ref|ZP_04528098.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182379317|gb|EDT76816.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237656462|gb|EEP54018.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 202

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/178 (15%), Positives = 52/178 (29%), Gaps = 24/178 (13%)

Query: 22  FIRYVKQM--HIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFISGVHHSVS--- 75
           FI  +               I V  G  P  +E+A +L  +     I  SG         
Sbjct: 7   FIEEITSYIFVEDKIEKSDIIFVPGGLYPEPMEKACDLYLHGYAPYILPSGKFSMKFNGF 66

Query: 76  ----------------KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN- 118
                           +   L+ + I   + E  +     A  T+ NA  +    +K   
Sbjct: 67  TKPESKKDKYKKDYKTEFEFLKDVAIINGVPEEVVLKEDCATWTKQNAFNSKRVTDKLGL 126

Query: 119 -FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
                +I    +H  R  +         +FI  P+    + + +       ++ ++ E
Sbjct: 127 NVKKAIICCKSFHAKRCLMFYSWAYQNTKFIVCPVDVDGINKENWFKSEYGIQQVMGE 184


>gi|225024219|ref|ZP_03713411.1| hypothetical protein EIKCOROL_01091 [Eikenella corrodens ATCC
           23834]
 gi|224943244|gb|EEG24453.1| hypothetical protein EIKCOROL_01091 [Eikenella corrodens ATCC
           23834]
          Length = 221

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/212 (15%), Positives = 73/212 (34%), Gaps = 17/212 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIVVLTGEPI----------R 49
           +R  W G+ +CL+  ++        V             A VVL               R
Sbjct: 10  LRQVWRGIKLCLLVLLVQAAWCTWLVYSYSTRTASRRADAAVVLGAAAWGKNPSPVFRER 69

Query: 50  IERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           I     L  N    K+  +G       +++  + ++      +    I +   + +T+ N
Sbjct: 70  INHGITLYRNNRVGKLIFTGGTPKAGYMTEAEVARRYARGHGVPNKDILLETTSRDTQQN 129

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
            +   A    N    V+I++  YH+ R       +    Q  P P   +  +  +     
Sbjct: 130 LENTKALMYNNGLESVVIISDPYHLARAAAVADYVGLDYQTEPTPTSRYSGQSRAKFMAS 189

Query: 167 KILRVLLIEYLKI---LLLSIQLSLSTQTASQ 195
           ++L ++  ++ ++   +    +  L ++ A Q
Sbjct: 190 EVLSLMAFQWWRLSETVAAYGRDYLLSRQAGQ 221


>gi|39936223|ref|NP_948499.1| hypothetical protein RPA3160 [Rhodopseudomonas palustris CGA009]
 gi|39650078|emb|CAE28601.1| DUF218 [Rhodopseudomonas palustris CGA009]
          Length = 264

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 60/199 (30%), Gaps = 31/199 (15%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELL 57
                +  +            +   I+VL                      R+  A +L 
Sbjct: 57  LGNVLLLSLSERFPPWHEAGRAPDGIIVLGGAIASELSAARNALEVDASAERVLAALDLA 116

Query: 58  ENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
                 +I  SG        SV++  L  ++  R  LA   + +  K+  T  NA    A
Sbjct: 117 RRYPKARIVYSGGSGNLIQRSVAEAPLAGELLERFGLASDRLVLEDKSRTTAENAAYTRA 176

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR-- 170
                     L+VT  +HMPR+ +  +        +PYP+         +      L   
Sbjct: 177 LVAPKPGELWLLVTSAFHMPRSIIAFRAA--GFDVVPYPVDWRTRGSEDAARTFSTLAAG 234

Query: 171 -----VLLIEYLKILLLSI 184
                V + E+  +L   +
Sbjct: 235 LARTDVAVHEWAGLLAYRL 253


>gi|222529669|ref|YP_002573551.1| hypothetical protein Athe_1684 [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456516|gb|ACM60778.1| protein of unknown function DUF218 [Caldicellulosiruptor bescii DSM
           6725]
          Length = 195

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 63/192 (32%), Gaps = 15/192 (7%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           ++    L       ++  ++    +             I+VL               R+ 
Sbjct: 3   KFLKISLCTLATVILIFAVTEASIIIFGISAKPKKSDCIIVLGCAVYGDFPSPFFRERLN 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           RAFEL +N     I + G      ++S+    ++  +   +    +    K+ +T  N  
Sbjct: 63  RAFELYKNGYARYIIVCGAKGPGENISEAEAGKRYLVEMGVLPEFVLKEDKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            +     K  F   +IV++ +H+ R  L  +++     F    +             ++ 
Sbjct: 123 YSKRIMNKKGFKSAIIVSNMFHLERAHLIAKKLKINSSF--SGVYVKQYLHEEYYGFVRE 180

Query: 169 LRVLLIEYLKIL 180
              +  E LK L
Sbjct: 181 SVAVWYEILKTL 192


>gi|153004625|ref|YP_001378950.1| hypothetical protein Anae109_1763 [Anaeromyxobacter sp. Fw109-5]
 gi|152028198|gb|ABS25966.1| protein of unknown function DUF218 [Anaeromyxobacter sp. Fw109-5]
          Length = 252

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 64/204 (31%), Gaps = 27/204 (13%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
             +   L     G   F+    +          A +VL+                     
Sbjct: 46  VLVVFSLAPVANGLQRFVERGAERTFRPGAVYDAAIVLSGQVDEAASRASGELELDAAAD 105

Query: 49  RIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+ R  EL       ++ +SG          S+   L+   +R  +    I +  ++ NT
Sbjct: 106 RVVRGLELWRAGRVRRLLLSGGPPAAVPGEPSEAERLRDALVRWGVPAAAILVDPQSRNT 165

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  ++  A ++    +L+VT   H PR     + +   +     P+        S +
Sbjct: 166 RENAIASAHLAAEHGLRSLLLVTSAAHAPRALGCFRAV--GLSPDVLPVDRRTGPSGSWL 223

Query: 164 FKIKILRV---LLIEYLKILLLSI 184
            +   L     +L E    ++  +
Sbjct: 224 PRAGALEQSTAVLRELAGRVVYRL 247


>gi|306841899|ref|ZP_07474579.1| Hypothetical protein BIBO2_1680 [Brucella sp. BO2]
 gi|306288029|gb|EFM59431.1| Hypothetical protein BIBO2_1680 [Brucella sp. BO2]
          Length = 205

 Score = 79.5 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 52/198 (26%), Gaps = 31/198 (15%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELLENQI 61
            +S +             V  IVVL                      RI     L     
Sbjct: 2   LLSPLENRFPKSESLPQHVDGIVVLGGYMNGEIVAGRQNFELNSAADRIVETMRLARLYP 61

Query: 62  GEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
             KI +SG   +  +         + +      +        K+ NT  NA  + A A  
Sbjct: 62  DAKIIVSGGEGTFFEKSAREAETTRALLSDLGFSGDRYIFEGKSRNTVENAIFSQALALP 121

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI-------L 169
                 L+VT  YHMPR     ++         +P+        +    ++         
Sbjct: 122 KPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFGLYLESPNDALSRF 179

Query: 170 RVLLIEYLKILLLSIQLS 187
            + L E+  +        
Sbjct: 180 SMALREWTGLAAYWWTGR 197


>gi|255068057|ref|ZP_05319912.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
 gi|255047655|gb|EET43119.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
          Length = 214

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 59/178 (33%), Gaps = 17/178 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFI----SFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+ +      I  ++G        + +     +P H    A +VL             
Sbjct: 11  LRYYLFRGIGLSILLVLGIFGEGAWQVYHTGSQPLPGHVRADAALVLGAAAWDKRPSPIF 70

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L ++   EKI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 71  RERINHAITLYQSHRVEKIVFTGGTPKKGYMTEAEVGRRYALKQGIPAHNILFENTSRNT 130

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N +             ++IV+  YH+ R       ++        P    D  +  
Sbjct: 131 YENIRNIRPILRAEGIGSIIIVSDPYHLARALEIASDLDIEAYISATPTTRFDQSKEK 188


>gi|115525420|ref|YP_782331.1| hypothetical protein RPE_3419 [Rhodopseudomonas palustris BisA53]
 gi|115519367|gb|ABJ07351.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisA53]
          Length = 267

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/204 (12%), Positives = 61/204 (29%), Gaps = 31/204 (15%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELL 57
                +  +         +  +   IVVL                      R+    +L 
Sbjct: 57  LGNALLLVLTERFPSWQAEGRAPDGIVVLGGSIDSDISAARNALETDASAERVFAMLDLA 116

Query: 58  ENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
                 +I  +G        + ++  +  ++  +  +A   I +   +  T  NA     
Sbjct: 117 RRYPNARIVFTGGSANLIGDTAAEAPVAGQLLEQFGIAPDRIVLESGSRTTAENATMTRD 176

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDLEENSS-----IFK 165
                     L+VT  +HMPR+    + I    +   YP+   +    +           
Sbjct: 177 LVAPKPGERWLLVTSAFHMPRSIGVFRAI--GFEVEAYPVDWRTRGWIDLRWPFGKLSAG 234

Query: 166 IKILRVLLIEYLKILLLSIQLSLS 189
           +  + V + E++ ++   +   ++
Sbjct: 235 LARIDVAVHEWVGLIAYRLTGRIA 258


>gi|312622108|ref|YP_004023721.1| hypothetical protein Calkro_1031 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202575|gb|ADQ45902.1| protein of unknown function DUF218 [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 195

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 64/192 (33%), Gaps = 15/192 (7%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R+    L   +I  ++  ++    +             I+VL               R+ 
Sbjct: 3   RFLKILLCTLVIVILIFAVTEASIIIFGISAKPKKSDCIIVLGCAVYGDFPSPFFRERLN 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           RAFEL +      I + G      ++S+    ++  +   +    +    K+ +T  N  
Sbjct: 63  RAFELYKKGYARYIVVCGAKGPGENISEAEAGKRYLVEMGVLPKFVLKEDKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            A     K  F   +IV++ +H+ R  L  +++     F    +             ++ 
Sbjct: 123 HAKRVMNKKGFKSAIIVSNMFHLERAHLIAKKLKINSSF--SGVYVKQYLHEEYYGFMRE 180

Query: 169 LRVLLIEYLKIL 180
              +  E LK L
Sbjct: 181 SVAVWYEILKTL 192


>gi|254228155|ref|ZP_04921584.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262393954|ref|YP_003285808.1| hypothetical protein VEA_003183 [Vibrio sp. Ex25]
 gi|151939228|gb|EDN58057.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262337548|gb|ACY51343.1| hypothetical protein VEA_003183 [Vibrio sp. Ex25]
          Length = 205

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 62/166 (37%), Gaps = 11/166 (6%)

Query: 26  VKQMHIPDHPSVSAIVVLTGE---PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
           V   H  +      +VVL        ++  A +L + +   K+ +SG +       +   
Sbjct: 34  VFPKHQDEFQHAEVLVVLGSYKATQYKMPTAVQLYKEKKVSKLLLSGGNLAIDRKPEFES 93

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLE 137
           +++  +   ++E  I +   A NT  NAQ ++    ++      V I+T  +H+ R    
Sbjct: 94  MREYALTNGVSESDIILEPHAKNTVENAQFSTEIIVESEVAKKSVAILTTAFHIKRAKHL 153

Query: 138 LQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLL--IEYLKIL 180
            + +    +    Y +       ++       +  ++   E +K L
Sbjct: 154 FKNVLPQSLDLYGYFVNDRSTRRDNWWLTESAVSRVMHSHEVIKSL 199


>gi|306844040|ref|ZP_07476635.1| Hypothetical protein BIBO1_0705 [Brucella sp. BO1]
 gi|306275795|gb|EFM57519.1| Hypothetical protein BIBO1_0705 [Brucella sp. BO1]
          Length = 264

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 54/211 (25%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIGAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + +      +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKIIVSGGEGTFFEKSAREAETTRALLSDLGFSGDRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 225

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 226 LYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|78188131|ref|YP_378469.1| hypothetical protein Cag_0148 [Chlorobium chlorochromatii CaD3]
 gi|78170330|gb|ABB27426.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 251

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 73/219 (33%), Gaps = 35/219 (15%)

Query: 3   YFWYGLFVCLIF----FIMGFISFIRYVKQMHIPDH-PSVSAIVVLTGEPIRIERAFE-- 55
             WY   V   F       G + F+   + + +P       AIVVL G   R+E A E  
Sbjct: 33  LLWYAALVLWAFSIPTVADGLMHFVEGNRTVALPQTLHQADAIVVLGGMIRRVEGAAEGE 92

Query: 56  -------------LLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIG 97
                        L        +  +         +V +  LL +  +++ + E  + + 
Sbjct: 93  WNDAADRFEAGVTLYRAGKAPLLLFTRGRMPWSPDAVPEGELLVERALQRGVPEAALGLT 152

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---- 153
               NTE  A + +    +     +++VT  YHM R+ L  +     +   PYP+     
Sbjct: 153 APVANTEDEAADVARLLRERGAERIILVTSAYHMRRSQLLFEHT--GLSVEPYPVDFRVD 210

Query: 154 ----SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
                  L    S   +      L E +  L   ++L  
Sbjct: 211 SYPEPAVLRFAPSAEALYRSETALRELIGWLYYRVKLFF 249


>gi|192291940|ref|YP_001992545.1| hypothetical protein Rpal_3570 [Rhodopseudomonas palustris TIE-1]
 gi|192285689|gb|ACF02070.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           TIE-1]
          Length = 264

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 60/199 (30%), Gaps = 31/199 (15%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELL 57
                +  +            +   I+VL                      R+  A +L 
Sbjct: 57  LGNVLLLSLSERFPPWHEAGRAPDGIIVLGGAIDSELSVARNTLEVDASAERVLAALDLA 116

Query: 58  ENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
                 +I  SG        SV++  L  ++  R  LA   + +  K+  T  NA    A
Sbjct: 117 RRYPKARIVYSGGSGNLIQRSVAEAPLAGELLERFGLASDRLVLEDKSRTTAENAAYTRA 176

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR-- 170
                     L+VT  +HMPR+ +  +        +PYP+         +      L   
Sbjct: 177 LVVPKPGELWLLVTSAFHMPRSIIAFRAA--GFDVVPYPVDWRTRGSEDAARTFSTLAAG 234

Query: 171 -----VLLIEYLKILLLSI 184
                V + E+  +L   +
Sbjct: 235 LARTDVAVHEWAGLLAYRL 253


>gi|108804095|ref|YP_644032.1| hypothetical protein Rxyl_1256 [Rubrobacter xylanophilus DSM 9941]
 gi|108765338|gb|ABG04220.1| protein of unknown function DUF218 [Rubrobacter xylanophilus DSM
           9941]
          Length = 195

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 50/150 (33%), Gaps = 8/150 (5%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKA 100
                 R   A  L        +  +G    H  S+  ++ ++     +    + +  +A
Sbjct: 48  SGTLMARTLHAARLYRGGRVRLLIPTGGVGRHPPSEAEIMARLLRGAGVPGRAVLLEDRA 107

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
           L+T  +A+  S  A       VL+VT   H  RT    +     ++ IP P+ S  +   
Sbjct: 108 LSTWDSARYVSRMARGLGVGRVLVVTDPLHCVRTVAAFRHA--GLEAIPEPVYSSPMWRV 165

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQLSLST 190
             +     L     E   +     +  + +
Sbjct: 166 RWLR----LGQFFREMGALAWYRARHGVGS 191


>gi|281418736|ref|ZP_06249755.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|281407820|gb|EFB38079.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
          Length = 251

 Score = 79.1 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 68/206 (33%), Gaps = 32/206 (15%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------------- 48
               +         I  +    +   P   +   I++L G                    
Sbjct: 48  ILYLISTPMVCDSLIWSLEK--KYQPPSELNGDVIIMLGGGAFADTPNVNGKGHLSSIAA 105

Query: 49  -RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
            R+    +L        I   G     + S+  + + I +   + E  I +  ++LNT  
Sbjct: 106 NRLLTCVQLYYKLDVPIIISGGQIPGHTTSEGEIARNILLSLGVPEEKIIVENRSLNTTQ 165

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-----HDLEEN 160
           NA       +K+ F+  ++VT  +HM R   + ++  + V  IPYP          +   
Sbjct: 166 NAFYTKELLDKHGFNKPILVTSAFHMKRAVKQFEK--NEVNVIPYPTDYQTNSIRKITFM 223

Query: 161 SSIFKIKILRVL---LIEYLKILLLS 183
             +   + L+     + EY+ I+   
Sbjct: 224 DFVPSAEALQKFYFSVKEYVGIVASR 249


>gi|28211594|ref|NP_782538.1| membrane associated protein [Clostridium tetani E88]
 gi|28204035|gb|AAO36475.1| membrane associated protein [Clostridium tetani E88]
          Length = 192

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 58/159 (36%), Gaps = 13/159 (8%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
           R     ++  L   I+  I  +                I++L               RIE
Sbjct: 3   RVKKVIIYSILFGIILTLILGMNIYLFGRNSKAEKSDCIIILGCSVYGETPSPFLQWRIE 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
             + L +   G  I  SG      S+S+   +++  I + + E  I    K+ +T  N +
Sbjct: 63  EGYRLYKEGYGRYILASGGKGPGESISEAEAMKRYLISKGIKEEYIIKEDKSTSTMENLK 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
             +   EK    + +IV++ YH+ R  L  +++     F
Sbjct: 123 NCNKIMEKKGLKNAVIVSNKYHLKRASLMTKKVGIDSSF 161


>gi|154248380|ref|YP_001419338.1| hypothetical protein Xaut_4460 [Xanthobacter autotrophicus Py2]
 gi|154162465|gb|ABS69681.1| protein of unknown function DUF218 [Xanthobacter autotrophicus Py2]
          Length = 267

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/225 (15%), Positives = 68/225 (30%), Gaps = 41/225 (18%)

Query: 2   RYFWYGLFVCLIF--FIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEPI---- 48
           R    GL +  +    + GF       +S +         D   V+ I++L G       
Sbjct: 37  RRLGTGLILTAVAGWLVFGFSPVALYMLSPLEERFPQFKDDGTPVTGIIMLGGSEKPEIG 96

Query: 49  -------------RIERAFELLENQIGEKIFISGVHHSVS------KDILLQKIPIRQDL 89
                        R      L       ++   G    +       +  +++       +
Sbjct: 97  NVRGLPSFGEAGERPIAFAALSRRYPQARLAFVGGSGLLFPNGDAVEAQMIRMSLPDLGI 156

Query: 90  AECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
            E  ++   K+ NT  NA+ A A  +       L+VT  +HMPR     +++      +P
Sbjct: 157 PEARVEFEGKSRNTAENAEFAKALLKPKPGERWLLVTSAWHMPRAVGCFRKV--GFDVVP 214

Query: 150 YPIISHDLEENSSIFKIKILR-------VLLIEYLKILLLSIQLS 187
           YP+       +                 V   E++ ++   +   
Sbjct: 215 YPVDFQTAAPDRLDQPFSRAADGLDKTDVATREWIGLVAYYLSGK 259


>gi|254228166|ref|ZP_04921595.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262393992|ref|YP_003285846.1| hypothetical protein VEA_003221 [Vibrio sp. Ex25]
 gi|151939239|gb|EDN58068.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262337586|gb|ACY51381.1| hypothetical protein VEA_003221 [Vibrio sp. Ex25]
          Length = 209

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 62/166 (37%), Gaps = 11/166 (6%)

Query: 26  VKQMHIPDHPSVSAIVVLTGE---PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
           V   H  +      +VVL        ++  A +L + +   K+ +SG +       +   
Sbjct: 38  VFPKHQDEFQHAEVLVVLGSYKATQYKMPTAVQLYKEKKVSKLLLSGGNLAIDRKPEFES 97

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLE 137
           +++  +   ++E  I +   A NT  NAQ ++    ++      V I+T  +H+ R    
Sbjct: 98  MREYALTNGVSESDIILEPHAKNTVENAQFSTEIIVESEVAKKSVAILTTAFHIKRAKHL 157

Query: 138 LQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLL--IEYLKIL 180
            + +    +    Y +       ++       +  ++   E +K L
Sbjct: 158 FKNVLPQSLDLYGYFVNDRSTRRDNWWLTESAVSRVMHSHEVIKSL 203


>gi|83311553|ref|YP_421817.1| hypothetical protein amb2454 [Magnetospirillum magneticum AMB-1]
 gi|82946394|dbj|BAE51258.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 266

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/221 (11%), Positives = 59/221 (26%), Gaps = 37/221 (16%)

Query: 2   RYFWYGLFVCLIFFIM----GFISFIRYVKQMHIPDHPSVSAIVV--------------- 42
           +     L   +   +       ++++    Q   P    V  I++               
Sbjct: 40  KILSITLLTLVFTSVFPVEKWALAWLEDRFQTPDPLPDKVDGIIILGGAISPEQSAARGQ 99

Query: 43  --LTGEPIRIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCID 95
             +     R+     L       ++  +G   +       +    +            + 
Sbjct: 100 VSVGSAVTRMTEMIPLARRYPEARVVFTGGSGNAFDQEHREADYAEMFYRDIGFETGRMV 159

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               + NT  NA  +    +       L++T  +HMPR     + +      +P P+   
Sbjct: 160 FERDSRNTRENATLSKELMQPKPGETWLLITSAWHMPRAVGCFRAV--GWPVVPIPVDYQ 217

Query: 156 DLEEN-SSI--------FKIKILRVLLIEYLKILLLSIQLS 187
               +              I  L  L+ E L +++  +   
Sbjct: 218 TSGISRPWWSELRFSPQKGISGLGPLIHEGLGLIIYRLMGW 258


>gi|91977540|ref|YP_570199.1| hypothetical protein RPD_3072 [Rhodopseudomonas palustris BisB5]
 gi|91683996|gb|ABE40298.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB5]
          Length = 264

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 61/199 (30%), Gaps = 31/199 (15%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELL 57
                +  +         +  +   I+VL                      R+  A EL 
Sbjct: 57  LGSVLLLTLSERFPPWQFNGRAPDGIIVLGGAVDSEVSAARSSLEIDSSAERVVAALELA 116

Query: 58  ENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
                 +I  SG       +SV++  +  ++  R  +A   + +  K+  T  NA     
Sbjct: 117 RQYPQARIIYSGGSGNLIANSVAEAPIAGELLARFGVAPDRVVLESKSRTTAENASFTRE 176

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-------SHDLEENSSIFK 165
                     L+VT  +HMPR+    + +        YP+           L  +     
Sbjct: 177 LVSPKPGEVWLLVTSAFHMPRSIEAFRAV--EFDVQAYPVDWRTRGWRDAALPFDRLSSG 234

Query: 166 IKILRVLLIEYLKILLLSI 184
           +  + V + E+  +L   +
Sbjct: 235 LARMDVAVHEWAGLLAYRL 253


>gi|320161035|ref|YP_004174259.1| hypothetical protein ANT_16330 [Anaerolinea thermophila UNI-1]
 gi|319994888|dbj|BAJ63659.1| hypothetical protein ANT_16330 [Anaerolinea thermophila UNI-1]
          Length = 202

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 59/188 (31%), Gaps = 9/188 (4%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP--IRIERAFELLENQIGE 63
               V     I  F+        +         AIVVL+G     R+E+A  L++     
Sbjct: 13  LLGIVISCLCITPFLLGSIGSLLVISTPLQPADAIVVLSGGRDLQRLEKAVNLMKEGQAG 72

Query: 64  KIFISGVHHSV----SKDILLQKIPIRQDLAECCI-DIGYKALNTEGNAQEASAWAEKNN 118
            + ++               L     ++ +    I      + NTE  A        +  
Sbjct: 73  YLILTKTEDITESGRQTADYLASEAHQRGIPVPKIVITQKTSKNTEQEAIATLEILRERG 132

Query: 119 FHHVLIVTHDYHMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEY 176
           +  +++VT  YH  R+ +  + +     ++    P    D+            R +  E 
Sbjct: 133 WKTLIVVTDPYHTLRSRIIFREVMRKDSIKVYTVPSKKPDVPSWLWYIDGNSRRAVWREI 192

Query: 177 LKILLLSI 184
           L +L   +
Sbjct: 193 LSLLAYLL 200


>gi|294852515|ref|ZP_06793188.1| hypothetical protein BAZG_01442 [Brucella sp. NVSL 07-0026]
 gi|294821104|gb|EFG38103.1| hypothetical protein BAZG_01442 [Brucella sp. NVSL 07-0026]
          Length = 264

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 55/211 (26%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 225

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 226 LYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|307267183|ref|ZP_07548690.1| protein of unknown function DUF218 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306917799|gb|EFN48066.1| protein of unknown function DUF218 [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 191

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 70/189 (37%), Gaps = 15/189 (7%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
                  + ++F I+G I   + +   +         I+VL               R+E 
Sbjct: 4   ILKIVWLLLVLFIIIGIILEWQIISFAYNEKPKKSDVIIVLGCAVYGDIPSPFFKARLEE 63

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A  L     G  I +SG      ++S+    +   +++ + E  I I  K+ +T  N Q 
Sbjct: 64  ALRLYNEGYGRYIIVSGGKGPGENISEAEAGKGYLLKKGIPEKAILIDDKSFSTYENLQF 123

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           +    +K +    +I+++ +H+ R  +  +R+   ++     +             ++ +
Sbjct: 124 SKEIMDKKSLKRAVIISNKFHLKRASVIAKRV--GIEASFSGVFVRRYINEEIYGFLREV 181

Query: 170 RVLLIEYLK 178
             L   YLK
Sbjct: 182 VALWYIYLK 190


>gi|23502055|ref|NP_698182.1| hypothetical protein BR1177 [Brucella suis 1330]
 gi|62290089|ref|YP_221882.1| hypothetical protein BruAb1_1183 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700013|ref|YP_414587.1| hypothetical protein BAB1_1199 [Brucella melitensis biovar Abortus
           2308]
 gi|225627645|ref|ZP_03785682.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237815595|ref|ZP_04594592.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|256369602|ref|YP_003107112.1| hypothetical protein BMI_I1188 [Brucella microti CCM 4915]
 gi|297248487|ref|ZP_06932205.1| hypothetical protein BAYG_01444 [Brucella abortus bv. 5 str. B3196]
 gi|23348011|gb|AAN30097.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196221|gb|AAX74521.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616114|emb|CAJ11155.1| Protein of unknown function DUF218 [Brucella melitensis biovar
           Abortus 2308]
 gi|225617650|gb|EEH14695.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237788893|gb|EEP63104.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|255999764|gb|ACU48163.1| hypothetical protein BMI_I1188 [Brucella microti CCM 4915]
 gi|297175656|gb|EFH35003.1| hypothetical protein BAYG_01444 [Brucella abortus bv. 5 str. B3196]
          Length = 268

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 55/211 (26%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 52  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 111

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K+ NT
Sbjct: 112 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 171

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 172 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 229

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 230 LYLESPNDALSRFSMALREWTGLAAYWWTGR 260


>gi|17987093|ref|NP_539727.1| hypothetical protein BMEI0810 [Brucella melitensis bv. 1 str. 16M]
 gi|163843442|ref|YP_001627846.1| hypothetical protein BSUIS_A1225 [Brucella suis ATCC 23445]
 gi|189024327|ref|YP_001935095.1| hypothetical protein BAbS19_I11160 [Brucella abortus S19]
 gi|225852674|ref|YP_002732907.1| hypothetical protein BMEA_A1222 [Brucella melitensis ATCC 23457]
 gi|254689399|ref|ZP_05152653.1| hypothetical protein Babob68_04337 [Brucella abortus bv. 6 str.
           870]
 gi|254693883|ref|ZP_05155711.1| hypothetical protein Babob3T_04332 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697533|ref|ZP_05159361.1| hypothetical protein Babob28_07456 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701918|ref|ZP_05163746.1| hypothetical protein Bsuib55_13827 [Brucella suis bv. 5 str. 513]
 gi|254704463|ref|ZP_05166291.1| hypothetical protein Bsuib36_11145 [Brucella suis bv. 3 str. 686]
 gi|254710250|ref|ZP_05172061.1| hypothetical protein BpinB_08247 [Brucella pinnipedialis B2/94]
 gi|254714246|ref|ZP_05176057.1| hypothetical protein BcetM6_13021 [Brucella ceti M644/93/1]
 gi|254717682|ref|ZP_05179493.1| hypothetical protein BcetM_15020 [Brucella ceti M13/05/1]
 gi|254730428|ref|ZP_05189006.1| hypothetical protein Babob42_04352 [Brucella abortus bv. 4 str.
           292]
 gi|256031744|ref|ZP_05445358.1| hypothetical protein BpinM2_14019 [Brucella pinnipedialis
           M292/94/1]
 gi|256044830|ref|ZP_05447734.1| hypothetical protein Bmelb1R_10074 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113736|ref|ZP_05454540.1| hypothetical protein Bmelb3E_13258 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257645|ref|ZP_05463181.1| hypothetical protein Babob9C_09914 [Brucella abortus bv. 9 str.
           C68]
 gi|256263835|ref|ZP_05466367.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260168877|ref|ZP_05755688.1| hypothetical protein BruF5_11021 [Brucella sp. F5/99]
 gi|260546638|ref|ZP_05822377.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565570|ref|ZP_05836054.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260754918|ref|ZP_05867266.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758135|ref|ZP_05870483.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761961|ref|ZP_05874304.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883930|ref|ZP_05895544.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214170|ref|ZP_05928451.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261219524|ref|ZP_05933805.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261317810|ref|ZP_05957007.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322019|ref|ZP_05961216.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261752483|ref|ZP_05996192.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755142|ref|ZP_05998851.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758366|ref|ZP_06002075.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265988841|ref|ZP_06101398.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991256|ref|ZP_06103813.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995092|ref|ZP_06107649.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17982753|gb|AAL51991.1| putative membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|163674165|gb|ABY38276.1| protein of unknown function DUF218 [Brucella suis ATCC 23445]
 gi|189019899|gb|ACD72621.1| Protein of unknown function DUF218 [Brucella abortus S19]
 gi|225641039|gb|ACO00953.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|260095688|gb|EEW79565.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151638|gb|EEW86732.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668453|gb|EEX55393.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672393|gb|EEX59214.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675026|gb|EEX61847.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873458|gb|EEX80527.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915777|gb|EEX82638.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260924613|gb|EEX91181.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294709|gb|EEX98205.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297033|gb|EEY00530.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261738350|gb|EEY26346.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261742236|gb|EEY30162.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744895|gb|EEY32821.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262766205|gb|EEZ11994.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002040|gb|EEZ14615.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093964|gb|EEZ17898.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661038|gb|EEZ31299.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|326409195|gb|ADZ66260.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538905|gb|ADZ87120.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 264

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 55/211 (26%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 225

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 226 LYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|190576261|ref|YP_001974106.1| hypothetical protein Smlt4469 [Stenotrophomonas maltophilia K279a]
 gi|190014183|emb|CAQ47827.1| conserved hypothetical exported protein [Stenotrophomonas
           maltophilia K279a]
          Length = 210

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 57/174 (32%), Gaps = 17/174 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W    + +I+ +      +   ++          AI+VL               RI  
Sbjct: 15  WLWRLFVLLVIWLLGVTAWIVWVGER---DQAAKADAIIVLGAAAYDAKPSPVFEERIRH 71

Query: 53  AFELLENQIGEKIFISGVHH----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
             +L E +    +  +G +       S+  + ++  ++  + +  I I   + NT  N  
Sbjct: 72  GLDLYEARYAPLLIFTGGYGGTGARFSESQVARRYALKHGVPDDAILIETASRNTVQNLV 131

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           EA    ++   H V++V+   HM R     + +         P         S 
Sbjct: 132 EAKRLMDQRGLHRVIVVSDPLHMARALRLSKALGIDALASSTPSTRFRSFHTSW 185


>gi|256159910|ref|ZP_05457632.1| hypothetical protein BcetM4_13019 [Brucella ceti M490/95/1]
 gi|256255144|ref|ZP_05460680.1| hypothetical protein BcetB_12801 [Brucella ceti B1/94]
 gi|261222341|ref|ZP_05936622.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265998306|ref|ZP_06110863.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920925|gb|EEX87578.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552774|gb|EEZ08764.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 264

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 55/211 (26%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 225

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 226 LYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|161619130|ref|YP_001593017.1| hypothetical protein BCAN_A1197 [Brucella canis ATCC 23365]
 gi|260566292|ref|ZP_05836762.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335941|gb|ABX62246.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|260155810|gb|EEW90890.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 264

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 55/211 (26%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 225

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 226 LYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|254719238|ref|ZP_05181049.1| hypothetical protein Bru83_06801 [Brucella sp. 83/13]
 gi|265984234|ref|ZP_06096969.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837987|ref|ZP_07470845.1| Hypothetical protein BROD_0794 [Brucella sp. NF 2653]
 gi|264662826|gb|EEZ33087.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306406911|gb|EFM63132.1| Hypothetical protein BROD_0794 [Brucella sp. NF 2653]
          Length = 264

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 55/211 (26%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGDRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 225

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 226 LYLESPNDALSRFSMALREWTGLTAYWWTGR 256


>gi|332528861|ref|ZP_08404835.1| hypothetical protein HGR_03097 [Hylemonella gracilis ATCC 19624]
 gi|332041720|gb|EGI78072.1| hypothetical protein HGR_03097 [Hylemonella gracilis ATCC 19624]
          Length = 255

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 52/152 (34%), Gaps = 12/152 (7%)

Query: 47  PIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
             R+  A  LL+ +    +  +G          S+    ++  + Q +    + +   + 
Sbjct: 106 AERLTAALPLLQREPRLVLLYTGGEGELLASGPSEAERARRFYVEQGVPPARLLLESASR 165

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA  ++A    +     L++T  +HMPR+    ++        P+P          
Sbjct: 166 NTHDNAVFSAALPGVDRTRPWLLITSAWHMPRSLRTFRKA--GWNVTPWPTDYRAGLTTP 223

Query: 162 SIFK-----IKILRVLLIEYLKILLLSIQLSL 188
                        ++ L E L +    ++  L
Sbjct: 224 WHQYSLSQGAAKWQLALHELLGLAAYRLRGWL 255


>gi|239617397|ref|YP_002940719.1| protein of unknown function DUF218 [Kosmotoga olearia TBF 19.5.1]
 gi|239506228|gb|ACR79715.1| protein of unknown function DUF218 [Kosmotoga olearia TBF 19.5.1]
          Length = 254

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 78/208 (37%), Gaps = 30/208 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS----VSAIVVLTGEP----------- 47
               GLF  L+   +G   +++ ++  +   + S      AIVVL G             
Sbjct: 45  ILIIGLFSYLLMSGIGTYLYVKPLETEYSVPNASLLDTAEAIVVLGGGMIIAPYELEPGD 104

Query: 48  ---IRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
               R+ +AF++        I   G      S+S+  ++    +   + E  + +   A 
Sbjct: 105 HTLKRLYKAFQIHRATGKPIIVTGGTPMGRDSLSESEVMLNTLLNWGIDENDVIVENSAR 164

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-HDLEEN 160
           NT  NA   +   ++  +  +++VT   HM R+    +     +  IPYP    +D  + 
Sbjct: 165 NTNENAVRVAEICKEKKWKKIVLVTSAVHMKRSVESFEEQ--GLNVIPYPTDYLYDYTDL 222

Query: 161 SSIFKIKILRVL------LIEYLKILLL 182
           S +  +     L      + E++ I+  
Sbjct: 223 SWVDFLPGRDALTANLSGIHEFIGIIWY 250


>gi|15644422|ref|NP_229474.1| hypothetical protein TM1674 [Thermotoga maritima MSB8]
 gi|4982249|gb|AAD36741.1|AE001808_16 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 237

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 71/209 (33%), Gaps = 26/209 (12%)

Query: 2   RYFWYGLFVCLIFFI--MGFISFIRYVKQM--HIPDHPSVSAIVVLTGEP---------- 47
           R+F   L   +  F   +G   F+  +++        P+ + IVVL G            
Sbjct: 32  RWFLLALAAIVYLFSSYVGEFLFLWPLEKNLDVPATLPNDAVIVVLGGGVERNTKAGDNL 91

Query: 48  -----IRIERAFELLENQIGEKIFISGVHHSVS-KDILLQKIPIRQDLAECCIDIGYKAL 101
                 R+    ++ +      +   G    +  + ++++   +   + E  I +  ++ 
Sbjct: 92  SDATLRRLLTGVQIYQKTKMPILVTGGSLTGLRSEAMIMKDYLVSLGVPEEKITVEDRSR 151

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA        K     +++VT   HM R     +R   +V   P      D E   
Sbjct: 152 NTYENALFTRE---KIGDVPIILVTDSIHMRRAVFTFKRFFQSVTPYPAGFYFGDPEFVD 208

Query: 162 SIFKIKILRV---LLIEYLKILLLSIQLS 187
            +       +    + E++ ++  + +  
Sbjct: 209 FLPNATSFYLNSRAIYEWIGLVWYNFRWR 237


>gi|167465736|ref|ZP_02330825.1| hypothetical protein Plarl_24758 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381937|ref|ZP_08055887.1| hypothetical protein PL1_0708 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154077|gb|EFX46405.1| hypothetical protein PL1_0708 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 233

 Score = 78.3 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/210 (14%), Positives = 74/210 (35%), Gaps = 30/210 (14%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAF 54
           + G+ +  + +       +       +P+   V   +VL  +            R+++A 
Sbjct: 6   FLGILLAGLLWTFYVQWLLSRQDYPALPE--GVDTGIVLGAKLETNQASPGLAERLDQAI 63

Query: 55  ELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
            L   +  + + +SG         +++   ++   +++ + E  I +  +A NT  N   
Sbjct: 64  SLYNQRKFKHLIVSGGLDKEGDSQITEAEGMRNYLVQKGIPEQAITMEKQAKNTYENLVF 123

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           +    E+  +   +I+TH+YH  R                 P      +          +
Sbjct: 124 SKRIMEQKGWTSCIIITHEYHGARAMDIADF------IALSPAYLSTTDSTHLFMPYHKI 177

Query: 170 RVLLI----EYLKILLLSIQLSLSTQTASQ 195
           R +L     E+ K     ++L+++ Q   +
Sbjct: 178 REILAFTKWEFNKW---RMRLNITVQLEKE 204


>gi|254523274|ref|ZP_05135329.1| periplasmic protein [Stenotrophomonas sp. SKA14]
 gi|219720865|gb|EED39390.1| periplasmic protein [Stenotrophomonas sp. SKA14]
          Length = 210

 Score = 78.3 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/174 (17%), Positives = 58/174 (33%), Gaps = 17/174 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W    V +I+ +      +   ++          AI+VL               RI  
Sbjct: 15  WLWRLFVVLVIWLLGVTAWIVWVGER---DQAAKADAIIVLGAAAYDAKPSPVFEERIRH 71

Query: 53  AFELLENQIGEKIFISGVHH----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
             +L E Q    +  +G +       S+  + ++  ++  + +  I I   + NT  N  
Sbjct: 72  GLDLYEAQYAPLLIFTGGYGGSGARFSESQVARRYALKHGVPDDAILIETASRNTVQNLI 131

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           EA    ++ N H V+IV+   HM R     + +         P         S 
Sbjct: 132 EAKRLMDQRNLHRVIIVSDPLHMARALRLSKALGIDALASSTPSTRFRSFHTSW 185


>gi|153955310|ref|YP_001396075.1| hypothetical protein CKL_2692 [Clostridium kluyveri DSM 555]
 gi|146348168|gb|EDK34704.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
          Length = 196

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 60/149 (40%), Gaps = 13/149 (8%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------EPIRIERA 53
             + L+  ++ F++  I+ I+ +             I+VL               R+ + 
Sbjct: 5   IKFVLYFIIVIFLLALITEIQIIYFGENAKPKKSDCIIVLGCRVYGSTPSPFLIWRLNKG 64

Query: 54  FELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
            EL +   G+ I +SG      ++S+   ++   + + +    + +  K+++T  N   +
Sbjct: 65  LELYDKGYGDYIIVSGGKGPGENISEAKAMKNYLVYKGIDSSRVIMEDKSMSTMENLSNS 124

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
               E+      +IV++ YH+ R  L  +
Sbjct: 125 KRVMEEKGLKTAVIVSNKYHLKRASLMAE 153


>gi|148560243|ref|YP_001259097.1| hypothetical protein BOV_1136 [Brucella ovis ATCC 25840]
 gi|148371500|gb|ABQ61479.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 268

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 54/211 (25%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I+VL                      
Sbjct: 52  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIVLGGYMNGEIVAGRQNFELNSAAD 111

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K  NT
Sbjct: 112 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKLRNT 171

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 172 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 229

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 230 LYLESPNDALSRFSMALREWTGLAAYWWTGR 260


>gi|90577673|ref|ZP_01233484.1| hypothetical protein VAS14_11519 [Vibrio angustum S14]
 gi|90440759|gb|EAS65939.1| hypothetical protein VAS14_11519 [Vibrio angustum S14]
          Length = 221

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 60/180 (33%), Gaps = 11/180 (6%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHH-------SVSKDI 78
                 +      I VL     R+ ERA EL +  +   I  SG          + S+  
Sbjct: 15  YHQLNHEIVKSDCIFVLGSNDERVAERAVELYKKGVAPYIIFSGGVGELTEGLFNTSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
              KI +   + +  I I  ++ NT  N        ++        ++V   +   RT  
Sbjct: 75  HFAKIALDMGVPKEAILIEPESTNTGENVVFTRRLLQQKGLTPRSFILVQKPFMERRTLA 134

Query: 137 ELQRINSTVQ-FIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQ 195
             ++    +Q  +  P I  D   N +I    ++ V++ +  +I         + Q    
Sbjct: 135 TFEQQWPNMQAIVTSPAIRFDDYANDTISFGDLINVMVGDLQRIRFYPEFGFSTPQPIPN 194


>gi|312127289|ref|YP_003992163.1| hypothetical protein Calhy_1067 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777308|gb|ADQ06794.1| protein of unknown function DUF218 [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 195

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 62/192 (32%), Gaps = 15/192 (7%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           ++    L       ++  ++    +             I+VL               R+ 
Sbjct: 3   KFLKISLCTLASVILIFAVTEASIIIFGISAKPKKSDCIIVLGCAVYGDFPSPFFRERLN 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           RAFEL +      I + G      ++S+    ++  +   +    +    K+ +T  N  
Sbjct: 63  RAFELYKKGYARYIIVCGAKGPGENISEAEAGKRYLVESGVLPEFVLKEDKSFSTYENLL 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            A     K  F   +IV++ +H+ R  L  +++     F    +             ++ 
Sbjct: 123 HAKRIMNKKGFKSAIIVSNMFHLERAHLIAKKLKINSSF--SGVYVKQYLHEEYYGFVRE 180

Query: 169 LRVLLIEYLKIL 180
              +  E LK L
Sbjct: 181 SVAVWYEILKTL 192


>gi|300690675|ref|YP_003751670.1| hypothetical protein RPSI07_1014 [Ralstonia solanacearum PSI07]
 gi|299077735|emb|CBJ50373.1| conserved protein of unknown function, DUF218 [Ralstonia
           solanacearum PSI07]
          Length = 190

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 55/154 (35%), Gaps = 7/154 (4%)

Query: 34  HPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
                 IVVL      R+  A EL    +  ++F+SG    +    L+ +  +   +   
Sbjct: 43  PGHADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCL----LIVRRLVMAGVPAD 98

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I    ++ +T GNA+              ++VT  YH  R     +++   V +    +
Sbjct: 99  RIGHECESGSTMGNAEMTHRALTGQPVRSAVLVTSWYHTGRALEVFRQVWPEVTWGARGV 158

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
              D    S          +L EY+K    +++ 
Sbjct: 159 FPGDTLAKSFPIYESGS--ILAEYIKRAWYAVRY 190


>gi|239946686|ref|ZP_04698439.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920962|gb|EER20986.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 171

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 71/159 (44%), Gaps = 7/159 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      +I+GF  ++  +    +  +   +AI+V  G   +IE    +L+  
Sbjct: 2   IRKFLLTILAIFALWIVGFGYYLYLINSYKLNSNT-TNAIIVFAGGGHKIETGIAMLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL++  +   + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFITGIESAGQLKNLLKEHSV---IEQQVILAPNKIMSEEDNIKKAVDFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISHD 156
            +++V H+Y+MP    +L++       +  + YP+  + 
Sbjct: 118 SIILVEHNYNMPFMLNKLKKAIPSSNNIYIVSYPVFPNK 156


>gi|15964004|ref|NP_384357.1| hypothetical protein SMc00331 [Sinorhizobium meliloti 1021]
 gi|15073180|emb|CAC41688.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
          Length = 335

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/215 (13%), Positives = 59/215 (27%), Gaps = 33/215 (15%)

Query: 4   FWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLT----------------- 44
           F   +    +F   G  F+  +        P+   ++ I+VL                  
Sbjct: 116 FGLAVLFVTLFTTAGSYFLQILEDRFPRPTPEPTELACIIVLGGAFENVVMASRGGMELN 175

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYK 99
               R      L +     +I +SG                +       +    +    +
Sbjct: 176 QAAERFVETLRLAQAYPQARILVSGGDGSLSGIYEGDAHASENFFGTFGIGSDRLIREGE 235

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH---- 155
           +  T  NA+       KN      +VT  YHMPR+    +   + ++  P+P        
Sbjct: 236 SRTTFENARYTRDLLAKNGLERCALVTSAYHMPRSIGLFR--ANGMEVTPWPTDYRTSGK 293

Query: 156 ---DLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
                +        ++      E+  ++   +   
Sbjct: 294 VRLGFDFTQPSLNAQLATTAAKEWTGLVAYYLLGR 328


>gi|307306416|ref|ZP_07586160.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
 gi|306902258|gb|EFN32855.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
          Length = 262

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/215 (13%), Positives = 59/215 (27%), Gaps = 33/215 (15%)

Query: 4   FWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLT----------------- 44
           F   +    +F   G  F+  +        P+   ++ I+VL                  
Sbjct: 43  FGLAVLFVTLFTTAGSYFLQILEDRFPRPTPEPTELACIIVLGGAFENVVMASRGGMELN 102

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYK 99
               R      L +     +I +SG                +       +    +    +
Sbjct: 103 QAAERFVETLRLAQAYPQARILVSGGDGSLSGIYEGDAHASENFFGTFGIGSDRLIREGE 162

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH---- 155
           +  T  NA+       KN      +VT  YHMPR+    +   + ++  P+P        
Sbjct: 163 SRTTFENARYTRDLLAKNGLERCALVTSAYHMPRSIGLFR--ANGMEVTPWPTDYRTSGK 220

Query: 156 ---DLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
                +        ++      E+  ++   +   
Sbjct: 221 VRLGFDFTQPSLNAQLATTAAKEWTGLVAYYLLGR 255


>gi|304404431|ref|ZP_07386092.1| protein of unknown function DUF218 [Paenibacillus curdlanolyticus
           YK9]
 gi|304346238|gb|EFM12071.1| protein of unknown function DUF218 [Paenibacillus curdlanolyticus
           YK9]
          Length = 230

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 58/159 (36%), Gaps = 14/159 (8%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
                + V  + +    +  I  VK+      P    I+VL               R++ 
Sbjct: 24  RIVAWMIVLGVLWCGYLLWLINDVKRPLPRSLPKADVIIVLGAALWSDKPSPGLKERLDY 83

Query: 53  AFELLENQIGEKIFISGVHH----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           AF L +    +K+ ++G       ++++   +++    + +    + I  KA +T  N  
Sbjct: 84  AFGLYKLGKADKLILTGGLDGNGSTITEAEGMRRYLTARGIPNDKLLIENKATSTYENLL 143

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQF 147
            +    ++     VLIVTHDYH  R     + +      
Sbjct: 144 FSKQITDRGGMKQVLIVTHDYHSSRAAEIARYVGFNKPI 182


>gi|73539728|ref|YP_294248.1| hypothetical protein Reut_A0022 [Ralstonia eutropha JMP134]
 gi|72117141|gb|AAZ59404.1| Protein of unknown function DUF218 [Ralstonia eutropha JMP134]
          Length = 337

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 68/195 (34%), Gaps = 21/195 (10%)

Query: 3   YFWYGLFVCLIFFI---MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------R 49
             W  L+     ++     F   IR    + +P    + AI+VL               R
Sbjct: 143 LLWRALWTAFAVWLVTVGVFFHGIRSGLSVSVPTGVPIQAIIVLGSGTPDCHASPALTAR 202

Query: 50  IERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           +E+           K+ +SG        ++  ++    + + +A   +    ++ +TE N
Sbjct: 203 LEQGLIQARRLPAAKVVVSGGPDFGRHCTEADIMADYLVARGVAADRLIREGRSTSTEEN 262

Query: 107 AQEASAWAEKNNFH---HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
              +    E  N      +++VT D+H+ R     ++   +  F         L  N+ +
Sbjct: 263 LVFSRQLLEAQNVDADGPIVVVTSDFHVRRAVGIARKAGFSQIFGVGAATPLYLRFNAWL 322

Query: 164 FK--IKILRVLLIEY 176
            +    I   +L EY
Sbjct: 323 REYFASISSWILREY 337


>gi|219855730|ref|YP_002472852.1| hypothetical protein CKR_2387 [Clostridium kluyveri NBRC 12016]
 gi|219569454|dbj|BAH07438.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 199

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 60/149 (40%), Gaps = 13/149 (8%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------EPIRIERA 53
             + L+  ++ F++  I+ I+ +             I+VL               R+ + 
Sbjct: 8   IKFVLYFIIVIFLLALITEIQIIYFGENAKPKKSDCIIVLGCRVYGSTPSPFLIWRLNKG 67

Query: 54  FELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
            EL +   G+ I +SG      ++S+   ++   + + +    + +  K+++T  N   +
Sbjct: 68  LELYDKGYGDYIIVSGGKGPGENISEAKAMKNYLVYKGIDSSRVIMEDKSMSTMENLSNS 127

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
               E+      +IV++ YH+ R  L  +
Sbjct: 128 KRVMEEKGLKTAVIVSNKYHLKRASLMAE 156


>gi|125974798|ref|YP_001038708.1| hypothetical protein Cthe_2313 [Clostridium thermocellum ATCC
           27405]
 gi|256004933|ref|ZP_05429906.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|125715023|gb|ABN53515.1| protein of unknown function DUF218 [Clostridium thermocellum ATCC
           27405]
 gi|255991113|gb|EEU01222.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|316941930|gb|ADU75964.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           1313]
          Length = 251

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 67/206 (32%), Gaps = 32/206 (15%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------------- 48
               +         I  +    +   P   +   I++L G                    
Sbjct: 48  ILYLISTPMVCDSLIWSLEK--KYQPPSELNGDVIIMLGGGAFADTPNVNGKGHLSSIAA 105

Query: 49  -RIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
            R+    +L        I   G     + S+  +   I +   + E  I +  ++LNT  
Sbjct: 106 NRLLTCVQLYYKLDVPIIISGGQIPGHTTSEGEIAMNILLSLGVPEEKIIVENRSLNTTQ 165

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-----HDLEEN 160
           NA       +K+ F+  ++VT  +HM R   + ++  + V  IPYP          +   
Sbjct: 166 NAFYTKELLDKHGFNKPILVTSAFHMKRAVKQFEK--NEVNVIPYPTDYQTNSIRKITFM 223

Query: 161 SSIFKIKILRVL---LIEYLKILLLS 183
             +   + L+     + EY+ I+   
Sbjct: 224 DFVPSAEALQKFYFSVKEYVGIVASR 249


>gi|294085382|ref|YP_003552142.1| hypothetical protein SAR116_1815 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664957|gb|ADE40058.1| DUF218 [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 264

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 67/223 (30%), Gaps = 38/223 (17%)

Query: 2   RYFWYGLFVCLIF-FIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGE------- 46
           R+      V +I   + GF       + F+     + I +   +  I++L G        
Sbjct: 36  RWARMFTIVAVILPLLYGFIPLSHIPLQFLENRFDVPILEGRPLDGIIILGGHTGNGEIS 95

Query: 47  -----------PIRIERAFELLENQIGEKIFISG-----VHHSVSKDILLQKIPIRQDLA 90
                        R   A  L        I  SG     +    S+   ++++     +A
Sbjct: 96  EGRGQPQLSAAAERFTTALHLHRQFPDLPILFSGFSGELMPKGWSETQTIKRLLDELGMA 155

Query: 91  ECC-IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           E   I     + NT  NA  +            ++VT   HMPR     +        IP
Sbjct: 156 ESPNILFESTSRNTYENALYSETVLSPQPGSFWVLVTSASHMPRAVGSFRNAGWG-GVIP 214

Query: 150 YPIISHDLEE-----NSSIFKIKILRVLLIEYLKILLLSIQLS 187
           YP+    L        +    +  + ++  EY  +    +   
Sbjct: 215 YPVDYQTLPSGFPYIWNLPRGLHTMTIVFHEYAGLFAYWLSGK 257


>gi|218437457|ref|YP_002375786.1| hypothetical protein PCC7424_0452 [Cyanothece sp. PCC 7424]
 gi|218170185|gb|ACK68918.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7424]
          Length = 260

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 70/215 (32%), Gaps = 40/215 (18%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------I 48
              L V    +I   +      + +   + P   AIV+L G                   
Sbjct: 45  LIILLVASNGWISNQLVQSLEWQNI-PSEIPQAEAIVLLGGATKPPAYPRPMVDMSEQGD 103

Query: 49  RIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKALNT 103
           R+  A +L  +Q    I  SG          S+   +  +     +    I     +LNT
Sbjct: 104 RVLYAAKLYLDQKAPLIIASGGRIDWLSNEQSESADMANLLQLMGVPPQVIIQEPDSLNT 163

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEE 159
             NA       ++     VL+VT   HMPR+    +++   +  I  P    +   +LE 
Sbjct: 164 YENATNVKKILQEKGIKQVLLVTSALHMPRSLFIFKKL--GIDVIAAPTDFLVSRTELEP 221

Query: 160 NS------------SIFKIKILRVLLIEYLKILLL 182
           N+            S   +      L EY+ +L+ 
Sbjct: 222 NNLTLEGIILNILPSSENLDRTTKALKEYIGLLVY 256


>gi|163783486|ref|ZP_02178477.1| hypothetical protein HG1285_08734 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881250|gb|EDP74763.1| hypothetical protein HG1285_08734 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 239

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 60/183 (32%), Gaps = 20/183 (10%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAFELLENQIGEKIFIS 68
           + F         P       IVVL G              R+   F L        I   
Sbjct: 57  VLFYPLESPFKTPKRIRGDVIVVLGGGAYNSGYLKASSYKRLIAGFLLHRRTGKPLILSG 116

Query: 69  GV-HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           G     + +  +++++ +   + E  I    ++ +T  NA+      EK     + +VT 
Sbjct: 117 GAAIGVIPEAKVMKELLLEFGVEEKDIYADLRSRDTYENAKYVRNICEKIGCRSITLVTS 176

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV------LLIEYLKILL 181
            +HM R  +  ++    ++  PYP         +         V       + EY+ +L 
Sbjct: 177 AFHMRRALMVFKKT--GLEVQPYPTDLKFEGRYNLYSAFPKYSVFYDSSIAIREYVGLLF 234

Query: 182 LSI 184
            S+
Sbjct: 235 YSL 237


>gi|330448188|ref|ZP_08311836.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492379|dbj|GAA06333.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 221

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 47/145 (32%), Gaps = 13/145 (8%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------DI 78
                        I VL     R+ ERA EL +  +   I  SG    +++         
Sbjct: 15  YHQLSHTMVKSDCIFVLGSNDDRVAERAVELYKQGLAPYIVFSGGVGELTEGLYSTSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH--HVLIVTHDYHMPRTFL 136
              KI +   + +  I I  ++ NT  N        E+   H    ++V   +   RT  
Sbjct: 75  HFAKIAMDMGVPQQDIVIESESTNTGENVVFTRRLLEQEGLHPSSFILVQKPFMERRTLA 134

Query: 137 ELQRINSTVQFIPYPIISHDLEENS 161
             ++    +   P  + S  L  + 
Sbjct: 135 TFEQQWPNM---PAIVTSPQLSFDD 156


>gi|256061258|ref|ZP_05451408.1| hypothetical protein Bneo5_12948 [Brucella neotomae 5K33]
 gi|261325265|ref|ZP_05964462.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301245|gb|EEY04742.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 264

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 55/211 (26%), Gaps = 31/211 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
              F          +S +             V  I++L                      
Sbjct: 48  LLFFGAFTTGGAMLLSPLENRFPKSESLPQHVDGIIMLGGYMNGEIVAGRQNFELNSAAD 107

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK-----DILLQKIPIRQDLAECCIDIGYKALNT 103
           RI     L       KI +SG   +  +         + + +    +        K+ NT
Sbjct: 108 RIVETMRLARLYPDAKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIFEGKSRNT 167

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             NA  + A A+       L+VT  YHMPR     ++         +P+        +  
Sbjct: 168 VENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKA--GFDVTAWPVDYKTRTRETFG 225

Query: 164 FKIKI-------LRVLLIEYLKILLLSIQLS 187
             ++          + L E+  +        
Sbjct: 226 LYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|194367604|ref|YP_002030214.1| hypothetical protein Smal_3832 [Stenotrophomonas maltophilia
           R551-3]
 gi|194350408|gb|ACF53531.1| protein of unknown function DUF218 [Stenotrophomonas maltophilia
           R551-3]
          Length = 210

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 58/174 (33%), Gaps = 17/174 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W    + +I+ +      +   ++          AI+VL               RI  
Sbjct: 15  WLWRLFVLLVIWLLGVTAWIVWVGER---DQAAKADAIIVLGAAAYDAKPSPVFEERIRH 71

Query: 53  AFELLENQIGEKIFISGVHH----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
             +L E +    +  +G +       S+  + ++  ++  + +  I I   + NT  N  
Sbjct: 72  GLDLYEARYAPLLIFTGGYGGTGARFSESQVARRYALKHGIPDDAILIETASRNTVQNLV 131

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           EA    E+ + H V+IV+   HM R     + +         P         S 
Sbjct: 132 EAKRLMEQRDLHRVIIVSDPLHMARALRLSKALGIDALASSTPSTRFRSFHTSW 185


>gi|310823295|ref|YP_003955653.1| hypothetical protein STAUR_6067 [Stigmatella aurantiaca DW4/3-1]
 gi|309396367|gb|ADO73826.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 256

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 71/215 (33%), Gaps = 28/215 (13%)

Query: 1   MRYFWYGLFVCLIF--FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------------ 46
           ++     +           G + ++    +          A++VL G             
Sbjct: 39  LQVLGLAVLYTFSIEPVAGGLMRWVESGAKETYRPEVVYDAVIVLGGGLDPDATERSGRP 98

Query: 47  -----PIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDI 96
                  RI R +ELL       + +SG        +V +  +LQ+  +   +A   I +
Sbjct: 99  EYNAAVERILRGYELLREGRARHVLLSGGSLDTRPEAVIEATVLQRQLLAWGIAPERIVV 158

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-SH 155
              + NT  NA ++    E+  +  +L++T   H+PR +     +      +   +  S 
Sbjct: 159 EGHSRNTRENALDSKKLIEERGWKTLLLITSAAHLPRAYGCFAAVGLRPDTLAADVRASD 218

Query: 156 DLEENSSIFKIKILRV---LLIEYLKILLLSIQLS 187
                S + +   L      L E    ++  ++  
Sbjct: 219 GKRPPSWLPRANHLSASTDALRELAGRVVYRLRGW 253


>gi|325295248|ref|YP_004281762.1| hypothetical protein Dester_1066 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065696|gb|ADY73703.1| protein of unknown function DUF218 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 272

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 61/220 (27%), Gaps = 39/220 (17%)

Query: 2   RYFWYGLFVCLIFFIMGF---------ISFIRYVKQMHIPDHPSVSAIVVLTGE------ 46
           R     +       I            +  +               AIVVL G       
Sbjct: 34  RKIGIAILSLTAVLIYLLSIEPVKNRILLPLENAFPYPSEAELDCKAIVVLGGGEIFHSP 93

Query: 47  ------------PIRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAE 91
                         R+  AF++ +      +   G     +  ++   +++  I   +  
Sbjct: 94  AEGMKAAVKPQVAKRLYTAFKIWKKVKKPIVVSGGKVFNENVEAESSAMKRFLISLGIPN 153

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             I    K+ NT  N         K     + +VT  YHMPR++   + I      IP P
Sbjct: 154 KEIIEESKSKNTFQNGIFTYKILNKKGIKKICLVTSAYHMPRSYRIFKSI--GFSVIPVP 211

Query: 152 IISH-DLEENSSIFKIKILRVL------LIEYLKILLLSI 184
                +    S       +  L      + EY+ I    +
Sbjct: 212 ADYRVNRGSYSWSSYFPRMEDLYDSFLGIHEYVGIAYFEL 251


>gi|221633222|ref|YP_002522447.1| ACR protein [Thermomicrobium roseum DSM 5159]
 gi|221156511|gb|ACM05638.1| Uncharacterized ACR [Thermomicrobium roseum DSM 5159]
          Length = 210

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/198 (13%), Positives = 59/198 (29%), Gaps = 22/198 (11%)

Query: 3   YFWYGLFVCLIFFIMG---FISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------R 49
            ++   F+ L     G    +  +   +     +     AI+VL               R
Sbjct: 16  RWFVAGFLGLTALTAGTTILVLGLAIAEHARSDERAPADAILVLGAAQYNGWPTRAFRAR 75

Query: 50  IERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++ A  L        I + G        S+     +    Q + +  + +     NT  +
Sbjct: 76  LDHAAALFRQGYAPTIVLVGGKTDRDLESEAEAGARYLREQGIPDNALIVVPVGRNTWQS 135

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
            + A+    +     +L+V+  +H+ R+ L  +      Q +  P     +         
Sbjct: 136 IEAAAQPLHERGVQRLLVVSDGFHLFRSKLMARSF--GFQVVGSPAPGSPIRPG----SP 189

Query: 167 KILRVLLIEYLKILLLSI 184
                +  E +  L   +
Sbjct: 190 LERWYIAREAVATLAFLL 207


>gi|332968539|gb|EGK07600.1| protein of hypothetical function DUF218 [Kingella kingae ATCC
           23330]
          Length = 207

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 69/198 (34%), Gaps = 26/198 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH--PSVSAIVVLTGEPI----------R 49
           RY+  GL + +       +  +  V     P        A VVL               R
Sbjct: 9   RYWLRGLGLSIALISSLQLWCVWQVYAYSRPQPLPDEADAAVVLGAAAWGNKPSPVFRER 68

Query: 50  IERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           I  A  L +    +KI  +G        ++  + ++  I+Q +A+  I    ++ +T  N
Sbjct: 69  INHALTLYQTGRVKKIIFTGGTPKAGFATEAEVARQYAIKQGIADQDIVFETRSKDTFQN 128

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
                   +K++ + V+IV+  YHM R     Q     +Q   Y   +     N+     
Sbjct: 129 LANTRFLMKKHHLNSVIIVSDPYHMARAMNMAQ----DLQLNAYASHTPTSRYNN----- 179

Query: 167 KILRVLLIEYLKILLLSI 184
              R  + E   + +  +
Sbjct: 180 --ARFFVEESYSLFVYEL 195


>gi|269925497|ref|YP_003322120.1| protein of unknown function DUF218 [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789157|gb|ACZ41298.1| protein of unknown function DUF218 [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 188

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/195 (12%), Positives = 66/195 (33%), Gaps = 21/195 (10%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFE 55
               + +I +    +  I   K  +  +     AI+VL               R++ A  
Sbjct: 2   IIALLLVIVWFGNVL--IEIHKVGNTDNAVKSDAILVLGAAQYNGRPSPVFRARLDHALA 59

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           L + ++  K+ + G      + ++     +  +R+ +    +       +T  + + A  
Sbjct: 60  LYKKRLAPKVVVVGGKARGDTYTEADSGVRYLLRRGIPSSSLVAVPHGRSTYSSLRAAKN 119

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
             +  +   ++IV+  +HM R+    + +    +    P     ++++         R +
Sbjct: 120 MLQPKHVRSLIIVSDRFHMYRSLEMAKSL--GFRVTGSPTPDSPIDKDP----AAETRYV 173

Query: 173 LIEYLKILLLSIQLS 187
           + E L      I   
Sbjct: 174 IREALAYTAYRISGR 188


>gi|291522028|emb|CBK80321.1| Uncharacterized conserved protein [Coprococcus catus GD/7]
          Length = 195

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 54/168 (32%), Gaps = 24/168 (14%)

Query: 32  PDHPSVSAIVVLTGEP-IRIERAFELLENQIGEKIFISGVH------------------- 71
                   I+V          RA  L +  +   I +SG +                   
Sbjct: 15  DLPKKADIIIVPGNTWPQPARRAAALYQAGMAPYIVVSGRYSKGRSAFEGPSCDRECYKG 74

Query: 72  HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDY 129
              ++   L  + ++  +    I    +A  T  NA+      E+ +      +I    +
Sbjct: 75  PYAAEADFLTDVLMQAGVPGEAILQEREATFTLENAEYIRKMLEEKHLPIKRAIICCQAF 134

Query: 130 HMPRTFLELQRINST--VQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           H  R  +  + +     ++F+  P ++  +  ++ +   K L  +L E
Sbjct: 135 HARRCRMYFEYVFQDREIEFLMCPAVTQSISRDNWMESKKGLETVLGE 182


>gi|217077219|ref|YP_002334937.1| hypothetical protein THA_1144 [Thermosipho africanus TCF52B]
 gi|217037074|gb|ACJ75596.1| conserved hypothetical protein [Thermosipho africanus TCF52B]
          Length = 241

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/202 (20%), Positives = 75/202 (37%), Gaps = 24/202 (11%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVS--AIVVLTGEP------------ 47
           R+F     V  +     F+ F+     +   + P      IV+L G              
Sbjct: 38  RFFLILSIVFYLISSPFFVYFLSKSFYIKEKNIPDSQNSVIVILGGGITFFDGKYEVGNH 97

Query: 48  --IRIERAFELLENQIGEKIFISGVH-HSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
              R+ + FE+        I   GV    +S+  +++ I +   +    I +  KA  T+
Sbjct: 98  TLKRLLKGFEIYRKTNAPIIISGGVIGKGISESAIMKDILVTFGVNINDIIVEDKARTTK 157

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP----YPIISHDLEEN 160
            NA   S   +  NF ++++VT   HM R+ +  ++  S    IP    YPI   +   +
Sbjct: 158 ENAIFVSKLLKGKNFENIILVTSFLHMKRSIMLFEK-YSKKNIIPIVCDYPIDFRNSFLD 216

Query: 161 --SSIFKIKILRVLLIEYLKIL 180
              S   +     +  E+  IL
Sbjct: 217 YLPSAEALYTFSQITHEFFGIL 238


>gi|261379601|ref|ZP_05984174.1| putative periplasmic protein [Neisseria subflava NJ9703]
 gi|284798080|gb|EFC53427.1| putative periplasmic protein [Neisseria subflava NJ9703]
          Length = 218

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 64/202 (31%), Gaps = 25/202 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFI----SFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+ +      +  + G        I       +P      A VVL             
Sbjct: 11  LRYYLFRGLALSVLLVCGIFLSGTWQIYRTGSHTLPKDAHADAAVVLGAAAWDKRPSPVF 70

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 71  RERINHAITLYQSHRVGKIIFTGGTPKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNT 130

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQFIPYPIISHDLEENSS 162
             N +        N    +++V+  YH+ R       +  S  QF   P    D      
Sbjct: 131 YENLRNIVPIMHANGVGSIIVVSDPYHLARAEEMAADLGLSDAQFSATPTTRFDERSKK- 189

Query: 163 IFKIKILRVLLIEYLKILLLSI 184
                  + L+ E   + L  I
Sbjct: 190 ------AKFLMQESYSLFLYRI 205


>gi|167629577|ref|YP_001680076.1| hypothetical protein HM1_1492 [Heliobacterium modesticaldum Ice1]
 gi|167592317|gb|ABZ84065.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 252

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 68/207 (32%), Gaps = 30/207 (14%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------------I 48
            L        +G         +   PD PS   I++L G                     
Sbjct: 48  LLLYLFSISAVGETMIRSLENRYLPPDKPSGDVIIMLGGGATMDTPDIDGLGQMTGGSAN 107

Query: 49  RIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+  A  L +      I  +G    +S ++  +  +      + E  I +   + NTE N
Sbjct: 108 RLLTAARLHQLTGAPIIVSAGQVFENSGNESRIAFRQLTGLGVPESMIIVEEMSRNTEEN 167

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH-----DLEENS 161
           A+      +   FH  ++VT  +HM R+     ++   V  +P+P             N 
Sbjct: 168 ARYTKEILDARGFHKPILVTSAFHMERSVGHFSKL--GVSTLPFPTDYRVNRQARYSLND 225

Query: 162 SIFKI---KILRVLLIEYLKILLLSIQ 185
                       + + EYL ++ L ++
Sbjct: 226 WAPSAVAMSNASLAMKEYLGLIPLWLK 252


>gi|220933067|ref|YP_002509975.1| hypothetical protein Hore_22350 [Halothermothrix orenii H 168]
 gi|219994377|gb|ACL70980.1| uncharacterized conserved protein [Halothermothrix orenii H 168]
          Length = 256

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 67/213 (31%), Gaps = 30/213 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRY-VKQMHIPDHPSVSAIVVLTGEP--------------- 47
                 +     +M F+  +       +I  +     IVVL G                 
Sbjct: 46  LVLMYILSSAVGVMLFLIPLETKFPYYNISRYDKELPIVVLGGGINYFGEKGEGKLNPIT 105

Query: 48  -IRIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             R+   + L +      IF  G    H   S+  +  +      + +  + +  +A NT
Sbjct: 106 LQRLVTGYRLYKEVETTLIFTGGQGIGHSGPSEADVAGEFLRELGINQEALVLENRARNT 165

Query: 104 EGNAQEASAWAEKNN--FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N      + E+ N     V +VT   H+PR     +R+   ++ +P P          
Sbjct: 166 YENGLYVRDYLEQRNGLDRGVYLVTSAVHLPRAVGVFRRL--NLKVVPVPAGYFADHTQG 223

Query: 162 SIFKIKILRVL------LIEYLKILLLSIQLSL 188
            +        L      + E++ +L   ++  +
Sbjct: 224 WLDFFPARSNLNATLAAIHEWIGLLWYKVRGRI 256


>gi|229097607|ref|ZP_04228566.1| hypothetical protein bcere0020_28490 [Bacillus cereus Rock3-29]
 gi|229106282|ref|ZP_04236779.1| hypothetical protein bcere0019_52930 [Bacillus cereus Rock3-28]
 gi|229116606|ref|ZP_04245993.1| hypothetical protein bcere0017_28920 [Bacillus cereus Rock1-3]
 gi|228666916|gb|EEL22371.1| hypothetical protein bcere0017_28920 [Bacillus cereus Rock1-3]
 gi|228677137|gb|EEL31517.1| hypothetical protein bcere0019_52930 [Bacillus cereus Rock3-28]
 gi|228685877|gb|EEL39796.1| hypothetical protein bcere0020_28490 [Bacillus cereus Rock3-29]
          Length = 219

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/193 (19%), Positives = 66/193 (34%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDDVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYALKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N  H   IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGIENGIHSYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|269119959|ref|YP_003308136.1| hypothetical protein Sterm_1340 [Sebaldella termitidis ATCC 33386]
 gi|268613837|gb|ACZ08205.1| protein of unknown function DUF218 [Sebaldella termitidis ATCC
           33386]
          Length = 208

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 71/200 (35%), Gaps = 23/200 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
             +F+  I      I+ I       + +       V+L               RI     
Sbjct: 9   LLIFIAGIIIAYVVITAISICLYSKVDEKQPADVAVILGAGASDEKVSPVFQERINHGIS 68

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           L +N+  +K+  +G     +  S      +  I+Q + +  I +   ++ T+ N + A  
Sbjct: 69  LYKNKYVKKLIFTGGTGKGNQNSDAYTAMQYAIKQGVPKDDILLEEMSVITQENIKNAKM 128

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
             +KN++H  ++V+   HM R  L  +   S +     P  +        I     L  L
Sbjct: 129 IMDKNSYHTAILVSDPLHMKRAMLMAKN--SKIDCYSSPTPTTKY-----ITLKSTLPFL 181

Query: 173 LIE---YLKILLLSIQLSLS 189
           L E   Y+   + ++   +S
Sbjct: 182 LREVFFYVGYKIYTMFDYIS 201


>gi|17547179|ref|NP_520581.1| transmembrane protein [Ralstonia solanacearum GMI1000]
 gi|17429481|emb|CAD16167.1| putative transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 185

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 55/155 (35%), Gaps = 8/155 (5%)

Query: 34  HPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC 92
                 IVVL      R+  A EL    +  ++F+SG    +    L+ +      +   
Sbjct: 37  PGRADVIVVLGGESGQRVIGAAELYHAGVAPRVFVSGEGDCL----LIVRRLEMAGVPAE 92

Query: 93  CIDIGYKALNTEGNAQEASA-WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
            I    ++ +T  NA+      A +      ++VT  YH  R     +R+   V +    
Sbjct: 93  RIGHECESGSTMENARMTRRTLAGQPPVRSAVLVTSWYHTGRALHVFRRVWPEVAWGARG 152

Query: 152 IISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
           +   D    S          +L EY+K    +++ 
Sbjct: 153 VFPGDTLAKSFPIYESGS--ILAEYIKRAWYAVRY 185


>gi|148270249|ref|YP_001244709.1| hypothetical protein Tpet_1119 [Thermotoga petrophila RKU-1]
 gi|281412552|ref|YP_003346631.1| protein of unknown function DUF218 [Thermotoga naphthophila RKU-10]
 gi|147735793|gb|ABQ47133.1| protein of unknown function DUF218 [Thermotoga petrophila RKU-1]
 gi|281373655|gb|ADA67217.1| protein of unknown function DUF218 [Thermotoga naphthophila RKU-10]
          Length = 237

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 70/209 (33%), Gaps = 26/209 (12%)

Query: 2   RYFWYGLFVCLIFFI--MGFISFIRYVKQM--HIPDHPSVSAIVVLTGEP---------- 47
           R+F   L V    F   +G   F+  +++        P+ + IVVL G            
Sbjct: 32  RWFLLALAVTAYLFSSYVGEFLFLWSLEKNLDVPATLPNDAVIVVLGGGVERNTKAGDNL 91

Query: 48  -----IRIERAFELLENQIGEKIFISGVHHSV-SKDILLQKIPIRQDLAECCIDIGYKAL 101
                 R+    ++ +      +   G    +  + ++++   +   + E  I +  ++ 
Sbjct: 92  SDATLRRLLTGVQIYQKTKMPILVTGGSLTGLRPEAMIMKDYLVSLGVPEEKITVEDRSR 151

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA        K     +++VT   HM R     +    +V   P      D E   
Sbjct: 152 NTYENAFFTRE---KIGDVPIILVTDSIHMRRAVSTFKSFFQSVTPYPAGFYFGDPEFVD 208

Query: 162 SIFKIKILRV---LLIEYLKILLLSIQLS 187
            +       +    + E++ ++  + +  
Sbjct: 209 FLPNATSFYLNSRAIYEWIGLVWYNFRWR 237


>gi|86749502|ref|YP_485998.1| hypothetical protein RPB_2382 [Rhodopseudomonas palustris HaA2]
 gi|86572530|gb|ABD07087.1| Protein of unknown function DUF218 [Rhodopseudomonas palustris
           HaA2]
          Length = 264

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 51/165 (30%), Gaps = 20/165 (12%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCID 95
           V L     R+  A EL  +    +I  SG       +SV++  +   +  R  +A     
Sbjct: 100 VELDSSAERVMAALELARDYPQARIVYSGGSGNLIQNSVAEAPIAADLFARFGVAPDRFV 159

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +  ++  T  NA               L+VT  +HMPR+    +           P+   
Sbjct: 160 VESRSRTTAENASFTRELVSPKPGEVWLLVTSAFHMPRSITAFRAA--GFDVTAAPV--- 214

Query: 156 DLEENSSIFKIKILRVL----------LIEYLKILLLSIQLSLST 190
           D          +    L            E+  +L   +    ++
Sbjct: 215 DWRTRGWGDAARPFDRLSSGLARTDVAAHEWAGLLAYRLSGRTTS 259


>gi|255527086|ref|ZP_05393975.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296188150|ref|ZP_06856542.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
 gi|255509238|gb|EET85589.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296047276|gb|EFG86718.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
          Length = 197

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 70/189 (37%), Gaps = 17/189 (8%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------IRIE 51
           R         L+F ++ F   +  +             I+VL  +            R +
Sbjct: 5   RKLVLYGIGILVFLVIIFAFQV--IYFGESSKPEKSDCIIVLGCKVYGSTPSPFLIWRTD 62

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
               L +   G+ I +SG      S+S+   +++  + + +    I +  K+ +T  N  
Sbjct: 63  EGLRLFKEGYGKYIIVSGGKGQGESISEAEAMKRYLVSKGVDSSKIILEDKSASTMANLI 122

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            + +  EK NF   +IV++ YH+ R  L   +    ++     +     + +  +  ++ 
Sbjct: 123 NSKSIMEKKNFKTAIIVSNKYHLKRASLMATQE--GIKASYSGVFVKPYKTDEFVGYLRE 180

Query: 169 LRVLLIEYL 177
           +  L+  Y 
Sbjct: 181 VPALMKYYF 189


>gi|261365693|ref|ZP_05978576.1| putative periplasmic protein [Neisseria mucosa ATCC 25996]
 gi|288565787|gb|EFC87347.1| putative periplasmic protein [Neisseria mucosa ATCC 25996]
          Length = 224

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 65/196 (33%), Gaps = 21/196 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R     + + L  F +G    + +     +P H    A +VL               RI 
Sbjct: 17  RGIGLSILLILGIFSVG-AWQVYHTGSQPLPRHVRADAALVLGAAAWDKRPSPVFRERIN 75

Query: 52  RAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A  L ++   EKI  +G       +++  + ++  ++Q +    I     + NT  N +
Sbjct: 76  HAITLYQSHRVEKIVFTGGTSKKGYMTEAEVGRRYALKQGIPAHNIIFENTSRNTYENIR 135

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
                        ++IV+  YH+ R       ++        P    D  +  +      
Sbjct: 136 NIRPILRAEGIESIIIVSDPYHLARALEIASDLDIEAYVSATPTTRFDQGKEKN------ 189

Query: 169 LRVLLIEYLKILLLSI 184
            + LL E   + L  I
Sbjct: 190 -KFLLQESYALFLYRI 204


>gi|253584074|ref|ZP_04861272.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251834646|gb|EES63209.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 252

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 55/162 (33%), Gaps = 9/162 (5%)

Query: 34  HPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAE 91
             S    V   G   RI +  +       +     G      +    + ++  I   +  
Sbjct: 91  PNSAGGNVPAEGANTRIMKTAQFYNKYPKKIYVSGGTPLQNKESESSVYKRELIGLGVPA 150

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             I I  K+ NT+ NA       E+      +++T  +HMPR+     +    + F P P
Sbjct: 151 EDIVIEEKSRNTKENAVYIKKMMEEAKEKKAVLITSAFHMPRSVKTFDKGEEGLIFYPAP 210

Query: 152 I-------ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
                     +  +        K L +LL EY+ ++   I+ 
Sbjct: 211 CDFMAKSETENFFDYIPKYVNFKKLGLLLKEYIGMVYYKIRY 252


>gi|78484758|ref|YP_390683.1| hypothetical protein Tcr_0413 [Thiomicrospira crunogena XCL-2]
 gi|78363044|gb|ABB41009.1| Conserved hypothetical protein; predicted membrane protein with
           DUF218 [Thiomicrospira crunogena XCL-2]
          Length = 272

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 65/208 (31%), Gaps = 33/208 (15%)

Query: 6   YGLFVCLIFFIMGFIS-FIRYVKQMHIPDHPSVSAIVVLTGEPI---------------- 48
              F+ L F I   +   +    +        +  I+VL G                   
Sbjct: 50  LAGFIVLAFPIGDLLIQPLEQRFKAPDTLPKHIDGIIVLGGGEDLKRSLSWGRPELGIGG 109

Query: 49  -RIERAFELLENQIGEKIFISGV------HHSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
            R   A EL  +     +  +G        ++  +  L +++     + +  + I   + 
Sbjct: 110 DRYIGAKELATHYPKAPVIFTGGSGSMQLQNTQGEGSLARQLLTTLGITDKRLIIESLSR 169

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN- 160
           NT  N +   A     N    L+VT  +HMPR+          +  IPYP+      E  
Sbjct: 170 NTYENFKFTKALLPDANG-TYLLVTSAFHMPRSVGIANNQ--NIHVIPYPVDYRSNSEKL 226

Query: 161 -----SSIFKIKILRVLLIEYLKILLLS 183
                     +K L     E++ + +  
Sbjct: 227 RQIDFDFFDHLKSLEPAWKEWIGLTVYY 254


>gi|170749150|ref|YP_001755410.1| hypothetical protein Mrad2831_2743 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655672|gb|ACB24727.1| protein of unknown function DUF218 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 281

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 66/218 (30%), Gaps = 37/218 (16%)

Query: 4   FWYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
               L    +    G        +  +      +  D P+ + I+VL G           
Sbjct: 40  LGLALLGSFLLGAAGLAPLSDVALIPLEQRFPAYPDDGPAPTGIIVLGGGIEAGLSEARR 99

Query: 49  ---------RIERAFELLENQIGEKIFISGVHHSVS----KDILLQKIPIRQDLAECCID 95
                    R     +L       ++  SG    ++    +  ++ +      +    + 
Sbjct: 100 QIVVNDAGERPIYLGDLARRYPAARLVFSGGSGFIAGGMAEADIVSRQADVIGVPRTRLI 159

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-- 153
           +  ++ NT  NA  ++A  +       L+VT  +HMPR     ++         +P+   
Sbjct: 160 LENRSRNTHENAAFSAALVKPKPGERWLLVTSAWHMPRAVGCFRQA--GFAVDAFPVDYR 217

Query: 154 SHDLEENSSIFKIKI-----LRVLLIEYLKILLLSIQL 186
           +    + +              + + E++ ++   +  
Sbjct: 218 TRGWSDVAHFHGFASDGLLQFDLAVKEWIGLVAYRLSG 255


>gi|149925438|ref|ZP_01913702.1| Uncharacterized ACR, COG1434 family protein [Limnobacter sp.
           MED105]
 gi|149825555|gb|EDM84763.1| Uncharacterized ACR, COG1434 family protein [Limnobacter sp.
           MED105]
          Length = 274

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/193 (19%), Positives = 65/193 (33%), Gaps = 36/193 (18%)

Query: 29  MHIPDHPSVSAIVVLTGE-----------------PIRIERAFELLENQIGEKIFISGVH 71
            + P    V AIVVL G                    R+ +   L +  +  +I +SG  
Sbjct: 83  ANRPLPAQVDAIVVLGGGLEGRFDGVRALPDLNDAGDRVWQGARLYKQGVATRIVLSGGQ 142

Query: 72  HSVS-----KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
                    +   ++   +   + E  + I   +  T  NA        +     + +VT
Sbjct: 143 FQTDPRKEAEAPGMKMFMLDMGVPEDALVIEDNSRTTFENAVRTRELLGER-ARSIALVT 201

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN------SSIFKIKIL---RVLLIEYL 177
             +HM R+ L  ++      F  YP+ +     N        + K + L    V + EYL
Sbjct: 202 SAFHMGRSVLWFEKAG----FTVYPVRTDIRVLNESRAFWEWLPKPQALDESTVAIKEYL 257

Query: 178 KILLLSIQLSLST 190
             L L +  +  T
Sbjct: 258 GRLQLKVSGAYET 270


>gi|150016976|ref|YP_001309230.1| hypothetical protein Cbei_2107 [Clostridium beijerinckii NCIMB
           8052]
 gi|149903441|gb|ABR34274.1| protein of unknown function DUF218 [Clostridium beijerinckii NCIMB
           8052]
          Length = 201

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 51/180 (28%), Gaps = 24/180 (13%)

Query: 20  ISFIRYVKQM--HIPDHPSVSAIVVLTGEPI-RIERAFELLENQIGEKIFISGVH----- 71
           I+FI+ +               I +         E+A +L        I  SG +     
Sbjct: 6   INFIKEITSFIFVEDKPEYCDIIFIPGSAWPEPAEKASKLWLEGYAPYILPSGKYSMSKG 65

Query: 72  --------------HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
                            ++   ++ I I   +    I     A  T+ NA ++    +  
Sbjct: 66  YFPGPITKAEIYNGEYNTEWEFMRDIAISNGVNGDAILKEDNATWTKENAFKSKEVTDNY 125

Query: 118 N--FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           N      +I    +H  R  +         +F   PI    + + +       +  ++ E
Sbjct: 126 NLDIKKAIICCKSFHAKRCLMFYSYAYPKTKFFVCPIDVDGITKENWFKTESGIDKVMGE 185


>gi|313672214|ref|YP_004050325.1| hypothetical protein Calni_0249 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312938970|gb|ADR18162.1| protein of unknown function DUF218 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 238

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/206 (19%), Positives = 71/206 (34%), Gaps = 23/206 (11%)

Query: 2   RYFWYGLFVCLIFFIMGFI--SFIRYVKQMHIPDHPSVSAIVVLTGEPI----------- 48
           RY  +   V L  F +  +    I  +++ +I        IVVL G              
Sbjct: 34  RYLLFFFAVMLYLFSISPVKDILIYPIEKDYINLKCDGDIIVVLGGGVYGNGELSEDAFK 93

Query: 49  RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+ + FE         I   G        +  +++ + +   + E  I +   + +T  N
Sbjct: 94  RVVKGFEKGRGGDKIIIVSGGRVSESYPYEAEVMKDLLVTLGIREGNIIMDKDSKDTVEN 153

Query: 107 AQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINST------VQFIPYPIISHDLEE 159
           A+      E+      V+++T  YHM R  L  ++            F    + S   + 
Sbjct: 154 AKFTKKIVEEKGIKGDVILITSAYHMKRGILIFKKYGFDNICAAATDFKFDGVYS-IYDF 212

Query: 160 NSSIFKIKILRVLLIEYLKILLLSIQ 185
             S   +  +   L EYL IL   I+
Sbjct: 213 LPSASNLNTVSKALKEYLGILFYRIK 238


>gi|288958654|ref|YP_003448995.1| hypothetical protein AZL_018130 [Azospirillum sp. B510]
 gi|288910962|dbj|BAI72451.1| hypothetical protein AZL_018130 [Azospirillum sp. B510]
          Length = 264

 Score = 76.4 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/200 (11%), Positives = 59/200 (29%), Gaps = 30/200 (15%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELLE 58
           +   ++     +         +  I++L                      RI    +L+ 
Sbjct: 59  LGALVALPLENRFPRSEPEGRIDGIIMLGGAVNPPITADRGDPSLNEAAERILGFADLVR 118

Query: 59  NQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
                K   +G         + +D+  +    +  +    +    ++ NT  NA  +   
Sbjct: 119 RHPEAKAVFTGGSGQLLAPDLKEDVTARAALAQAGIPADRVLYEAESRNTWENAVFSKEM 178

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL- 172
                    +++T   HMPR+    + +       PYP+      +   I + ++ + L 
Sbjct: 179 VRPRPGERWILITSAMHMPRSVGIFREV--GWPVEPYPVDYRTRHDARPILRFQLDQNLV 236

Query: 173 -----LIEYLKILLLSIQLS 187
                + E++ +        
Sbjct: 237 ILDDAVREWIGLAAYWAMGR 256


>gi|170288947|ref|YP_001739185.1| hypothetical protein TRQ2_1158 [Thermotoga sp. RQ2]
 gi|170176450|gb|ACB09502.1| protein of unknown function DUF218 [Thermotoga sp. RQ2]
          Length = 237

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 70/209 (33%), Gaps = 26/209 (12%)

Query: 2   RYFWYGLFVCLIFFI--MGFISFIRYVKQM--HIPDHPSVSAIVVLTGEP---------- 47
           R+F   L V    F   +G   F+  +++        P+ + IVVL G            
Sbjct: 32  RWFLLALAVTAYLFSSYVGEFLFLWSLEKNLDVPATLPNDAVIVVLGGGVERNTKAGDNL 91

Query: 48  -----IRIERAFELLENQIGEKIFISGVHHSV-SKDILLQKIPIRQDLAECCIDIGYKAL 101
                 R+    ++ +      +   G    +  + ++++   +   + E  I +  ++ 
Sbjct: 92  SDATLRRLLTGVQIYQKTKMPILVTGGSLTGLRPEAMIMKDYLVSLGVPEEKITVEDRSR 151

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA        K     +++VT   HM R     +    +V   P      D E   
Sbjct: 152 NTYENAFFTRE---KIGDVPIILVTDSIHMRRAVFTFKSFFQSVTPYPAGFYFGDPEFVD 208

Query: 162 SIFKIKILRV---LLIEYLKILLLSIQLS 187
            +       +    + E++ ++  + +  
Sbjct: 209 FLPNATSFYLNSRAIYEWIGLVWYNFRWR 237


>gi|289642675|ref|ZP_06474815.1| protein of unknown function DUF218 [Frankia symbiont of Datisca
           glomerata]
 gi|289507505|gb|EFD28464.1| protein of unknown function DUF218 [Frankia symbiont of Datisca
           glomerata]
          Length = 205

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/206 (11%), Positives = 60/206 (29%), Gaps = 19/206 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
                  + L   ++   + I+        D      ++VL               R++ 
Sbjct: 3   LLRVVAILVLAGVMISVFAMIQIWVVGRSDDQRRSDVLIVLGASQFNGRPSAVFAARLDH 62

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A  L    +  +I   G        ++        + + +    + +  +  +T G+ + 
Sbjct: 63  ALALYRAGVAPRIVTVGGSQVGDVYTEARAAANYLVSRGVPASAVVVVGEGRDTLGSLRA 122

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
            +     N +   ++VT  +H  R+    + +   +  +  P  +              L
Sbjct: 123 VARIMAVNRWRSAVVVTDPWHSLRSRTIARDL--DIDAVTSPATTGPTTRGI----ATTL 176

Query: 170 RVLLIEYLKILLLSIQLSLSTQTASQ 195
           R +L E        +    +   A+ 
Sbjct: 177 RYILREGAAYRFYQLFHRATPVGAAP 202


>gi|332969923|gb|EGK08925.1| protein of hypothetical function DUF218 [Desmospora sp. 8437]
          Length = 189

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/169 (14%), Positives = 55/169 (32%), Gaps = 17/169 (10%)

Query: 5   WYGLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
           W             F   +                    +VL               R++
Sbjct: 4   WLIAIAMGAGIAGSFGCLLWIRVSSFDGKRLLPIPRQGAIVLGTALEDHRPSPALQERMD 63

Query: 52  RAFELLENQIGEKIFISGVHHS--VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           +A +L +  +   + +SG        +  ++++  + + + +  + +  ++ NT  N   
Sbjct: 64  QALKLYQRGLAPILILSGGSPRGTTPEARVMKEYLVERGVRKRDLILEDRSTNTAENLVR 123

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
           +      +    V +VTHD+HM R     +R    +   P P+ +  L 
Sbjct: 124 SGELLLSHGIRDVYLVTHDFHMYRALRCARRA--QLSVTPAPVATRSLW 170


>gi|291614927|ref|YP_003525084.1| hypothetical protein Slit_2472 [Sideroxydans lithotrophicus ES-1]
 gi|291585039|gb|ADE12697.1| protein of unknown function DUF218 [Sideroxydans lithotrophicus
           ES-1]
          Length = 251

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 58/201 (28%), Gaps = 26/201 (12%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------------RIE 51
            +   FF    +  +     ++    P   AIVVL G                    R+ 
Sbjct: 52  LLSTPFFAEAMLQGLEGQPFVNDTSKPQADAIVVLGGGTNFRAPEYGGDTVSKETLERLR 111

Query: 52  RAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDI-GYKALNTEGNAQEA 110
            A  L        +   G           Q     +      +      + NT  NA+ +
Sbjct: 112 YAARLYRQTGKPILVTGGTPLGNDLSEAAQMKKTLEQEFNVPVRWAEGASNNTLENARLS 171

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL- 169
               +K     + +VTH +HMPR     Q      Q  P P       +   +  I    
Sbjct: 172 REVLKKEGISRIYLVTHAWHMPRAVQVFQAA--GFQVYPAPTAYTTRYQLDLLVFIPSAS 229

Query: 170 -----RVLLIEYLKILLLSIQ 185
                R+ + E + +L   ++
Sbjct: 230 ALRDSRIFMHEMIGLLWYRLK 250


>gi|254490468|ref|ZP_05103654.1| conserved hypothetical protein [Methylophaga thiooxidans DMS010]
 gi|224464212|gb|EEF80475.1| conserved hypothetical protein [Methylophaga thiooxydans DMS010]
          Length = 276

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 64/216 (29%), Gaps = 36/216 (16%)

Query: 2   RYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVV--------------- 42
           R                     +  +     +      +V  I+V               
Sbjct: 43  RIITLMSLAGFSMLAYPVSDYLMYPLETRFALPEDLPDNVDGIIVLGGAEKLKLSMSWKQ 102

Query: 43  --LTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDIL------LQKIPIRQDLAECCI 94
             +     RI +A EL        +  +G  + V    L       Q +  +  + +  +
Sbjct: 103 AEVGEAAERILKAAELSRRYPDVPVIYTGGSNLVQMQNLDTQGSVSQTLLTQAGIDKQRL 162

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            I  +A NT  N         K    + ++VT  +H+PR+    +++   +  IPYP+  
Sbjct: 163 IIETQARNTAENFFYIKPLLPKQQG-NYILVTSAFHIPRSVGIARKL--GIDVIPYPVDY 219

Query: 155 HDLEENSSIFKIKILRVL------LIEYLKILLLSI 184
                +   +   +   L        E+L +    +
Sbjct: 220 RSSRPDERYWDFDLFDHLQVLEPAWHEWLGLTAYFV 255


>gi|188587339|ref|YP_001918884.1| protein of unknown function DUF218 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179352026|gb|ACB86296.1| protein of unknown function DUF218 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 230

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 67/197 (34%), Gaps = 24/197 (12%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-PIRIERAFELLENQIGEKIF 66
             + L  F    ++ I        P     S I+VL G  P RI    EL ++   E I 
Sbjct: 27  AILILTIFWDNLLTAIGKFLVAEEPLERDGSYILVLQGGIPDRIAHGVELHQDNYAENIL 86

Query: 67  ISGVHHSVSK-------------DILLQKIPIRQDLAECCI-DIGYKALNTEGNAQEASA 112
           +       +                + ++  ++  + +  I  I  K  +T+  A + + 
Sbjct: 87  MVESKSFTNYELMEQKQLDLPSSAEINKQAAMQMGIDDDQINIIPGKVDSTQQEAGKVAQ 146

Query: 113 WAEKNNFH----HVLIVTHDYHMPRTFLEL-----QRINSTVQFIPYPIISHDLEENSSI 163
           +   N        V++VT  YH  R  L L     +   + +  +  P        +   
Sbjct: 147 YLSSNYHSEEDLKVILVTSRYHSKRAKLILQTELKEHDLTNIDIVSSPSHYDPYYPDEWW 206

Query: 164 FKIKILRVLLIEYLKIL 180
              +  R   +EYLK++
Sbjct: 207 KNRRQARNTFMEYLKLI 223


>gi|42782182|ref|NP_979429.1| hypothetical protein BCE_3127 [Bacillus cereus ATCC 10987]
 gi|42738107|gb|AAS42037.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 210

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKEVGTENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|42523257|ref|NP_968637.1| hypothetical protein Bd1767 [Bdellovibrio bacteriovorus HD100]
 gi|39575462|emb|CAE79630.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 184

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 75/180 (41%), Gaps = 11/180 (6%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIP------DHPSVSAIVVLTGEPIRIERAFE 55
           R FW   F+  +        F+   +++           PS    VVLTG   R+   F+
Sbjct: 4   RSFWALAFLSAVV----LYRFVDEFQKVQSERIQSWTKTPSADCAVVLTGGAGRVREGFD 59

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           LL NQ  +K+ ISGV+ +     ++   P   +L+E  + +  ++  T GNAQ++    E
Sbjct: 60  LLVNQNVKKLVISGVYSNARLREIMPVWPFYGNLSENDVVLDRRSETTYGNAQQSLPIVE 119

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
                 +L+VT   HM R++   +      +    + II    E +      + L+ L  
Sbjct: 120 ALKCRDILLVTSRLHMYRSYRTFRATFPENIYIEKHAIIGGRFESSVWESGFEALKSLFY 179


>gi|89076218|ref|ZP_01162571.1| hypothetical protein SKA34_04145 [Photobacterium sp. SKA34]
 gi|89048104|gb|EAR53690.1| hypothetical protein SKA34_04145 [Photobacterium sp. SKA34]
          Length = 226

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 48/145 (33%), Gaps = 13/145 (8%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHH-------SVSKDI 78
                 +      I VL     R+ ERA EL +  +   I  SG          + S+  
Sbjct: 15  YHQLNHEIVKSDYIFVLGSNDERVAERAVELYKQGLAPYIIFSGGVGELTEGLFNTSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
              KI +   + +  I I  ++ NT  N        ++        ++V   +   RT  
Sbjct: 75  HFAKIALDMGVPKGAILIEPESTNTGENVLFTRRLLQQKGLTPRSFILVQKPFMERRTLA 134

Query: 137 ELQRINSTVQFIPYPIISHDLEENS 161
             ++    +Q I   + S  +  + 
Sbjct: 135 TFEQQWPHMQAI---VTSPQINFDD 156


>gi|170744388|ref|YP_001773043.1| hypothetical protein M446_6345 [Methylobacterium sp. 4-46]
 gi|168198662|gb|ACA20609.1| protein of unknown function DUF218 [Methylobacterium sp. 4-46]
          Length = 273

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 58/180 (32%), Gaps = 11/180 (6%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHH 72
           +  + G ++     ++     +     +V       R   A  +           SG   
Sbjct: 84  VVVLGGALAEGIRAERGAPGLNREADRLVAFAALARRYPAAKLVFAGGPA-----SGRRE 138

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
            +++    + +     L    + +  ++ +T  NA EA A A        L+VT   HMP
Sbjct: 139 GLTEAQASRALLEEIGLPPGRLLVDDRSRSTWENAVEARALARPGPGETWLLVTSASHMP 198

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR-----VLLIEYLKILLLSIQLS 187
           R     +R       + +P+        ++  +    +     +   E+  +L   ++  
Sbjct: 199 RAMGAFRRAG-WPPLLAWPVAYRTTRRGAAALRPLGAKLAAIDLAAHEWAGLLAYRLRGR 257


>gi|229156674|ref|ZP_04284762.1| hypothetical protein bcere0010_28590 [Bacillus cereus ATCC 4342]
 gi|228626843|gb|EEK83582.1| hypothetical protein bcere0010_28590 [Bacillus cereus ATCC 4342]
          Length = 219

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGVENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|307319303|ref|ZP_07598732.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|306895139|gb|EFN25896.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
          Length = 262

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/215 (13%), Positives = 59/215 (27%), Gaps = 33/215 (15%)

Query: 4   FWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLT----------------- 44
           F   +    +F   G  F+  +        P+   ++ I+VL                  
Sbjct: 43  FGLAVLFVTLFTTAGSYFLQILEDRFPRPTPEPTELACIIVLGGAFENVVMASRGGMELN 102

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYK 99
               R      L +     +I +SG                +       +    +    +
Sbjct: 103 QAAERFVETLRLAQAYPQARILVSGGDGSLSGIYEGDAHASENFFGTFGIGSDRLIRAGE 162

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH---- 155
           +  T  NA+       KN      +VT  YHMPR+    +   + ++  P+P        
Sbjct: 163 SRTTFENARYTRDLLAKNGLERCALVTSAYHMPRSIGLFR--ANGMEVTPWPTDYRTSGK 220

Query: 156 ---DLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
                +        ++      E+  ++   +   
Sbjct: 221 VRLGFDFTQPSLNAQLATTAAKEWTGLVAYYLLGR 255


>gi|228986175|ref|ZP_04146317.1| hypothetical protein bthur0001_28620 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228773556|gb|EEM21980.1| hypothetical protein bthur0001_28620 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 219

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|295108464|emb|CBL22417.1| Uncharacterized conserved protein [Ruminococcus obeum A2-162]
          Length = 194

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 56/169 (33%), Gaps = 22/169 (13%)

Query: 29  MHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH---------------- 71
               +      I +      ++ E+A  L   +    +  SG +                
Sbjct: 14  FAEDEPEKADIIFIPGNGYSQMAEKAAALYGEKYAPFVLPSGKYSITVDKFCGVLSGQER 73

Query: 72  ---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVT 126
              +  ++   L+ + ++  + +  I    +A  T  NA+ +    +K        L+  
Sbjct: 74  YNGNYRTEWEFLKDVLVKNHVPDEVILKEDQATFTWENARLSREVTDKAGIEIKKALLCC 133

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            +YH  R  +  QR     +F   P     + + + +   + ++ +L E
Sbjct: 134 KNYHARRALMYYQRAYPEAEFRVCPCCVDGVTKENWMNAEESIQSVLGE 182


>gi|229139714|ref|ZP_04268284.1| hypothetical protein bcere0013_28240 [Bacillus cereus BDRD-ST26]
 gi|228643845|gb|EEL00107.1| hypothetical protein bcere0013_28240 [Bacillus cereus BDRD-ST26]
          Length = 219

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|168179334|ref|ZP_02613998.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226950331|ref|YP_002805422.1| hypothetical protein CLM_3296 [Clostridium botulinum A2 str. Kyoto]
 gi|182669557|gb|EDT81533.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226841604|gb|ACO84270.1| conserved hypothetical protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 198

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 67/162 (41%), Gaps = 15/162 (9%)

Query: 33  DHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
                 +I++L  +            R++    L     G+ I +SG      ++S+   
Sbjct: 39  QPQKSDSIIILGCKVKGNDPTPFLKRRLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEA 98

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           +QK  +++ L +  I +  K+ NT  N + +    E NN    +IV++ YH+ R  L  Q
Sbjct: 99  MQKYLVQKGLDKKFIILEDKSRNTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQ 158

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +    ++     +       +  +  ++ +  LL+ Y+K + 
Sbjct: 159 KE--GIKASYSGVFVRSHMSHEIMGFLREIPALLVYYIKTMY 198


>gi|226308856|ref|YP_002768816.1| hypothetical protein RER_53690 [Rhodococcus erythropolis PR4]
 gi|226187973|dbj|BAH36077.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 229

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 58/190 (30%), Gaps = 26/190 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------R 49
           R+      +  + +    +               +  A VV+                 R
Sbjct: 19  RWVAGIAVLGAVVYAGSIVWISVASAGHTSDAADAPDAPVVIVLGAQIKDGKPMAFLKGR 78

Query: 50  IERAFELLENQIGEKIFISGVHHSVSKDILLQK--IPIRQDLAECCIDIGYKALNTEGNA 107
           ++ A EL+E    + + +SG  +  S D +       + Q + E  I      L+T    
Sbjct: 79  LDAAVELVEAGKAKAVLVSGDANGGSGDEIAAMTNYLVEQGIDERRIVGDPYGLDTYDTC 138

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             A            LIVT  YH+PR     + +          I +  +  +       
Sbjct: 139 FRA---IHTYGVTKALIVTQGYHVPRAVALCRDVG---------IDADGVNSDCGCATPT 186

Query: 168 ILRVLLIEYL 177
           +++    E++
Sbjct: 187 LIKNAAREWV 196


>gi|222100068|ref|YP_002534636.1| hypothetical protein CTN_1094 [Thermotoga neapolitana DSM 4359]
 gi|221572458|gb|ACM23270.1| Putative uncharacterized protein [Thermotoga neapolitana DSM 4359]
          Length = 252

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 64/209 (30%), Gaps = 26/209 (12%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQ----MHIPDHPSVSAIVVLTGEP---------- 47
           R+ +  L   L         F+         +     P    IV+L G            
Sbjct: 47  RWLFVLLATFLYVLSSYPAEFLFLRPLEEDLIVPDGLPQNGVIVILGGGVERNTKTGDSL 106

Query: 48  -----IRIERAFELLENQIGEKIFISGVHHSV-SKDILLQKIPIRQDLAECCIDIGYKAL 101
                 RI   F++        +   G    +  + I++++  +   + E  + +  ++ 
Sbjct: 107 SDSTLRRILTGFQVHRKTGLPILVTGGSLSGLEPEAIIMKEYLVSLGVPEKNVLVENRSR 166

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           NT  NA              +++VT   HM R     ++  S V   P        E   
Sbjct: 167 NTYENAFFTKNLI---GDVPIVLVTDSIHMRRALYTFKKFFSEVVPYPAGCYFGTPEFVD 223

Query: 162 SIFKIKILRV---LLIEYLKILLLSIQLS 187
            +       +    + E++ ++  +++  
Sbjct: 224 FLPSATSFYLNSRAIYEWIGLVWYNLRGR 252


>gi|258591830|emb|CBE68131.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 232

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 65/203 (32%), Gaps = 18/203 (8%)

Query: 1   MRYFWYGLFVCLIFFIMG-FISFIRYVKQMHIPDHPSVSAIVVL--TGEPIRIERAFELL 57
           +R+      + L+ ++   F+        +         AI VL   G   R   A  L 
Sbjct: 6   IRWLIVFPLLGLLLYVGHPFLLRAMGRYLITEDRLQKAEAIAVLAGDGGVGRTLEAVRLY 65

Query: 58  ENQIGEKIFISG-------------VHHSVSKDILLQKIPIRQDLAECCIDIGYKALN-T 103
           ++    +I ++                    +  +   +     +    +    +  + T
Sbjct: 66  QDGYAPRIILTRQRLPTGYEALTRLGITVPEERHIQWMVLKAMRVPVTAVLQVNERSDST 125

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN-STVQFIPYPIISHDLEENSS 162
                      +++    +++VT+  H  R    L R++ + +  I  P      + +  
Sbjct: 126 ASEMVHLVRLLKEHRIRTIILVTNKSHSTRASKILARVSRNNLTSISRPTRYDTFDPDGW 185

Query: 163 IFKIKILRVLLIEYLKILLLSIQ 185
                  R +L EYLK+L   +Q
Sbjct: 186 WRSRADARDVLFEYLKLLDYLVQ 208


>gi|316933607|ref|YP_004108589.1| hypothetical protein Rpdx1_2264 [Rhodopseudomonas palustris DX-1]
 gi|315601321|gb|ADU43856.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           DX-1]
          Length = 264

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 56/203 (27%), Gaps = 31/203 (15%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELL 57
                +  +            +   I+VL                      R+    +L 
Sbjct: 57  LGNVLLLSLSERYPPWHDTGRAPDGIIVLGGAINSEVSAARNTVELDASAERVLATLDLA 116

Query: 58  ENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
                 +I  SG   ++      +  L  ++  R  LA   + +  ++  T  NA    A
Sbjct: 117 RRYPQARIVYSGGSGNLIQRSAAEAPLAGELLERFGLAAGRVVLEDQSRTTAENAANTRA 176

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR-- 170
                     L+VT  +HMPR+ +  Q        + YP+                L   
Sbjct: 177 LVSPKPGELWLLVTSSFHMPRSIMAFQAA--GFDVVAYPVDWRTRGREDVALPFATLAAG 234

Query: 171 -----VLLIEYLKILLLSIQLSL 188
                V   E+  +L   +   +
Sbjct: 235 LARTDVAAHEWAGLLAYRLGGKI 257


>gi|324327048|gb|ADY22308.1| EpiH/GdmH-related protein [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 210

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKEVGIENGIQTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|67459774|ref|YP_247398.1| hypothetical protein RF_1382 [Rickettsia felis URRWXCal2]
 gi|67005307|gb|AAY62233.1| Uncharacterized conserved protein [Rickettsia felis URRWXCal2]
          Length = 174

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 69/158 (43%), Gaps = 7/158 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      ++ G   ++  +    +  +   +A++V  G   +IE    LL+  
Sbjct: 2   IRKFLLTILAIFALWVGGLGYYLYLINSYKLNSNT-TNAVIVFAGGGHKIETGIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL++  +   + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFITGIESTEQLKNLLKERNV---IEQQVILAPNKIMSEEDNIKKAVDFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISH 155
            +++V H+Y+MP    +L++       +  +PY + S 
Sbjct: 118 SIILVEHNYNMPFMLNKLEKAIPSSNNIYIVPYLVFSK 155


>gi|262204353|ref|YP_003275561.1| hypothetical protein Gbro_4535 [Gordonia bronchialis DSM 43247]
 gi|262087700|gb|ACY23668.1| protein of unknown function DUF218 [Gordonia bronchialis DSM 43247]
          Length = 334

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 64/209 (30%), Gaps = 19/209 (9%)

Query: 15  FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIRIERAFELLENQIGE 63
            I G     + V      +      IV+L                R+       E     
Sbjct: 117 IIAGVADAAKIVPDTTPKNVSGRPTIVILGYGLGADGKMAAELINRVRAGKSQAELTTSA 176

Query: 64  KIFISGVHHS--VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
            I +SG      +++   +QK  +   +    I    K+ +T  NAQ  +A         
Sbjct: 177 PIVVSGGVPKKGITEASAMQKWLVDNGVDASRITTEDKSGSTVANAQNTAAILAGKGVRD 236

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK---ILRVLLIEYLK 178
           +++VT   H+ R   +     + ++ +       DL   ++    +    +R+      K
Sbjct: 237 IILVTSPSHIRRAAADF--AATGLRVVASVTTGTDLSRYATPLTKQRQTGIRLEATRTAK 294

Query: 179 ILLLSIQLSLSTQTASQFFITLIEEITVK 207
           I     Q  +           LI EI  K
Sbjct: 295 IPATR-QPGVLPDNLPDPGPGLIPEIGNK 322


>gi|319788557|ref|YP_004148032.1| hypothetical protein Psesu_2977 [Pseudoxanthomonas suwonensis 11-1]
 gi|317467069|gb|ADV28801.1| protein of unknown function DUF218 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 202

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 53/166 (31%), Gaps = 15/166 (9%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLEN 59
           V  I ++ G  ++I +V             I+VL               RI     L   
Sbjct: 20  VLAILWLGGVAAWINWVGH--RDQAQRADVIIVLGAAAYDARPSPVFEERIRHGLNLYRA 77

Query: 60  QIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
                +  +G +      ++  + Q+  +RQ + E  I I   +  T  N  +A     +
Sbjct: 78  GYAPVLLFTGGYGTGARFAESQVAQRYAVRQGIPEEAILIETASRTTLQNLLQARELMRE 137

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
              H  +IV+   HM R     +++       P P       +   
Sbjct: 138 RQLHSAIIVSDPLHMSRALRLCRQLGIEATGSPTPSTRFRSFQTQW 183


>gi|237748053|ref|ZP_04578533.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229379415|gb|EEO29506.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 203

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 68/197 (34%), Gaps = 26/197 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           ++    L    +F I  F S   +     + +  +  A ++L               RI 
Sbjct: 3   KWIKVALVSFCVFLIYIFCSIAWF---STVDEKKTADAAIILGAAAWYKRPSPVFEERIN 59

Query: 52  RAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
               L +N   +K+  +G        S+  + ++  ++  + E  I I  ++L T  N Q
Sbjct: 60  HGIWLYKNGYVKKLIATGGKSKNAPFSEAFVARRYAMKNQIPEEDILIEEESLTTRENLQ 119

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            A    E+N+    +IV+   HM R         + +    +   +   +  S       
Sbjct: 120 NAKKLMEENHLSSAIIVSDPMHMRRAMQI----ANDLGIKAWSSPTPSTKYASW---QAK 172

Query: 169 LRVLLIEY---LKILLL 182
           ++ L  E    +  ++ 
Sbjct: 173 IQFLFQETWHMIAYIVY 189


>gi|225076794|ref|ZP_03719993.1| hypothetical protein NEIFLAOT_01845 [Neisseria flavescens
           NRL30031/H210]
 gi|224951892|gb|EEG33101.1| hypothetical protein NEIFLAOT_01845 [Neisseria flavescens
           NRL30031/H210]
          Length = 218

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 63/202 (31%), Gaps = 25/202 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFI----SFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+ +      +  + G        I       +P      A VVL             
Sbjct: 11  LRYYLFRGLALSVLLVCGIFLTGTWQIYRTGLQTLPKDAHADAAVVLGAAAWDKRPSPVF 70

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 71  RERINHAITLYQSHRVGKIIFTGGTPKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNT 130

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQFIPYPIISHDLEENSS 162
             N          N    +++V+  YH+ R       +  S  QF   P    D      
Sbjct: 131 YENMLNIVPIMHANGVGSIIVVSDPYHLARAEEMAADLGLSDAQFSATPTTRFDERSKK- 189

Query: 163 IFKIKILRVLLIEYLKILLLSI 184
                  + L+ E   + L  I
Sbjct: 190 ------AKFLMQESYSLFLYRI 205


>gi|168181584|ref|ZP_02616248.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|237796355|ref|YP_002863907.1| hypothetical protein CLJ_B3154 [Clostridium botulinum Ba4 str. 657]
 gi|182675224|gb|EDT87185.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|229261607|gb|ACQ52640.1| conserved hypothetical protein [Clostridium botulinum Ba4 str. 657]
          Length = 197

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 33  DHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
                 +I++L  +            R++    L     G+ I +SG      ++S+   
Sbjct: 39  QPQKSDSIIILGCKVKGNNPTPFLKRRLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEA 98

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           +QK  +++ + +  I +  K+ NT  N + +    E NN    +IV++ YH+ R  L  Q
Sbjct: 99  MQKYLVQKGVDKKFIILEDKSRNTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQ 158

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           +    ++     +       +  +  ++ +  LL+ Y+K +
Sbjct: 159 KE--GIKASYSGVFVRSHMSHEIMGFLREIPALLVYYIKTM 197


>gi|153832463|ref|ZP_01985130.1| integral membrane protein [Vibrio harveyi HY01]
 gi|148871258|gb|EDL70130.1| integral membrane protein [Vibrio harveyi HY01]
          Length = 268

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 80/219 (36%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   +V  ++VL              
Sbjct: 40  FVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFLPVSGTVDYVMVLGNGHVVDNEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRTALMRLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHD 156
            A +T   A++A+A+ ++ +    ++VT   HM R   E       ++ IP P    + D
Sbjct: 160 DAKDTWEEARQAAAFVKQKDI---VLVTSASHMKRALYEFNAA--GIKPIPAPTNFMAID 214

Query: 157 LEENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
             E          R L        EYL  L   ++ ++ 
Sbjct: 215 DIEQPWQKYAPKARYLEQTELYWHEYLGGLWQKLRDNVG 253


>gi|317064197|ref|ZP_07928682.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689873|gb|EFS26708.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 241

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 53/162 (32%), Gaps = 9/162 (5%)

Query: 34  HPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAE 91
             S    V   G   RI +  +       +     G      +    + ++  +   +  
Sbjct: 80  PNSAGGNVPSEGANARIIKTAQFYNKYPKKIYISGGSPLQNKESESSVYKRELVALGIPS 139

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             I I  K+ NT  NA       E +     +++T  +H+PR+          + F P P
Sbjct: 140 ENIVIEEKSRNTRENALYIRKMMEGSKEKKAVLITSAFHIPRSVKTFDDGEGGLIFYPAP 199

Query: 152 II-------SHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
                     +  +        K L +LL EY+ +L   I+ 
Sbjct: 200 CDFMAKKEAENFFDYIPEYTNFKKLGILLKEYIGMLYYRIRY 241


>gi|311697190|gb|ADQ00062.1| protein containing DUF218 [marine bacterium HP15]
          Length = 159

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/144 (13%), Positives = 47/144 (32%), Gaps = 10/144 (6%)

Query: 46  EPIRIERAFELLENQIGEKIFISGVHHSVSKD--ILLQKIPIRQDLAECCIDIGYKALNT 103
              R+  A  L        + ++G            +++      +    + +  ++ NT
Sbjct: 16  GADRVWHAARLFNASKAPLVLLTGGSDPSHSAASEAMRQFMRDLRVPGQALVLESRSRNT 75

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS- 162
             NA+ ++    +   + +L+VT  YHMPR     +     ++ I        L      
Sbjct: 76  SQNAEYSAEILTEQGVNRILLVTFAYHMPRAKALFEAQ--GLEVILVATDHEVLSRPLWR 133

Query: 163 -----IFKIKILRVLLIEYLKILL 181
                   +     ++ E +  L+
Sbjct: 134 SLLPETSALDGSSRVIKEIVGRLV 157


>gi|254430947|ref|ZP_05044650.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
 gi|197625400|gb|EDY37959.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
          Length = 265

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 37/208 (17%), Positives = 65/208 (31%), Gaps = 40/208 (19%)

Query: 19  FISFIRYVKQ-MHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQI 61
            I  +      +     P+  A+VVL G                   R+     LL    
Sbjct: 58  LIWGLEERSTALEPASLPAADAVVVLGGGLRPAQPPRRGVEVGEAGDRLLTGVRLLRQGK 117

Query: 62  GEKIFISGVH-------HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
              +  SG             +    + + +   +A   I +  +A  T   A++  A  
Sbjct: 118 APTLVTSGGRVHFTAGKPPPPEAEWARDLAVELGIAPERILLAREARTTAEEARDLGAMG 177

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---------------SHDLEE 159
               +  VL+VT   HMPR     QR  S ++ +  P                 S  L  
Sbjct: 178 RTRGWSRVLLVTSASHMPRALATFQRR-SGLEVVAVPTDFQLPQRASYGAPTLGSALLSV 236

Query: 160 NSSIFKIKILRVLLIEYLKILLLSIQLS 187
                 + +  V+L E+L +L+  ++  
Sbjct: 237 APDAEALYLSTVMLKEHLGLLVYRLRGW 264


>gi|332798404|ref|YP_004459903.1| hypothetical protein TepRe1_0394 [Tepidanaerobacter sp. Re1]
 gi|332696139|gb|AEE90596.1| protein of unknown function DUF218 [Tepidanaerobacter sp. Re1]
          Length = 193

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 70/199 (35%), Gaps = 27/199 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
           R  +  +FV L  F    I     +      D   V  +++L               R++
Sbjct: 4   RLLFIIVFVLLFSF---LIIESLIIVNSFSNDDMPVDYMIILGAGLYGDEPSPSLRYRLQ 60

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           +A E         I +SG       +S+   +Q+  ++  + E  I     + NT  N  
Sbjct: 61  QALEYANKYPQVPIVVSGGQGSNEWISEAEAMQRFLVKHGIKEERIIKEDCSTNTGENLL 120

Query: 109 EASAWAEKNN---FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
            A    +         V+IVT +YHM R+    +R      FIPY I +        +  
Sbjct: 121 FAREVIKYTGKAERPKVMIVTSEYHMFRSKFLARRYG----FIPYGICAPTPAYPRYLKP 176

Query: 166 IKILRVLLIEYLKILLLSI 184
           +  +R    EY  ++   +
Sbjct: 177 LYYIR----EYFAVIKSFL 191


>gi|52142423|ref|YP_084406.1| hypothetical protein BCZK2819 [Bacillus cereus E33L]
 gi|206974549|ref|ZP_03235465.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|222096575|ref|YP_002530632.1| epih/gdmh-related protein [Bacillus cereus Q1]
 gi|51975892|gb|AAU17442.1| conserved hypothetical protein [Bacillus cereus E33L]
 gi|206747192|gb|EDZ58583.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|221240633|gb|ACM13343.1| EpiH/GdmH-related protein [Bacillus cereus Q1]
          Length = 210

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|217960516|ref|YP_002339078.1| hypothetical protein BCAH187_A3129 [Bacillus cereus AH187]
 gi|217066516|gb|ACJ80766.1| conserved hypothetical protein [Bacillus cereus AH187]
          Length = 210

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|148380856|ref|YP_001255397.1| hypothetical protein CBO2900 [Clostridium botulinum A str. ATCC
           3502]
 gi|153931082|ref|YP_001385163.1| hypothetical protein CLB_2864 [Clostridium botulinum A str. ATCC
           19397]
 gi|153935289|ref|YP_001388632.1| hypothetical protein CLC_2797 [Clostridium botulinum A str. Hall]
 gi|148290340|emb|CAL84464.1| putative exported protein [Clostridium botulinum A str. ATCC 3502]
 gi|152927126|gb|ABS32626.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           19397]
 gi|152931203|gb|ABS36702.1| conserved hypothetical protein [Clostridium botulinum A str. Hall]
          Length = 197

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 33  DHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
                 +I++L  +            R++    L  +  G+ I +SG      ++S+   
Sbjct: 39  QPQKSDSIIILGCKVKGNDPTPFLKRRLDEGLRLYNDGYGKYIIVSGAKGPGENISEAEA 98

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           +QK  +++ L +  I    K+ NT  N + +    E NN    +IV++ YH+ R  L  Q
Sbjct: 99  MQKYLVQKGLDKKFIIPEDKSRNTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQ 158

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           +    ++     +       +  +  ++ +  LL+ Y+K +
Sbjct: 159 K--EGIKASYSGVFVRSHMSHEIMGFLREIPALLVYYIKTM 197


>gi|269963112|ref|ZP_06177447.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832076|gb|EEZ86200.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 268

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 80/219 (36%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   +V  ++VL              
Sbjct: 40  FVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFLPVSGTVDYVMVLGAGHVVDDEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRTALMRLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHD 156
            A +T   A++A+A+ ++ +    ++VT   HM R   E       ++ IP P    + D
Sbjct: 160 DAKDTWEEARQAAAFVKQKDI---VLVTSASHMKRALYEFNAA--GIKPIPAPTNFMAID 214

Query: 157 LEENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
             E          R L        EYL  L   ++ ++ 
Sbjct: 215 DIEQPWQKYAPKARYLEQTELYWHEYLGGLWQKLRDNVG 253


>gi|284038771|ref|YP_003388701.1| hypothetical protein Slin_3912 [Spirosoma linguale DSM 74]
 gi|283818064|gb|ADB39902.1| protein of unknown function DUF218 [Spirosoma linguale DSM 74]
          Length = 222

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 46/152 (30%), Gaps = 13/152 (8%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGV-------HHSVSKDI 78
                       AI+VL    +R+ ER  EL        +  SG          +  +  
Sbjct: 18  YHHTNHPLTKADAILVLCSHDLRVAERGAELFLEGWAPLLIFSGGLGVITRFMWTEPEAD 77

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMPRTFL 136
           +  +I     +    I I  ++ NT  N Q       +        ++V   Y   R+F 
Sbjct: 78  MFARIAQDMGVPAEHILIENRSSNTGENVQFTRQLLAERKLEIDKFIVVQKPYMERRSFA 137

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             +++    Q I   + S     +  +     
Sbjct: 138 TFRKVWPEKQVI---VTSPQDSFDDYLSTYSN 166


>gi|125974276|ref|YP_001038186.1| hypothetical protein Cthe_1772 [Clostridium thermocellum ATCC
           27405]
 gi|281418329|ref|ZP_06249349.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|125714501|gb|ABN52993.1| protein of unknown function DUF218 [Clostridium thermocellum ATCC
           27405]
 gi|281409731|gb|EFB39989.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
          Length = 262

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 68/173 (39%), Gaps = 24/173 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVK-QMHIPDHPSVSAIVVLTGE----------PIR 49
           +R  ++G  +    F   F+  +  +        +  V  +V+L               R
Sbjct: 70  LRRLFFGALIA---FAGSFVLILGLIFASSDTDKNVEVDYLVILGAGLKGDRITPTFQYR 126

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           +++  E L      K+ ++G       +++   +++  +   + E  I +  +A +T  N
Sbjct: 127 LDKGVEYLRANPELKVVVTGGQGPGEDLTEAEAMKRYLVSHGIDEDRIIMEDRATSTNEN 186

Query: 107 AQEASAWAEK---NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
            +  +   ++    + + ++IVT+D+HM R  +  +       F PY I +  
Sbjct: 187 MKYTAEVLKQLTGRSDYRIMIVTNDFHMFRAKILARHNG----FTPYGITAPT 235


>gi|229197269|ref|ZP_04324000.1| hypothetical protein bcere0001_28180 [Bacillus cereus m1293]
 gi|228586228|gb|EEK44315.1| hypothetical protein bcere0001_28180 [Bacillus cereus m1293]
          Length = 219

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + +  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKDEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGVENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|170755560|ref|YP_001782537.1| hypothetical protein CLD_1642 [Clostridium botulinum B1 str. Okra]
 gi|169120772|gb|ACA44608.1| conserved hypothetical protein [Clostridium botulinum B1 str. Okra]
          Length = 197

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 68/161 (42%), Gaps = 15/161 (9%)

Query: 33  DHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
                 +I++L  +            R++    L     G+ I +SG      ++S+   
Sbjct: 39  QPQKSDSIIILGCKVKGNDPTPFLKRRLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEA 98

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           +QK  +++ L +  I +  K+ NT  N + +    E NN    +IV++ YH+ R+ L  Q
Sbjct: 99  MQKYLVQKGLDKKFIILEDKSRNTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRSELLCQ 158

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           +    ++     +       +  +  ++ +  LL+ Y+K +
Sbjct: 159 KE--GIKASYSGVFVRSHMSHEIMGFLREIPALLVYYIKTM 197


>gi|317153120|ref|YP_004121168.1| hypothetical protein Daes_1408 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943371|gb|ADU62422.1| protein of unknown function DUF218 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 218

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 61/211 (28%), Gaps = 20/211 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHI-PDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           +        LI   +G    I     M +         I+ L G+  R+ +A EL     
Sbjct: 8   FLRLVGAATLIGLAVGIALLIGAGYWMRVNDAPRQADYIIPLAGDSGRLIKAAELYHQGF 67

Query: 62  GEKIFIS-----------------GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
              I +S                 G  +    +  ++ + +    A      GY  ++T 
Sbjct: 68  APVILLSNSVELPVTGLDRLRWEIGFPNLDRDEYHMRLLTVLGAQASVAGSFGYGHVSTV 127

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
             A+    + +      +L+VT   H  R  +  + I    +             +    
Sbjct: 128 EEAEALREYLKGKPA-RLLLVTSPTHARRAKMIFEDILPHCEITMVATDEGGFGTD-WWK 185

Query: 165 KIKILRVLLIEYLKILLLSIQLSLSTQTASQ 195
                + L++E+ K     +     +  +  
Sbjct: 186 DQYAAQNLVLEFAKTAHYMLGGVFRSTDSEP 216


>gi|328463014|gb|EGF34808.1| hypothetical protein AAULH_13826 [Lactobacillus helveticus MTCC
           5463]
          Length = 222

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 73/200 (36%), Gaps = 29/200 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
           + W  +   +       +  +     +     P +  +VVL               RI R
Sbjct: 22  FLWLVIIYLVTIM---MMYTLTAWINLINWHVPHLDYVVVLGAGIMGKTITPLLAARITR 78

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             E+ +   G K+ +SG       + +   + +  I   + +  I I  K+  T  N + 
Sbjct: 79  GIEIYQKNPGSKLIMSGGQGPGEDILEAEAMAEYAINLGIPKEDIIIENKSRTTNENLRF 138

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           + A  + N      IVT+ YH+ R  +  +R    +Q I Y   +         F +   
Sbjct: 139 SYALMKPN--SKFCIVTNSYHVYRALVLAKRQ--GLQCIGYGAKTK------WYFTLNAF 188

Query: 170 RVLLIEYLKILLLSIQLSLS 189
              + E++  L+++ ++ ++
Sbjct: 189 ---VREFIAYLVITKRIQIT 205


>gi|163939519|ref|YP_001644403.1| hypothetical protein BcerKBAB4_1530 [Bacillus weihenstephanensis
           KBAB4]
 gi|163861716|gb|ABY42775.1| protein of unknown function DUF218 [Bacillus weihenstephanensis
           KBAB4]
          Length = 194

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 80/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           ++Y    + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 9   IKYILVVIMICAVY--AGFLQY-NIYKHGHMNAIDDADYIIVLGSKVNGTKPSYSLQYRI 65

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L+        +SG       +++ + +++  ++Q++AE  I +  K+ +T+ N 
Sbjct: 66  DKAAEYLKLHDKTIAIVSGGQGKGEDITEALAMKQGLMKQNIAEDRIIMEDKSTSTDENI 125

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + +       N    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 126 KFSKPLI-PANMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 178

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 179 -----VREYLAITQYWFMNRI 194


>gi|65320363|ref|ZP_00393322.1| COG1434: Uncharacterized conserved protein [Bacillus anthracis str.
           A2012]
 gi|228915677|ref|ZP_04079263.1| hypothetical protein bthur0012_28950 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228928153|ref|ZP_04091197.1| hypothetical protein bthur0010_28550 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228934353|ref|ZP_04097192.1| hypothetical protein bthur0009_28120 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228946697|ref|ZP_04109005.1| hypothetical protein bthur0007_28350 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229046787|ref|ZP_04192429.1| hypothetical protein bcere0027_28050 [Bacillus cereus AH676]
 gi|229092098|ref|ZP_04223281.1| hypothetical protein bcere0021_28900 [Bacillus cereus Rock3-42]
 gi|229110541|ref|ZP_04240111.1| hypothetical protein bcere0018_27940 [Bacillus cereus Rock1-15]
 gi|229122649|ref|ZP_04251860.1| hypothetical protein bcere0016_29430 [Bacillus cereus 95/8201]
 gi|229128413|ref|ZP_04257394.1| hypothetical protein bcere0015_28580 [Bacillus cereus BDRD-Cer4]
 gi|229145685|ref|ZP_04274067.1| hypothetical protein bcere0012_28360 [Bacillus cereus BDRD-ST24]
 gi|229151285|ref|ZP_04279491.1| hypothetical protein bcere0011_28320 [Bacillus cereus m1550]
 gi|229185305|ref|ZP_04312489.1| hypothetical protein bcere0004_28590 [Bacillus cereus BGSC 6E1]
 gi|228598225|gb|EEK55861.1| hypothetical protein bcere0004_28590 [Bacillus cereus BGSC 6E1]
 gi|228632285|gb|EEK88908.1| hypothetical protein bcere0011_28320 [Bacillus cereus m1550]
 gi|228637775|gb|EEK94223.1| hypothetical protein bcere0012_28360 [Bacillus cereus BDRD-ST24]
 gi|228655272|gb|EEL11129.1| hypothetical protein bcere0015_28580 [Bacillus cereus BDRD-Cer4]
 gi|228660901|gb|EEL16530.1| hypothetical protein bcere0016_29430 [Bacillus cereus 95/8201]
 gi|228673025|gb|EEL28299.1| hypothetical protein bcere0018_27940 [Bacillus cereus Rock1-15]
 gi|228691263|gb|EEL45026.1| hypothetical protein bcere0021_28900 [Bacillus cereus Rock3-42]
 gi|228724550|gb|EEL75865.1| hypothetical protein bcere0027_28050 [Bacillus cereus AH676]
 gi|228812994|gb|EEM59307.1| hypothetical protein bthur0007_28350 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228825521|gb|EEM71315.1| hypothetical protein bthur0009_28120 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228831570|gb|EEM77163.1| hypothetical protein bthur0010_28550 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228843963|gb|EEM89026.1| hypothetical protein bthur0012_28950 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 219

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKQVGIENGIQTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|75764443|ref|ZP_00743940.1| EpiH/GdmH-related protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228901618|ref|ZP_04065796.1| hypothetical protein bthur0014_28070 [Bacillus thuringiensis IBL
           4222]
 gi|228908852|ref|ZP_04072684.1| hypothetical protein bthur0013_30090 [Bacillus thuringiensis IBL
           200]
 gi|74488069|gb|EAO51788.1| EpiH/GdmH-related protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228850862|gb|EEM95684.1| hypothetical protein bthur0013_30090 [Bacillus thuringiensis IBL
           200]
 gi|228858030|gb|EEN02512.1| hypothetical protein bthur0014_28070 [Bacillus thuringiensis IBL
           4222]
          Length = 219

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 37/193 (19%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L  N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYRNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N  H   IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKQVGIENGIHTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|229030771|ref|ZP_04186797.1| hypothetical protein bcere0028_28350 [Bacillus cereus AH1271]
 gi|228730533|gb|EEL81487.1| hypothetical protein bcere0028_28350 [Bacillus cereus AH1271]
          Length = 219

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTNDGVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + +  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKDEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|288574503|ref|ZP_06392860.1| protein of unknown function DUF218 [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570244|gb|EFC91801.1| protein of unknown function DUF218 [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 270

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 68/203 (33%), Gaps = 25/203 (12%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE---------------PIRI 50
             L    +      +     + +  +P    +  +++L+G                  R+
Sbjct: 51  VFLLSLSLPVTSHLLLRQVEIYRKELPPEGPIPVVMILSGGFTRKNSGKTEPGPFTTQRL 110

Query: 51  ERAFELLENQIGEKIFISGVHHSVSKDILLQ--KIPIRQDLAECCIDIGYKALNTEGNAQ 108
                L     G  I +SG       + + +  +  IR+   +  I +   +  T  N  
Sbjct: 111 IEGASLARR-KGYPILLSGGLSYDKSESIARSMERSIRKWGYKGEIMLEENSRTTWENMT 169

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI----ISHDLEENSSIF 164
            +++   +     +++VT+ +HM R+    ++    ++  PY I       D +    I 
Sbjct: 170 YSASILRRKGIDRIILVTNSFHMKRSLWMAKKAMPDIEVYPYAIGSLADDMDSDPLKWIP 229

Query: 165 KIKILR---VLLIEYLKILLLSI 184
               LR   +   E + + +  I
Sbjct: 230 TAGALRDSSLAWKEIVGLTVYRI 252


>gi|126463807|ref|YP_001044920.1| hypothetical protein Rsph17029_3048 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105618|gb|ABN78148.1| protein of unknown function DUF218 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 280

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 54/156 (34%), Gaps = 11/156 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCIDI 96
            +T    R      L       ++  +G         + +  + ++I +   +    + +
Sbjct: 116 AVTEAGDRYLATIALARRFPEARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLIL 175

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++ NT  NA+ A A          L+VT  +HMPR+             +P+P     
Sbjct: 176 EGQSRNTAENARFAKALVANQGQGSWLLVTSAFHMPRSVETFCAAG-WQNLVPWPTDYRT 234

Query: 157 --LEENSSI---FKIKILRVLLIEYLKILLLSIQLS 187
             L +         + +L V + E++ IL   +   
Sbjct: 235 ASLRDGIGWDLARNLDLLNVAVREWIGILAYRVTGR 270


>gi|229173740|ref|ZP_04301282.1| hypothetical protein bcere0006_28400 [Bacillus cereus MM3]
 gi|228609839|gb|EEK67119.1| hypothetical protein bcere0006_28400 [Bacillus cereus MM3]
          Length = 219

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTNDGVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|206889829|ref|YP_002248307.1| hypothetical protein THEYE_A0462 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741767|gb|ACI20824.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 235

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 70/204 (34%), Gaps = 25/204 (12%)

Query: 1   MRYFWYGLFVCLIFFIM----GFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY  +   + +    +      + +                AIV+L G           
Sbjct: 35  IRYLAFFSALLVYLISIEPVKDLLLYPLEKSYSVSEKLD-ADAIVILGGGVYSWASFPED 93

Query: 49  ---RIERAFELLENQIGEKIFISG-VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
              R+   + +        I   G V   +S    +  +     + +  I    K+ +T 
Sbjct: 94  SSNRLFTGYLVYRKTKLPIIVSGGAVEGKISDSAAMAAMLKEFGVEDSKIIEENKSRDTA 153

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---SHDLEENS 161
            NA   +   ++ +F  V++VT  YHM R     ++    ++ +PYP     S+     S
Sbjct: 154 QNALYVAKICKEKSFKKVILVTSAYHMKRAVKFFKQA--GLEVLPYPADFKQSNHYNIYS 211

Query: 162 SIFKIKILRV---LLIEYLKILLL 182
            + K     +    + E++ +++ 
Sbjct: 212 FLPKFGNFALSSKAIREHIALIVY 235


>gi|47564233|ref|ZP_00235278.1| EpiH/GdmH-related protein [Bacillus cereus G9241]
 gi|47558385|gb|EAL16708.1| EpiH/GdmH-related protein [Bacillus cereus G9241]
          Length = 210

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RVFQVFLLMICSAILYVSYAAYDIWSYRFKTDDSVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|226334849|ref|YP_002784521.1| hypothetical membrane protein [Rhodococcus opacus B4]
 gi|226246069|dbj|BAH56169.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 190

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 57/167 (34%), Gaps = 12/167 (7%)

Query: 1   MRYFWYGLFVCLIFFI----MGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-RIERAFE 55
           MR     + V  I        GFI +     +  + D  SV AIVVL GE   R E AF+
Sbjct: 1   MRKIVAAMIVATILICCTAGAGFIVY----NRSAVDDIRSVDAIVVLGGERDGREEFAFD 56

Query: 56  LLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           L    +   + +S  +      +  +           CI        T G A      A 
Sbjct: 57  LARQGLSRNVVLSDPYGPYGTKLAARCETRDPRFTVRCI--PPNPSTTLGEAVFTRNLAT 114

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
            N ++ +++V+  YH+PR      R       +  P+          
Sbjct: 115 ANGWNSLMVVSWRYHLPRARYIFSRCLDGRDVLMVPV-PGTYSVARW 160


>gi|256003507|ref|ZP_05428497.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|255992531|gb|EEU02623.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|316941425|gb|ADU75459.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           1313]
          Length = 262

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 67/173 (38%), Gaps = 24/173 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVK-QMHIPDHPSVSAIVVLTGE----------PIR 49
           +R  ++G  +    F   F+  +  +        +  V  +V+L               R
Sbjct: 70  LRRLFFGALIA---FAGSFVLILGLIFASSDTDKNVEVDYLVILGAGLKGDRITPTFQYR 126

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           +++  E L      K+ ++G       +++   +++  +   + E  I +  +A +T  N
Sbjct: 127 LDKGVEYLRANPELKVVVTGGQGPGEDLTEAEAMKRYLVSHGIDEDRIIMEDRATSTNEN 186

Query: 107 AQEASAWAEK---NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
            +  +   ++    + + ++IVT+D+HM R  +  +       F PY I    
Sbjct: 187 MKYTAEVLKQLTGRSDYRIMIVTNDFHMFRAKILARHNG----FTPYGITVPT 235


>gi|156973875|ref|YP_001444782.1| hypothetical protein VIBHAR_01585 [Vibrio harveyi ATCC BAA-1116]
 gi|156525469|gb|ABU70555.1| hypothetical protein VIBHAR_01585 [Vibrio harveyi ATCC BAA-1116]
          Length = 268

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 80/219 (36%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   +V  ++VL              
Sbjct: 40  FVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFLPVSGTVDYVMVLGNGHVVDNEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRTALMRLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHD 156
            A +T   A++A+A+ ++ +    ++VT   HM R   E       ++ IP P    + D
Sbjct: 160 DAKDTWEEARQAAAFVKQKDI---VLVTSASHMKRALYEFNAA--GIKPIPAPTNFMAID 214

Query: 157 LEENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
             E          R L        EYL  L   ++ ++ 
Sbjct: 215 DIEQPWQKYAPKARYLEQTELYWYEYLGGLWQKLRDNVG 253


>gi|257469971|ref|ZP_05634063.1| hypothetical protein FulcA4_11568 [Fusobacterium ulcerans ATCC
           49185]
          Length = 252

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 53/162 (32%), Gaps = 9/162 (5%)

Query: 34  HPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAE 91
             S    V   G   RI +  +       +     G      +    + ++  +   +  
Sbjct: 91  PNSAGGNVPSEGANARIIKTAQFYNKYPKKIYISGGSPLQNKESESSVYKRELVALGIPS 150

Query: 92  CCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             I I  K+ NT  NA       E +     +++T  +H+PR+          + F P P
Sbjct: 151 ENIVIEEKSRNTRENALYIRKMMEGSKEKKAVLITSAFHIPRSVKTFDDGEGGLIFYPAP 210

Query: 152 II-------SHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
                     +  +        K L +LL EY+ +L   I+ 
Sbjct: 211 CDFMAKKEAENFFDYIPEYTNFKKLGILLKEYIGMLYYRIRY 252


>gi|228921749|ref|ZP_04085066.1| hypothetical protein bthur0011_27460 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228953412|ref|ZP_04115458.1| hypothetical protein bthur0006_27920 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|229070559|ref|ZP_04203799.1| hypothetical protein bcere0025_27430 [Bacillus cereus F65185]
 gi|229080263|ref|ZP_04212790.1| hypothetical protein bcere0023_29110 [Bacillus cereus Rock4-2]
 gi|229179370|ref|ZP_04306724.1| hypothetical protein bcere0005_27200 [Bacillus cereus 172560W]
 gi|229191184|ref|ZP_04318173.1| hypothetical protein bcere0002_28480 [Bacillus cereus ATCC 10876]
 gi|228592334|gb|EEK50164.1| hypothetical protein bcere0002_28480 [Bacillus cereus ATCC 10876]
 gi|228604268|gb|EEK61735.1| hypothetical protein bcere0005_27200 [Bacillus cereus 172560W]
 gi|228703158|gb|EEL55617.1| hypothetical protein bcere0023_29110 [Bacillus cereus Rock4-2]
 gi|228712574|gb|EEL64509.1| hypothetical protein bcere0025_27430 [Bacillus cereus F65185]
 gi|228806309|gb|EEM52882.1| hypothetical protein bthur0006_27920 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228837961|gb|EEM83285.1| hypothetical protein bthur0011_27460 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 219

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKQVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|108762577|ref|YP_635041.1| putative SanA protein [Myxococcus xanthus DK 1622]
 gi|108466457|gb|ABF91642.1| putative SanA protein [Myxococcus xanthus DK 1622]
          Length = 225

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/198 (12%), Positives = 59/198 (29%), Gaps = 27/198 (13%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIRIERAFELLENQIGEKIFI 67
            +      + + +   P     +V                 R++ A  L +    + + +
Sbjct: 41  LVRLSYQDRIVPLEQAPQAPVALVFGAGLARGAVPSPVLAQRLDAAIALWQQGKVQTVLV 100

Query: 68  SGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           SG        +   +++  +   + E  I      L+T  +   A+           ++V
Sbjct: 101 SGDQTKPFHHETRAMRRYLVEHGVPESAILGDEAGLSTYDSCLRAATVF---GAKRAVLV 157

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
           T  +H+ R       +        + + + +             R  + E L  +L    
Sbjct: 158 TQRFHLTRALFIANSVG----IDAWGVAADEGRSTPW-------RYQVRETLSRVLALAM 206

Query: 186 LSLSTQTASQFFITLIEE 203
           + L  + A     T++ E
Sbjct: 207 VMLEVEPAYPSGRTVLPE 224


>gi|51474043|ref|YP_067800.1| hypothetical protein RT0866 [Rickettsia typhi str. Wilmington]
 gi|51460355|gb|AAU04318.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 174

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 71/157 (45%), Gaps = 7/157 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           ++ F   + V    ++ GF  ++  +    +  +   +AI+V  G   +IE    LL+  
Sbjct: 2   IKKFLLIILVIFTLWVGGFCYYLYLINSYKLNSNT-TNAIIVFAGGGHKIETCIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL +  +   + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFITGIESAEHFKNLLMEHNV---IEQQVILAPNKIMSEEDNIKKAIDFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIIS 154
            +++V H+Y++P    +LQ+       V  +PYP+ S
Sbjct: 118 FIILVEHNYNIPFMLNKLQKAIPSSNNVYIVPYPVFS 154


>gi|228940198|ref|ZP_04102769.1| hypothetical protein bthur0008_28470 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228973089|ref|ZP_04133681.1| hypothetical protein bthur0003_28520 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228979696|ref|ZP_04140020.1| hypothetical protein bthur0002_28700 [Bacillus thuringiensis Bt407]
 gi|228780009|gb|EEM28252.1| hypothetical protein bthur0002_28700 [Bacillus thuringiensis Bt407]
 gi|228786648|gb|EEM34635.1| hypothetical protein bthur0003_28520 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228819324|gb|EEM65378.1| hypothetical protein bthur0008_28470 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 219

 Score = 74.5 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 64/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L  N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYRNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKQVGIENGIQTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|30021189|ref|NP_832820.1| EpiH/GdmH-related protein [Bacillus cereus ATCC 14579]
 gi|30263055|ref|NP_845432.1| hypothetical protein BA_3106 [Bacillus anthracis str. Ames]
 gi|47528398|ref|YP_019747.1| hypothetical protein GBAA_3106 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49185896|ref|YP_029148.1| hypothetical protein BAS2890 [Bacillus anthracis str. Sterne]
 gi|49479533|ref|YP_037182.1| hypothetical protein BT9727_2858 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|165868915|ref|ZP_02213575.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167632539|ref|ZP_02390866.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|167637429|ref|ZP_02395709.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170685113|ref|ZP_02876338.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170704915|ref|ZP_02895380.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|177650000|ref|ZP_02933001.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190564854|ref|ZP_03017775.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196032544|ref|ZP_03099958.1| conserved hypothetical protein [Bacillus cereus W]
 gi|196038177|ref|ZP_03105487.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|196042737|ref|ZP_03109976.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|218232485|ref|YP_002367802.1| hypothetical protein BCB4264_A3095 [Bacillus cereus B4264]
 gi|218904226|ref|YP_002452060.1| hypothetical protein BCAH820_3110 [Bacillus cereus AH820]
 gi|225865058|ref|YP_002750436.1| hypothetical protein BCA_3166 [Bacillus cereus 03BB102]
 gi|227814096|ref|YP_002814105.1| hypothetical protein BAMEG_1503 [Bacillus anthracis str. CDC 684]
 gi|229600823|ref|YP_002867325.1| hypothetical protein BAA_3156 [Bacillus anthracis str. A0248]
 gi|254685645|ref|ZP_05149504.1| hypothetical protein BantC_17565 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254723056|ref|ZP_05184844.1| hypothetical protein BantA1_11354 [Bacillus anthracis str. A1055]
 gi|254738109|ref|ZP_05195812.1| hypothetical protein BantWNA_23369 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254742718|ref|ZP_05200403.1| hypothetical protein BantKB_17177 [Bacillus anthracis str. Kruger
           B]
 gi|254752426|ref|ZP_05204462.1| hypothetical protein BantV_08161 [Bacillus anthracis str. Vollum]
 gi|254760943|ref|ZP_05212967.1| hypothetical protein BantA9_21746 [Bacillus anthracis str.
           Australia 94]
 gi|296503616|ref|YP_003665316.1| EpiH/GdmH-related protein [Bacillus thuringiensis BMB171]
 gi|300118019|ref|ZP_07055768.1| hypothetical protein BCSJ1_08918 [Bacillus cereus SJ1]
 gi|301054601|ref|YP_003792812.1| hypothetical protein BACI_c30540 [Bacillus anthracis CI]
 gi|29896743|gb|AAP10021.1| EpiH/GdmH-related protein [Bacillus cereus ATCC 14579]
 gi|30257688|gb|AAP26918.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gi|47503546|gb|AAT32222.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49179823|gb|AAT55199.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
 gi|49331089|gb|AAT61735.1| conserved hypothetical protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|164715641|gb|EDR21158.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167514936|gb|EDR90302.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|167532837|gb|EDR95473.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|170129770|gb|EDS98632.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170671373|gb|EDT22111.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|172083952|gb|EDT69011.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190564171|gb|EDV18135.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|195995295|gb|EDX59249.1| conserved hypothetical protein [Bacillus cereus W]
 gi|196026221|gb|EDX64889.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|196031447|gb|EDX70044.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|218160442|gb|ACK60434.1| conserved hypothetical protein [Bacillus cereus B4264]
 gi|218536393|gb|ACK88791.1| conserved hypothetical protein [Bacillus cereus AH820]
 gi|225786516|gb|ACO26733.1| conserved hypothetical protein [Bacillus cereus 03BB102]
 gi|227003379|gb|ACP13122.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|229265231|gb|ACQ46868.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
 gi|296324668|gb|ADH07596.1| EpiH/GdmH-related protein [Bacillus thuringiensis BMB171]
 gi|298724604|gb|EFI65297.1| hypothetical protein BCSJ1_08918 [Bacillus cereus SJ1]
 gi|300376770|gb|ADK05674.1| conserved hypothetical protein [Bacillus cereus biovar anthracis
           str. CI]
          Length = 210

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIQTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|218898164|ref|YP_002446575.1| hypothetical protein BCG9842_B2141 [Bacillus cereus G9842]
 gi|218541554|gb|ACK93948.1| conserved hypothetical protein [Bacillus cereus G9842]
          Length = 210

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 37/193 (19%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L  N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYRNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N  H   IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIHTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|157826367|ref|YP_001494087.1| hypothetical protein A1C_06780 [Rickettsia akari str. Hartford]
 gi|157800325|gb|ABV75579.1| hypothetical protein A1C_06780 [Rickettsia akari str. Hartford]
          Length = 174

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 66/155 (42%), Gaps = 7/155 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      ++ G   F+  +       +   +AI+V  G   +IE    LL+  
Sbjct: 2   IRKFLLTILAIFALWVGGIGYFLYLINSYKFNSNT-TNAIIVFAGGGHKIETGIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI G+  +     LL++  +   + +  I    K ++ E N ++A  +    N  
Sbjct: 61  YAPILFIIGIESTEQLRNLLKERNV---IEQQVILAPNKIMSEEDNIKKAVDFIVTYNLA 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPI 152
            V++V ++Y+MP    +L++       +  + YP+
Sbjct: 118 SVILVEYNYNMPFMLNKLEKEIPSSNNIYIVQYPV 152


>gi|77465405|ref|YP_354908.1| hypothetical protein RSP_3403 [Rhodobacter sphaeroides 2.4.1]
 gi|77389823|gb|ABA81007.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 280

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 53/156 (33%), Gaps = 11/156 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCIDI 96
            +T    R      L       ++  +G         + +  + ++I +   +    + +
Sbjct: 116 AVTEAGDRYLATIALARRFPEARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLIL 175

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++ NT  NA+ A A          L+VT  +HMPR              +P+P     
Sbjct: 176 EGQSRNTAENARFAKALVANQGQGSWLLVTSAFHMPRAVETFCAAG-WQDLVPWPTDYRT 234

Query: 157 --LEENSSI---FKIKILRVLLIEYLKILLLSIQLS 187
             L +         + +L V + E++ IL   +   
Sbjct: 235 ASLRDGIGWDLARNLDLLNVAVREWIGILAYRVTGR 270


>gi|332561062|ref|ZP_08415380.1| hypothetical protein RSWS8N_18489 [Rhodobacter sphaeroides WS8N]
 gi|332274860|gb|EGJ20176.1| hypothetical protein RSWS8N_18489 [Rhodobacter sphaeroides WS8N]
          Length = 267

 Score = 74.5 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 53/156 (33%), Gaps = 11/156 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCIDI 96
            +T    R      L       ++  +G         + +  + ++I +   +    + +
Sbjct: 103 AVTEAGDRYLATIALARRFPEARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLIL 162

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++ NT  NA+ A A          L+VT  +HMPR              +P+P     
Sbjct: 163 EGQSRNTAENARFAKALVANQGQGSWLLVTSAFHMPRAVETFCAAG-WQDLVPWPTDYRT 221

Query: 157 --LEENSSI---FKIKILRVLLIEYLKILLLSIQLS 187
             L +         + +L V + E++ IL   +   
Sbjct: 222 ASLRDGIGWDLARNLDLLNVAVREWIGILAYRVTGR 257


>gi|309775431|ref|ZP_07670434.1| putative periplasmic protein [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916820|gb|EFP62557.1| putative periplasmic protein [Erysipelotrichaceae bacterium 3_1_53]
          Length = 193

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 54/153 (35%), Gaps = 13/153 (8%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAF 54
               + +       I +  + K           A +VL                R++ A 
Sbjct: 4   LAAILIVFLIAANLILYHYFPKPKKPKAGRVYDAAIVLGSPAKEDGSLSRLQKTRMDAAI 63

Query: 55  ELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L      ++I ISG    +  ++  ++    I   +A+  + +  KA NT  N + A  
Sbjct: 64  RLYRQHTVQRIIISGGSVRNDYAEAEIMAAYAITCGIAKEVLLLERKARNTYENLKYAKE 123

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV 145
               + +H V++VT  +H+ R    +++     
Sbjct: 124 ICIAHEWHSVVVVTSSFHVRRASYMVRKFFDDF 156


>gi|307150072|ref|YP_003885456.1| hypothetical protein Cyan7822_0130 [Cyanothece sp. PCC 7822]
 gi|306980300|gb|ADN12181.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7822]
          Length = 278

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 69/240 (28%), Gaps = 60/240 (25%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQM-----HIPDHPSVSAIVVLTGEP-------------- 47
                +I  + G       + Q         + P+  AI+VL G                
Sbjct: 41  ITLALIIILVAGNEWVSNGLIQSLEWQNIPQNIPNAEAIIVLGGATKSASFPRPMVDLNE 100

Query: 48  --IRIERAFELLENQIGEKIFISGVHHSV---------------------SKDILLQKIP 84
              R+  A +L ++     I  SG                           +   +  + 
Sbjct: 101 QGDRVVYAAKLYQDHKAPLIIASGGRIKWGGQQVTDKLSGVGNSFRTQQQPESADIATLL 160

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST 144
               +    I     +LNT  N         +     VL+VT   HMPR+ L  ++    
Sbjct: 161 TLMGVPPSAILQDSTSLNTYENVVNVKKILNEKGIKRVLLVTSALHMPRSLLIFKKQ--G 218

Query: 145 VQFIPYP----------------IISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
           +  IP P                + +  L       +++     L EY+ +++  ++  L
Sbjct: 219 IDVIPAPTDFLVSQPELEQSDLSVETIMLNLIPDAGRLEGTTKALKEYIGMVIYRLKGWL 278


>gi|110633611|ref|YP_673819.1| hypothetical protein Meso_1258 [Mesorhizobium sp. BNC1]
 gi|110284595|gb|ABG62654.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 268

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 65/207 (31%), Gaps = 31/207 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPI 48
             L V     +          +         ++ IVVL                      
Sbjct: 50  ILLAVIGWSPLGSAALLALENRFPRPAISGPIAGIVVLGGEIDTDVSAERKTIALTDAAE 109

Query: 49  RIERAFELLENQIGEKIFISGVHHSV------SKDILLQKIPIRQDLAECCIDIGYKALN 102
           R+ +  E        +I +SG  + +      ++  L +++ ++  +    I++  ++ N
Sbjct: 110 RLTKTAEFNRLYPNARILLSGGINDLLITHDRTEAALARELLVKIGVPADRIELEERSRN 169

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           T  NA E+ A A        L+VT  +HMPR     +        +PYP+         S
Sbjct: 170 TCENAIESKAVAAPKPGETWLLVTSAFHMPRAVGCFRAA--GFPVLPYPVDYLARRSALS 227

Query: 163 IFKIKILR------VLLIEYLKILLLS 183
                +        +   E+L +    
Sbjct: 228 SLAPSVAAGLYLTDIAAHEWLGLAAYY 254


>gi|328676916|gb|AEB27786.1| putative exported protein [Francisella cf. novicida Fx1]
          Length = 231

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 67/205 (32%), Gaps = 21/205 (10%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   L +       G     ++     +  +I    +   I++L             
Sbjct: 26  LRYFIVALTIVYYLIANGVLGTILALPLKSESTNIKACENTKGIILLGAGINDAFGKLEP 85

Query: 47  ----PIRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G      +S+  +   +  +  + +  I +   +
Sbjct: 86  ALSAYDRILKTAEVYHQYPQQIIISGGAPFGEKLSEAEIYADVLDKLGIPKSKIILEKNS 145

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NA+        +   + L+    ++  R  +   +       I       +++  
Sbjct: 146 KNTYQNAEFIKKILMNDKNTYCLVTGGIHY-KRAKIIFDKFAINTISIASSKFVPNIKIL 204

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQ 185
            + +   I + ++ EYL I+ + + 
Sbjct: 205 PNSYNFYITQNIVHEYLGIIRIYLS 229


>gi|317489670|ref|ZP_07948174.1| DUF218 domain-containing protein [Eggerthella sp. 1_3_56FAA]
 gi|316911264|gb|EFV32869.1| DUF218 domain-containing protein [Eggerthella sp. 1_3_56FAA]
          Length = 218

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/221 (14%), Positives = 66/221 (29%), Gaps = 47/221 (21%)

Query: 1   MRYFWYGLFVCLIFFIMGFIS-----FIRYVKQMHIPDHP---SVSAIVVLTGE------ 46
           M+     +  C++  +  F +           ++  P         AIVVL         
Sbjct: 1   MKTMLGLMLGCMLVVVAVFAATNVATIATTKDRIVEPQSAVGFDADAIVVLGASVFADGT 60

Query: 47  -----PIRIERAFELLENQIGEKIFISGVHHSV--SKDILLQKIPIRQDLAECCIDIGYK 99
                  R++    L +  +  K+ +SG + +V  ++  +++   I Q +    I   + 
Sbjct: 61  PSGILRDRLDDGIALYKEGVAPKLIMSGDNSTVSYNEVQVMKDYAISQGVPSHDIFCDHA 120

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
             +T  +   A           +++ T  YH+ R           +      + S   + 
Sbjct: 121 GFSTYESMYRAKHVF---GAERIVVATQTYHLYRALY----AAQGLGLESLGVASDYHD- 172

Query: 160 NSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITL 200
                           Y K L   ++          FF TL
Sbjct: 173 ----------------YSKQLQYDLREI--PARTKDFFKTL 195


>gi|206969158|ref|ZP_03230113.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|206736199|gb|EDZ53357.1| conserved hypothetical protein [Bacillus cereus AH1134]
          Length = 210

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|326940847|gb|AEA16743.1| EpiH/GdmH-related protein [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 210

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 64/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 11  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L  N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 71  NHAISLYRNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIQTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 187

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 188 FFKELFS-YIGYV 199


>gi|291295513|ref|YP_003506911.1| hypothetical protein Mrub_1127 [Meiothermus ruber DSM 1279]
 gi|290470472|gb|ADD27891.1| protein of unknown function DUF218 [Meiothermus ruber DSM 1279]
          Length = 252

 Score = 74.5 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 34/214 (15%), Positives = 64/214 (29%), Gaps = 31/214 (14%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQ---MHIPDHPSVSAIVVLTGEPI---------- 48
           R    G  +C +       + +        +          IVVL G             
Sbjct: 43  RVLLGGGVLCALLVAAVVFTPLTRTLAEGLIVNEAPQKADLIVVLGGGMHCGAGELEASS 102

Query: 49  --RIERAFELLENQIGEKIFIS-------GVHHSVSKDILLQKIPIRQ-DLAECCIDIGY 98
             R+E+  EL       +I +S       G     S   +  +            I    
Sbjct: 103 LARLEKGLELWRAGYAPRITLSDTVGEIFGDARCPSLGRVAAQRVQALYGDEGPEILFLP 162

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
           +   T   A   +   +   +  VL+VT   H  R     +++   V      + S +  
Sbjct: 163 QMRTTRTEALAVAELVQARGWQRVLLVTTPAHSRRAAGAFRKLGLEV----LSVNSSEPR 218

Query: 159 ENSSIFKI----KILRVLLIEYLKILLLSIQLSL 188
            + ++       + L  L+ EYL +L+  ++  L
Sbjct: 219 FDRALAAPADRLQALTPLVREYLGLLVYRLRGWL 252


>gi|319638788|ref|ZP_07993547.1| periplasmic protein [Neisseria mucosa C102]
 gi|317400029|gb|EFV80691.1| periplasmic protein [Neisseria mucosa C102]
          Length = 218

 Score = 74.5 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 64/202 (31%), Gaps = 25/202 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFI----SFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+ +      +  + G        I       +P      A VVL             
Sbjct: 11  LRYYLFRGLALSVLLVCGIFLSGTWQIYRTGLQTLPKDVHADAAVVLGAAAWDKRPSPVF 70

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 71  RERINHAITLYQSHRVGKIIFTGGTPKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNT 130

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQFIPYPIISHDLEENSS 162
             N +        N    +++V+  YH+ R       +  S  QF   P    D      
Sbjct: 131 YENLRNIVPIMHANGVGSIIVVSDPYHLARAEEMAADLGLSDAQFSATPTTRFDERSKK- 189

Query: 163 IFKIKILRVLLIEYLKILLLSI 184
                  + L+ E   + L  I
Sbjct: 190 ------AKFLIQESYSLFLYRI 205


>gi|229488511|ref|ZP_04382377.1| integral membrane protein [Rhodococcus erythropolis SK121]
 gi|229324015|gb|EEN89770.1| integral membrane protein [Rhodococcus erythropolis SK121]
          Length = 235

 Score = 74.5 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 57/190 (30%), Gaps = 26/190 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------------R 49
           R+      +  + +    +               +  A VV+                 R
Sbjct: 25  RWVAGIAVLGAVVYAGSIVWISVASAGHTSDAADAPDAPVVIVLGAQIKDGKPMAFLKGR 84

Query: 50  IERAFELLENQIGEKIFISGVHHSVSKDILLQK--IPIRQDLAECCIDIGYKALNTEGNA 107
           ++ A EL+E    + + +SG  +  S D +       + Q +    I      L+T    
Sbjct: 85  LDAAVELVEAGKAKAVLVSGDANGGSGDEIAAMTNYLVEQGIDARRIVGDPYGLDTYDTC 144

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             A            LIVT  YH+PR     + +          I +  +  +       
Sbjct: 145 FRA---IHTYGVTKALIVTQGYHVPRAVALCRDVG---------IDADGVNSDCGCATPT 192

Query: 168 ILRVLLIEYL 177
           +++    E++
Sbjct: 193 LIKNAAREWV 202


>gi|170758739|ref|YP_001788223.1| hypothetical protein CLK_2294 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169405728|gb|ACA54139.1| conserved hypothetical protein [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 197

 Score = 74.5 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 33  DHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
                 +I++L  +            R++    L     G+ I +SG      ++S+   
Sbjct: 39  QPQKSDSIIILGCKVKGNDPTPFLKRRLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEA 98

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           ++K  +++ L +  I +  K+ NT  N + +    E NN    +IV++ YH+ R  L  Q
Sbjct: 99  MEKYLVQKGLDKKFIILEDKSRNTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQ 158

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           +    ++     +       +  +  ++ +  LL+ Y+K +
Sbjct: 159 KE--GIKASYSGVFVRSHMSHEIMGFLREIPALLVYYIKTM 197


>gi|37520492|ref|NP_923869.1| hypothetical protein glr0923 [Gloeobacter violaceus PCC 7421]
 gi|35211486|dbj|BAC88864.1| glr0923 [Gloeobacter violaceus PCC 7421]
          Length = 239

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 65/205 (31%), Gaps = 27/205 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVK------------QMHIPDHPSVSAIVVLTGE-- 46
           +R   + + + ++   +  + F                     P +    AIVVL     
Sbjct: 45  IRPLPWKIPISVLAIALLLVYFAAVSPPALALADAQLGDYPEAPSNLKADAIVVLGRGER 104

Query: 47  --PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
               R+E A  L       +IFISG +        +     R  L    +     +  T+
Sbjct: 105 LRHTRVELAARLWRAGRAPRIFISGRND----ADTMVADLRRMGLPAKAVAGEECSRTTQ 160

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            NA+  +          +L+VT   HM R+    +        +  P           + 
Sbjct: 161 ENAEFTARILRPAGVRTLLLVTDAPHMLRSLRTFKEAGFNSAAVTSPFPEK-------LS 213

Query: 165 KIKILRVLLIEYLKILLLSIQLSLS 189
           +++   +++ EYL +L       + 
Sbjct: 214 ELRERLIVVREYLGLLTYRWLGRIE 238


>gi|116249878|ref|YP_765716.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254526|emb|CAK05600.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 262

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 58/186 (31%), Gaps = 25/186 (13%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
           C+I    GF + +   +             +   G   R   A  L +     +I +SG 
Sbjct: 80  CMIVLGGGFENEVNTARHG-----------IEFNGGADRFIEALRLAQKFPQSRILVSGG 128

Query: 71  HH-----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
                          ++      +    +    ++  T  NA     +       + L++
Sbjct: 129 DGSISGIYEGDAAASERFFPLFGVGRDRLIEERQSRTTFENAVNTKEFLASQGLSNCLLI 188

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISH-------DLEENSSIFKIKILRVLLIEYLK 178
           T  +HMPR+    +++   +  +P+P            L+        + L   + E+  
Sbjct: 189 TSGFHMPRSVGIFRKL--GIDIVPWPTDYRTDGQVRLGLDFTQPSLNAQNLATAIREWYG 246

Query: 179 ILLLSI 184
           ++   +
Sbjct: 247 LVGYYL 252


>gi|221369405|ref|YP_002520501.1| hypothetical protein RSKD131_3568 [Rhodobacter sphaeroides KD131]
 gi|221162457|gb|ACM03428.1| Hypothetical Protein RSKD131_3568 [Rhodobacter sphaeroides KD131]
          Length = 267

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 52/156 (33%), Gaps = 11/156 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCIDI 96
            +T    R      L       ++  +G         + +  + ++I +   +    + +
Sbjct: 103 AVTEAGDRYLATIALARRFPEARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLIL 162

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++ NT  NA  A A          L+VT  +HMPR              +P+P     
Sbjct: 163 EGQSRNTAENAHFAKALVANQGQGSWLLVTSAFHMPRAVETFCAAG-WQDLVPWPTDYRT 221

Query: 157 --LEENSSI---FKIKILRVLLIEYLKILLLSIQLS 187
             L +         + +L V + E++ IL   +   
Sbjct: 222 ASLRDGIGWDLARNLDLLNVAVREWIGILAYRVTGR 257


>gi|251796623|ref|YP_003011354.1| hypothetical protein Pjdr2_2614 [Paenibacillus sp. JDR-2]
 gi|247544249|gb|ACT01268.1| protein of unknown function DUF218 [Paenibacillus sp. JDR-2]
          Length = 219

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/191 (14%), Positives = 62/191 (32%), Gaps = 23/191 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
             + GL +  +      +  I               A +VL               R++ 
Sbjct: 21  RLFVGLCLLGVLCCGYLLWLINS--YDDSKPIEQADAAIVLGASLWSDKPSPALKERLDF 78

Query: 53  AFELLENQIGEKIFISGVHHS----VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           A +L ++       +SG        +++   ++   + + +    + +   A +T  N  
Sbjct: 79  ADKLYKDGKVNMFILSGGLDRNGSKLTEAQGMKAYLLAKGIPADKMLLDNAARSTYENLL 138

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            +   A ++  + +L+VTHDYH PR     + ++         + +              
Sbjct: 139 NSKVIAAEHGLNKLLVVTHDYHAPRAMEMARYLDYEN------VTAAAFHSEVLSPFKNQ 192

Query: 169 LRVLLIEYLKI 179
            R +L  Y K 
Sbjct: 193 SREVLA-YAKW 202


>gi|153938260|ref|YP_001392181.1| hypothetical protein CLI_2956 [Clostridium botulinum F str.
           Langeland]
 gi|152934156|gb|ABS39654.1| conserved hypothetical protein [Clostridium botulinum F str.
           Langeland]
          Length = 197

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 33  DHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
                 +I++L  +            R++    L     G+ I +SG      ++S+   
Sbjct: 39  QPQKSDSIIILGCKVKGNDPTPFLKRRLDEGLRLYNEGYGKYIIVSGAKGPGENISEAEA 98

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           +QK  +++ L +  I +  K+ NT  N + +    E NN    +IV++ YH+ R  L  Q
Sbjct: 99  MQKYLVQKGLDKKFIILEDKSRNTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQ 158

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           +    ++     +       +  +  ++ +  LL+ Y+K +
Sbjct: 159 KE--GIRASYSGVFVRSHMSHEIMGFLREIPALLVYYIKTM 197


>gi|34499564|ref|NP_903779.1| hypothetical protein CV_4109 [Chromobacterium violaceum ATCC 12472]
 gi|34105415|gb|AAQ61770.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 199

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 64/197 (32%), Gaps = 18/197 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYV-KQMHIPDHPSVSAIVVLTGEPI----------R 49
           +R    G  + ++  ++GF      +       + P   A +VL               R
Sbjct: 4   LRLMLRGFLLAVLLVVLGFACVAWSIVDYGSGDEVPGADAALVLGAAAWGNKPSPVFRER 63

Query: 50  IERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           I  A +L ++     I  +G        ++  + ++   RQ +    + +  ++  T  N
Sbjct: 64  INHAVKLYQSGKVRWIVFTGGTPEPGYPAEADVGREFAARQGVPMTAMLVENQSRTTWQN 123

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
              A     +      L+V+   HM R  L    +   ++  P P  S      +S  + 
Sbjct: 124 LSNARDLGNQFGIRSYLLVSDPLHMRRAVLMAGDL--GLRAYPAPTQSSRFRTLASWSRF 181

Query: 167 KILRVLLIEYLKILLLS 183
                 L  Y+   +  
Sbjct: 182 LARETWL--YVGYRVFR 196


>gi|323704444|ref|ZP_08116023.1| protein of unknown function DUF218 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323536510|gb|EGB26282.1| protein of unknown function DUF218 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 194

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/195 (13%), Positives = 69/195 (35%), Gaps = 16/195 (8%)

Query: 1   MRYFW-YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIR 49
           M+        +     ++  I+ ++ +   +        AI++L               R
Sbjct: 1   MKLLIKITASLITFVVLLNIIAELQVIIFAYNAKPVKSDAIIILGCAVYGKNPSPFFKER 60

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           +  A  L +  +G+ I +SG       VS+    ++  ++  +    I    K+ +T  N
Sbjct: 61  LNEAIRLYKKGLGKYIIVSGGKGPGEDVSEAEAGKEYLLKNGIPYNTILKDDKSYSTLQN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
            + +    ++ +    +IV++ +H+ R  +  +     +      +             +
Sbjct: 121 LENSKKIMDEKSLKTAIIVSNKFHLKRASIIAKEA--GINASYSGVFVKRYFYEEVYGFL 178

Query: 167 KILRVLLIEYLKILL 181
           +    LL  Y ++L+
Sbjct: 179 REAPALLYMYFRMLI 193


>gi|148241215|ref|YP_001226372.1| hypothetical protein SynRCC307_0116 [Synechococcus sp. RCC307]
 gi|147849525|emb|CAK27019.1| Uncharacterised conserved membrane protein [Synechococcus sp.
           RCC307]
          Length = 265

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 65/201 (32%), Gaps = 39/201 (19%)

Query: 25  YVKQMHIPDHPSVSAIVVLTGEPI----------------RIERAFELLENQIGEKIFIS 68
               +     P   A++VL G                   R+     L        +  S
Sbjct: 65  QAASLTPKSLPEADAVLVLGGGIRPAPAKGQGVEVNEAGDRLLCGVRLWRQGKAPVLITS 124

Query: 69  GVH-------HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
           G             + +L Q++     +    + +  KA  T   AQ  +  A +  +  
Sbjct: 125 GARVSFTLNDPIAPEAVLSQQLAQELGVPASALLLNEKARTTAEEAQRINQLAAEQGWKQ 184

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQFIP----YPIISHDLEENSSIFK-----------I 166
           +++VT  +HMPR     +R  S +Q IP    Y +      +  S  +           +
Sbjct: 185 LILVTSAFHMPRALASFKRQ-SELQIIPVACDYQLDPQHQNQAFSWGELLIDLIPSSDAL 243

Query: 167 KILRVLLIEYLKILLLSIQLS 187
                +L E+L +L+  ++  
Sbjct: 244 DQTTQVLKEHLGLLVYQLRGQ 264


>gi|89096104|ref|ZP_01168997.1| hypothetical protein B14911_25445 [Bacillus sp. NRRL B-14911]
 gi|89088958|gb|EAR68066.1| hypothetical protein B14911_25445 [Bacillus sp. NRRL B-14911]
          Length = 226

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/169 (17%), Positives = 62/169 (36%), Gaps = 12/169 (7%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEP---IRIERAFELLENQIGEKIFISGVHHS----VSKDI 78
           + +    D  S   I VL        R+ +A EL  +    K+  SG        + +  
Sbjct: 42  LYKNIADDKKSGECIFVLGSSKAAEYRLPKALELYNSGRAGKLLFSGGVVWAPSRLCEAE 101

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRT 134
           LL++  +   +    I I  ++L+T+ N   +    ++    +    +L+VT   H+ R 
Sbjct: 102 LLKEKALALGIPAADILIENQSLHTKENVLASLLVLDREFNLHKIKRILVVTASCHIRRA 161

Query: 135 FLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           +L ++      +++   P+      E +             E  K++  
Sbjct: 162 YLAMKTYMPDWIEYSLCPVDDIHTIEGNWQLSEAGRLRAKREAEKLIYY 210


>gi|87301698|ref|ZP_01084538.1| hypothetical protein WH5701_03449 [Synechococcus sp. WH 5701]
 gi|87283915|gb|EAQ75869.1| hypothetical protein WH5701_03449 [Synechococcus sp. WH 5701]
          Length = 266

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/208 (16%), Positives = 67/208 (32%), Gaps = 40/208 (19%)

Query: 19  FISFIR-YVKQMHIPDHPSVSAIVVLTGE----------------PIRIERAFELLENQI 61
            +  +     ++     P   AIVVL G                   R+     LL +Q 
Sbjct: 59  LVWGLEARSARLTPAPVPRGDAIVVLGGGLRAALPPRAGVEVNEAGDRLLSGIRLLRDQR 118

Query: 62  GEKIF-------ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
              +         SG   + ++ I  + + +   +    + +  +A  T   A++     
Sbjct: 119 APLLLLSGGRVSFSGGDPAPAEAISARSLALELGVPADRLLVSDQARTTAEEARDLRRIG 178

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN------------SS 162
           +   +  VL+VT   HMPR     +R  S +Q +P          +            S 
Sbjct: 179 QSRGWSTVLLVTSALHMPRALASFRRQ-SGLQVVPVACDYLLPARDQLGRPTAGSVLLSL 237

Query: 163 IFKIKIL---RVLLIEYLKILLLSIQLS 187
                 L    + + E+L +L+  ++  
Sbjct: 238 WPDAGSLLLSSLAIKEHLGLLVYRLRGW 265


>gi|15604704|ref|NP_221222.1| hypothetical protein RP875 [Rickettsia prowazekii str. Madrid E]
 gi|7388444|sp|Q9ZC92|Y875_RICPR RecName: Full=Uncharacterized protein RP875
 gi|3861399|emb|CAA15298.1| unknown [Rickettsia prowazekii]
 gi|292572540|gb|ADE30455.1| hypothetical protein rpr22_CDS854 [Rickettsia prowazekii Rp22]
          Length = 174

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 68/159 (42%), Gaps = 7/159 (4%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R F   +      ++ GF  ++  +    +  +   +AI+V      +IE    LL+  
Sbjct: 2   IRKFLLIILAIFTLWVGGFGYYLYLINSYKLNSNT-TNAIIVFADGGHKIETCMALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  +     LL K  +   + +  I    K ++ E N +EA  +    N  
Sbjct: 61  YAPILFITGIESTERFKNLLMKHNV---IEQQVILAPNKIMSEEDNIKEAINFIVTYNLT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS---TVQFIPYPIISHD 156
            + +V H+Y++P    +LQ+       V  +PYP+ S  
Sbjct: 118 LITLVEHNYNIPFMLNKLQKAIPSSNNVYIVPYPVFSKP 156


>gi|312114877|ref|YP_004012473.1| hypothetical protein Rvan_2149 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220006|gb|ADP71374.1| protein of unknown function DUF218 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 276

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/225 (12%), Positives = 67/225 (29%), Gaps = 37/225 (16%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIP----DHPSVSAIVVLTGEP--------- 47
           +R       + ++ F       +  ++         D    + I+VL G           
Sbjct: 38  LRLIVAATLLYVVAFSPLANWLLHPLEHEVKAGTERDVAGAAGIIVLGGGVSGAIPTEGG 97

Query: 48  --------IRIERAFELLENQIGEKIFISGVH-------HSVSKDILLQKIPIRQDLAEC 92
                    R+     L        +  SG          + ++    ++      +   
Sbjct: 98  AIPLGPSVERVTETLRLALRHPDLPVIFSGGSGLILQLSDAPNEADAARRFFEGFGIVAP 157

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            + +  ++ NT  NA  ++A  +       ++VT  +HM R     +      + +P+P+
Sbjct: 158 RLRLEDRSRNTLENATLSAAMLQPKPDQRWILVTSAFHMRRAAALFEAQ--GFRVVPWPV 215

Query: 153 -----ISHDLEENSSIFKIK--ILRVLLIEYLKILLLSIQLSLST 190
                 + DL +           + +   E+L I +       + 
Sbjct: 216 GYLTSGTGDLRQPFGRASEGLHRIDIATKEWLGIFVSWANGDFAP 260


>gi|328543434|ref|YP_004303543.1| hypothetical protein [polymorphum gilvum SL003B-26A1]
 gi|326413179|gb|ADZ70242.1| DUF218 protein [Polymorphum gilvum SL003B-26A1]
          Length = 265

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 61/226 (26%), Gaps = 41/226 (18%)

Query: 2   RYFWYGLFVCLIF-----------FIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRI 50
           R+   GL +                    +  +            +V  I+VL G    +
Sbjct: 33  RFRRIGLVLASAGGLLLGVAGLSPLANLLMVPLEDRFPAPSTLPETVDGILVLGGAIDTV 92

Query: 51  ERAFE-----------------LLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQD 88
                                 L        I  SG       +S ++     ++     
Sbjct: 93  VTGKRPFPGLTTAGERVAVIPGLARRYPQALIVHSGGSGLLFGNSSTEAEGAAQLFESFG 152

Query: 89  LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFI 148
           LA   + +  ++LNT  NA    A  E       L+VT   HMPR     ++       +
Sbjct: 153 LAPDRLVLEDRSLNTWQNAVYTKALVEPRAGQTWLLVTSAMHMPRAVGVFRKAG-WTGVV 211

Query: 149 PYPIISHDLEENSSIFKIKI-------LRVLLIEYLKILLLSIQLS 187
           PYP+          +            L +   E++ ++       
Sbjct: 212 PYPVDWRTRGPEDRLRVFGAVSDGLTRLDIAFREWVGLVAYRASGR 257


>gi|118478405|ref|YP_895556.1| hypothetical protein BALH_2770 [Bacillus thuringiensis str. Al
           Hakam]
 gi|118417630|gb|ABK86049.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
          Length = 225

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 26  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLGAASWNGKPSPVFKERI 85

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 86  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 145

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 146 KNAKQVGIENGIQTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 202

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 203 FFKELFS-YIGYV 214


>gi|325267121|ref|ZP_08133790.1| protein of hypothetical function DUF218 [Kingella denitrificans
           ATCC 33394]
 gi|324981474|gb|EGC17117.1| protein of hypothetical function DUF218 [Kingella denitrificans
           ATCC 33394]
          Length = 213

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 54/157 (34%), Gaps = 17/157 (10%)

Query: 21  SFIRYVKQMHIPDH--PSVSAIVVLTGEPI----------RIERAFELLENQIGEKIFIS 68
                V +   P +  P   A VVL               RI  A  L +     K+  +
Sbjct: 28  WCAWQVYRFSQPKNDLPQADAAVVLGAAAWGNRPSPVFRERINHALTLYQTGYVRKLIFT 87

Query: 69  GVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
           G        ++  + +   ++Q + E  I I  ++ +T  N        +K++ H ++I+
Sbjct: 88  GGTPKSGYETEAEVARNFALKQGIPEQDILIEMRSKDTYQNLVNTRFLMQKHHLHDIVII 147

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           +   H+ R     + +   ++    P  +      S 
Sbjct: 148 SDPLHIARAMAIAEDL--DIKANYSPTPTSRYHNASW 182


>gi|229149917|ref|ZP_04278145.1| hypothetical protein bcere0011_14750 [Bacillus cereus m1550]
 gi|228633598|gb|EEK90199.1| hypothetical protein bcere0011_14750 [Bacillus cereus m1550]
          Length = 194

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 9   MKGILVVIIICAVY--AGFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRI 65

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 66  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 125

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 126 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 178

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 179 -----VREYLAITQYWFMNRI 194


>gi|149914159|ref|ZP_01902690.1| hypothetical protein RAZWK3B_19201 [Roseobacter sp. AzwK-3b]
 gi|149811678|gb|EDM71511.1| hypothetical protein RAZWK3B_19201 [Roseobacter sp. AzwK-3b]
          Length = 260

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 53/157 (33%), Gaps = 14/157 (8%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS--------KDILLQKIPIRQDLAEC 92
           VVL     R+    EL       KI  +G    V         +  + Q   +   LA  
Sbjct: 102 VVLGDGAERLTATLELARRFPDAKIVYAGGSGRVRDAFGAQLTEADIAQHFLLNMGLAPE 161

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            +     + NT  NA  A   A        ++VT  +HMPR     +      + +PYP+
Sbjct: 162 RLLTDPTSRNTAENAARAMELATPEVGQTWVLVTSAFHMPRAIRSFEAAG-WSELVPYPV 220

Query: 153 ISHDLEENSSI-----FKIKILRVLLIEYLKILLLSI 184
                   + +       + +L++ + E +      +
Sbjct: 221 DYRTGTFTNGLGWDLTGNLAMLQIAIREAVGSFAYRL 257


>gi|322807220|emb|CBZ04794.1| hypothetical protein H04402_02990 [Clostridium botulinum H04402
           065]
          Length = 197

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 67/161 (41%), Gaps = 15/161 (9%)

Query: 33  DHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDIL 79
                 +I++L  +            R++    L     G+ I +SG      ++S+   
Sbjct: 39  QPQKSDSIIILGCKVKGNDPTPFLKRRLDEGLGLYNEGYGKYIIVSGAKGPGENISEAEA 98

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           +QK  +++ L +  I +  K+ NT  N + +    E NN    +IV++ YH+ R  L  Q
Sbjct: 99  MQKYLVQKGLDKKFIILEDKSRNTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQ 158

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
           +    ++     +       +  +  ++ +  LL+ Y+K +
Sbjct: 159 K--EGIKASYSGVFVRSHMSHEIMGFLREIPALLVYYIKTM 197


>gi|254372782|ref|ZP_04988271.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570509|gb|EDN36163.1| conserved hypothetical protein [Francisella novicida GA99-3549]
          Length = 231

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 66/205 (32%), Gaps = 21/205 (10%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   L +       G     ++     +   I    +   I++L             
Sbjct: 26  LRYFIVALTIVYYLIGNGVLGTILALPLKSESTDIKACANTKGIILLGAGINDAFGKLEP 85

Query: 47  ----PIRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G      +S+  +   +  +  + +  I +   +
Sbjct: 86  ALSAYDRILKTAEVYHQHPQQIIISGGAPFGEKLSEAEIYADLLDKLGIPKSKIILEKNS 145

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NA+        +   + L+    ++  R  +   +       I       +++  
Sbjct: 146 KNTYQNAEFIKKILMNDKNTYCLVTGGIHY-KRAKIIFDKFAINTISIASSKFVPNIKIL 204

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQ 185
            + +   I + ++ EYL I+ + + 
Sbjct: 205 PNAYNFYITQNIVHEYLGIIRIYLS 229


>gi|21229858|ref|NP_635775.1| hypothetical protein XCC0380 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66766735|ref|YP_241497.1| hypothetical protein XC_0392 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188989803|ref|YP_001901813.1| hypothetical protein xccb100_0407 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21111359|gb|AAM39699.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572067|gb|AAY47477.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167731563|emb|CAP49738.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 205

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 53/173 (30%), Gaps = 16/173 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W    + LI+ +      +    +           I+VL               RI  
Sbjct: 17  WGWRLCMLALIWLVGVAGWIVWVGDR---DQAAPADVIIVLGAAAYDARPSPVFEERIRH 73

Query: 53  AFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L        +  +G   +    ++  + ++  +R  +    I I   +  T  N  +
Sbjct: 74  ALDLYARGYAPHLLFTGGFGNGARFAESQVARRYALRHGVPSEAIVIETSSRTTRQNLLQ 133

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           A A  E++  H  +IV+   HM R     Q +         P         S 
Sbjct: 134 ARALMERHGMHRAIIVSDPLHMARALRLCQELGVDALASSTPSTRFRSFHTSW 186


>gi|307946395|ref|ZP_07661730.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307770059|gb|EFO29285.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 267

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 62/219 (28%), Gaps = 34/219 (15%)

Query: 2   RYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLT------------- 44
           R      F+    F +G     +      +     D   +  I+VL              
Sbjct: 39  RGLVLLSFLGFFAFGLGPLGNILMQPLEDRFQTPEDVGQIDGIIVLGGAIDTVVTNTRLL 98

Query: 45  ----GEPIRIERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCID 95
                   R+    +L       ++  SG          S+   +  + +   +    I 
Sbjct: 99  TSINTAAERVTVVAQLAREHPKAEVIHSGGEGLLLGSGTSEAEGVLPLFLSFGIERERII 158

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           +  +A NT  NA       E       L+VT  YHMPR+    +        +PYP+   
Sbjct: 159 LEDQARNTWENATLTKEQLEPIEGQRWLLVTSAYHMPRSVGVFEAAG-WTGIVPYPVDQR 217

Query: 156 DLEENSSIFKIKILR-------VLLIEYLKILLLSIQLS 187
                 +      L        V + E++ ++       
Sbjct: 218 TRGPQDAGRWFVGLAEGLKRTDVAVKEWIGLVAYYATGR 256


>gi|228997721|ref|ZP_04157328.1| hypothetical protein bmyco0003_22930 [Bacillus mycoides Rock3-17]
 gi|229009077|ref|ZP_04166416.1| hypothetical protein bmyco0002_57970 [Bacillus mycoides Rock1-4]
 gi|228752247|gb|EEM01936.1| hypothetical protein bmyco0002_57970 [Bacillus mycoides Rock1-4]
 gi|228762065|gb|EEM11004.1| hypothetical protein bmyco0003_22930 [Bacillus mycoides Rock3-17]
          Length = 184

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 51/155 (32%), Gaps = 8/155 (5%)

Query: 33  DHPSVSAIVVLTGEPIRIER-AFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQD 88
           +      I++       +   A  L +  +   I  SG +      ++   L+ I I   
Sbjct: 17  EISPADVILIPGANHPPLMEKAASLYKQGLAPYILPSGGYKPQVGTTEWDFLRNIGIANG 76

Query: 89  LAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINS-TV 145
           + E  I    +A +T  NA+ +    +         +IV    H  R  L  Q       
Sbjct: 77  VPEEAILKEDQAQHTLENARLSLEVLQNTGIDPKKAIIVCKAGHSRRALLCYQAEFPKET 136

Query: 146 QFIPYPIISH-DLEENSSIFKIKILRVLLIEYLKI 179
           +F    +I    + + +       +  ++ E  KI
Sbjct: 137 EFFVSSVIDRYGITKENWFTTEIGISRIMTEVEKI 171


>gi|261211840|ref|ZP_05926127.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC341]
 gi|260839190|gb|EEX65822.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC341]
          Length = 273

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 77/228 (33%), Gaps = 39/228 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 40  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTLDYVMVLGNGHVVDDDIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG      VS   ++ ++ +   + +  I +  
Sbjct: 100 ELTRAALMRLTEGIRISRMYPGSKLILSGYAGGSEVSHARMMARVALALGVPKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 160 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 214

Query: 159 E--NSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFI 198
                    I   R L        E L +L   ++ +++   + Q   
Sbjct: 215 NIVQPWDKYIPKSRYLEQTEQYWYETLGLLWQKLRDTVAGDGSEQVGT 262


>gi|220908702|ref|YP_002484013.1| hypothetical protein Cyan7425_3327 [Cyanothece sp. PCC 7425]
 gi|219865313|gb|ACL45652.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 202

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/191 (19%), Positives = 72/191 (37%), Gaps = 9/191 (4%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                LF+  I F +GF+     +       +P   AI++L G   RI  A E       
Sbjct: 1   MLRKILFLGFILFWIGFVPLRLAIAH---QQYPQPQAILLLEGHRQRIPFAAEFWNQHPT 57

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
             I+ +G      ++   Q+I  +  +    I    ++ +T  N         + + HHV
Sbjct: 58  LPIWFTGSRTDRPRN---QRIFQQAGVPAEMIHYDRRSTDTVTNFTAIVRDLVRQDIHHV 114

Query: 123 LIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEENSSIFKIKI-LRVLLIEYLKI 179
            ++T DYHMPR       +     + F P  + +   ++ +    ++  LR +L     +
Sbjct: 115 FLITSDYHMPRASAIATLVLGSQGIVFTPVSVPTSPPKQENQWRTLRDCLRSVLWMVTGV 174

Query: 180 LLLSIQLSLST 190
              S++     
Sbjct: 175 TGASLRSYFQP 185


>gi|157736806|ref|YP_001489489.1| hypothetical protein Abu_0553 [Arcobacter butzleri RM4018]
 gi|157698660|gb|ABV66820.1| conserved hypothetical protein (DUF218 domain protein) [Arcobacter
           butzleri RM4018]
          Length = 248

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/216 (15%), Positives = 64/216 (29%), Gaps = 34/216 (15%)

Query: 2   RYFWYGLFVCLIFFIM-----GFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           + F    F+              IS +             +  I+VL             
Sbjct: 38  KIFLVLGFLWFALLSNQTISNMIISPLENAYPALKETPKDIKYILVLGNGHKTNDNFPIT 97

Query: 48  --------IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIG 97
                    R+       +N    K+ +SG       S   + +K+ I   + E  I   
Sbjct: 98  SELNTTAINRLIEGIRHYKNLENSKLIVSGYSFDDVNSHAQMQKKLAISLGVNEADIITL 157

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
               +T+  A EA           +++VT   HM R  +  ++    +  I  P      
Sbjct: 158 DTPKDTKEEAIEAKKIV---GNQKLILVTTASHMKRAVMLFEKE--DLNIIASPTNHKFF 212

Query: 158 EEN--SSIFKIKILRVL---LIEYLKILLLSIQLSL 188
                +S F    ++ +     EYL ++   ++  +
Sbjct: 213 TSTYPTSYFNATNIKKVELAFHEYLGMVYSYVKGEI 248


>gi|218661819|ref|ZP_03517749.1| hypothetical protein RetlI_21178 [Rhizobium etli IE4771]
          Length = 214

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 60/188 (31%), Gaps = 29/188 (15%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
           C+I     F + +   +   I  + +            R   A  L +     +I +SG 
Sbjct: 32  CMIVLGGAFENEVNTARH-SIEFNAAAD----------RFVEALRLAQKFPQSRILVSGG 80

Query: 71  HH-----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
                          ++      + +  +    ++  T  NA     +       H L++
Sbjct: 81  DGSLSGIYEGDAAASERFFPLFGIGKDRLIEERQSRTTFENAVNTKEFLASQGLSHCLLI 140

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISH---------DLEENSSIFKIKILRVLLIEY 176
           T  +HMPR+    +++   +  +P+P             D  + +     + +   + E+
Sbjct: 141 TSGFHMPRSVGIFRKL--GIDIVPWPTDYRTDGQVRPGLDFTQPN--LNAQNMATAIREW 196

Query: 177 LKILLLSI 184
             ++   +
Sbjct: 197 YGLVGYYL 204


>gi|323137866|ref|ZP_08072941.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
 gi|322396869|gb|EFX99395.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
          Length = 263

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/194 (13%), Positives = 57/194 (29%), Gaps = 30/194 (15%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLT-----------------GEPIRIERAFELLENQI 61
             + +         D P+   ++VL                      R+     L     
Sbjct: 61  LGAPLESRFPRPGDDMPAPDGVIVLGGTVDEKLSAELGHTAMVDAAERLTAPIALKRRYP 120

Query: 62  GEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
             +I  +G          ++   +++      L    I    ++ NT  NA       + 
Sbjct: 121 NARIVFTGGTAALRGSPFTEAEGVKRFWRDVGLDAGDILYEDRSRNTFENAIFTRELVQP 180

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL---- 172
                 L+VT   HMPR+    ++       I YP+      + S I     ++ +    
Sbjct: 181 KPGERWLLVTSAMHMPRSIGIFRKA--NFPVIAYPVDYRTNGKFSFILPRFAVKAIGVVE 238

Query: 173 --LIEYLKILLLSI 184
               E++ ++   +
Sbjct: 239 FAAHEWMGLVAYRL 252


>gi|222084312|ref|YP_002542841.1| hypothetical protein Arad_0152 [Agrobacterium radiobacter K84]
 gi|221721760|gb|ACM24916.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 263

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/213 (11%), Positives = 64/213 (30%), Gaps = 34/213 (15%)

Query: 4   FWYGLFVCLIFFI---MGFISFIRYVKQMHIPDHPSVSAIVVLT---------------- 44
               L + +  +       +  +         D   +  ++VL                 
Sbjct: 42  LLSILILFVALYTNAGAYVVQGLEERFPRVAADPADLKCMIVLGGATQNQVTTVRGGYEL 101

Query: 45  -GEPIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGY 98
                R+  A  L +     +I +SG             ++ ++      + +  +    
Sbjct: 102 DSGGDRLIEALRLAQKYPQARIVVSGGDGSIGGDYEGDAVISERFFTALGIGKDRLVEDK 161

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            +  T  NA        +N     L++T  +HMPR+    ++    +  +P+P+      
Sbjct: 162 TSRTTFENAVNTKELLAQNGLSGCLLITSGFHMPRSMGIFRKQ--GIDVVPWPVDYRSTG 219

Query: 159 ENSS-------IFKIKILRVLLIEYLKILLLSI 184
           + +            ++L   + E++ ++    
Sbjct: 220 KETLGLDFTQPSLNAQLLSTGVREWIGLVGYYA 252


>gi|116624473|ref|YP_826629.1| hypothetical protein Acid_5395 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227635|gb|ABJ86344.1| protein of unknown function DUF218 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 195

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 62/188 (32%), Gaps = 19/188 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYV--KQMHIPDHPSVSAIVVLTGEPIR--------- 49
           M+   +         +M +++F+     +Q    +      I+VL     R         
Sbjct: 1   MKRLLWNGIALAAVVVMFYVAFLSLRIEQQSVREEAQPADVILVLGAAEYRGRPSPVLRA 60

Query: 50  -IERAFELLENQIGEKIFI---SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
            ++ A +L   +   +I     SG     ++  + +    +  +    I +  +  +T  
Sbjct: 61  RLDHALDLYSRKFAPRILTTGGSGGDPIFTEGGVGRSYLTQHGVPSDAIIVETEGESTVE 120

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           +   A+    +   H V++V+  YH+ R    L+          Y     D  ++    +
Sbjct: 121 STTMAAEIMRRMELHSVIVVSDGYHIYRVKQMLEAHG----MTAYGSPRPDHSQSPLHLR 176

Query: 166 IKILRVLL 173
              L+   
Sbjct: 177 WNYLKQAF 184


>gi|229060751|ref|ZP_04198106.1| hypothetical protein bcere0026_28450 [Bacillus cereus AH603]
 gi|228718398|gb|EEL70030.1| hypothetical protein bcere0026_28450 [Bacillus cereus AH603]
          Length = 210

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 62/195 (31%), Gaps = 21/195 (10%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R     L  +C I   + + ++  +  +    D     A +VL               RI
Sbjct: 11  RILQVFLLMICSIILYVSYAAYDIWSYRFKTDDDVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYALKHGVKEEDILIETKSLFTEENL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIRTYTIVSDPLHMKRAMKIAKHI--KIEAYASPTPTSAYKTLD-----T 183

Query: 168 ILRVLLIEYLKILLL 182
            +     E    +  
Sbjct: 184 EIPFFFKELCSYIGY 198


>gi|304316432|ref|YP_003851577.1| hypothetical protein Tthe_0963 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777934|gb|ADL68493.1| protein of unknown function DUF218 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 191

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/189 (12%), Positives = 70/189 (37%), Gaps = 15/189 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
             + +     ++  I+ ++ +   +     +  AI+VL               R+  A +
Sbjct: 3   LLIKITAFVVLLNIIAELQVITFAYNAKPVNSDAIIVLGCAVYGKNPSPFFKERLSEAIK 62

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           L +  +G+ I +SG       +S+    ++  ++  + +  + +   + +T  N + +  
Sbjct: 63  LYKEGLGKYIIVSGGKGPGEDISEAEAGKEYLLKNGITDNVVLMDDGSYSTLQNLENSKK 122

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
             ++ +    +IV++ +H+ R  +  +     +      +             ++    L
Sbjct: 123 IMDEKSLKTAIIVSNKFHLKRASIIAKEA--GINASYSGVFVKRYFYEEVYGFLREAPAL 180

Query: 173 LIEYLKILL 181
           L  YL+ L 
Sbjct: 181 LYMYLRTLA 189


>gi|315635988|ref|ZP_07891248.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|315479709|gb|EFU70382.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 248

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/216 (15%), Positives = 64/216 (29%), Gaps = 34/216 (15%)

Query: 2   RYFWYGLFVCLIFFIM-----GFISFIRYVKQMHIPDHPSVSAIVVLTGEP--------- 47
           + F    F+              IS +             +  I+VL             
Sbjct: 38  KIFLVLGFLWFALLSNQTISNMIISPLENAYPALKETPKDIKYILVLGNGHKTNDNFPIT 97

Query: 48  --------IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIG 97
                    R+       +N    K+ +SG       S   + +K+ I   + E  I   
Sbjct: 98  SELNTTAINRLIEGIRHYKNLENSKLIVSGYSFDDVNSHAQMQKKLAISLGVNETDIITL 157

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
               +T+  A EA           +++VT   HM R  +  ++    +  I  P      
Sbjct: 158 DTPKDTKEEAIEAKKIV---GNQKLILVTTASHMKRAVMLFEKE--DLNIIASPTNHKFF 212

Query: 158 EEN--SSIFKIKILRVL---LIEYLKILLLSIQLSL 188
                +S F    ++ +     EYL ++   ++  +
Sbjct: 213 TSTYPTSYFNATNIKKVELAFHEYLGMVYSYVKGEI 248


>gi|298370494|ref|ZP_06981810.1| periplasmic protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281954|gb|EFI23443.1| periplasmic protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 220

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/191 (15%), Positives = 66/191 (34%), Gaps = 17/191 (8%)

Query: 1   MRYFWY----GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +R++         + ++    G +  +       +P   +  A VVL             
Sbjct: 12  LRFYLLRGIALSILLVLAVFAGNVWQVYRTGNQTLPAAATADAAVVLGAAAWNKQPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  LERINHAIALYQSHRVGKIVFTGGTPKKGYMTEAEVGRRYALKQGIPAKNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             N +        N+   ++IV+  YH+ R     + ++   +    P    D  E    
Sbjct: 132 YENLRNIKPILRANSVDSIIIVSDPYHLARAQAIARDLDLNAEVSATPTTRFDAREKKGR 191

Query: 164 FKIKILRVLLI 174
           F  +   +L +
Sbjct: 192 FLFQESYLLFL 202


>gi|54302360|ref|YP_132353.1| hypothetical protein PBPRB0680 [Photobacterium profundum SS9]
 gi|46915782|emb|CAG22553.1| hypothetical protein PBPRB0680 [Photobacterium profundum SS9]
          Length = 217

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 46/144 (31%), Gaps = 13/144 (9%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDI 78
             +          I VL    +R+ E A ++        I  SG    ++       +  
Sbjct: 15  YHLLNQTLEKSDCIFVLCSNDVRVAEHAAKIYLAGYAPYIVFSGGEGELTKGLFGCSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
               +     +    I I  ++ NT  N Q      E  +   + +++V   +   RTF 
Sbjct: 75  YFAHVAADMGVPLEKILIEPQSTNTGENVQFTRELLESKDLTPNKMILVQKPFMERRTFA 134

Query: 137 ELQRINSTVQFIPYPIISHDLEEN 160
              R     + I   + S D+  +
Sbjct: 135 TFVRQWPGKEVI---VTSPDISFD 155


>gi|110799112|ref|YP_695535.1| hypothetical protein CPF_1089 [Clostridium perfringens ATCC 13124]
 gi|110673759|gb|ABG82746.1| conserved hypothetical protein [Clostridium perfringens ATCC 13124]
          Length = 199

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 53/169 (31%), Gaps = 22/169 (13%)

Query: 32  PDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------------- 76
            +      I +       + E+A  L + ++ + +  SG      +              
Sbjct: 15  DEPKPCDLIFIPGSSKYEVSEKASLLYKQRLAKYVLPSGKFSCKLEKFPNEKIINKKYAG 74

Query: 77  -----DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129
                    +++  R D+    I +  K+ NT  NA  +    +  N      ++    +
Sbjct: 75  KYESDWEFCKEVLFRNDVPLESILVENKSTNTSENAFFSRKVTDDLNIEVKSAILCCQAF 134

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           H  R  +         QF   P+ +  + +++       +  +L E  K
Sbjct: 135 HARRALITYSLAYPNTQFYVVPVETQGISKDNWYKSDYGINRVLGELRK 183


>gi|145588430|ref|YP_001155027.1| hypothetical protein Pnuc_0242 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145046836|gb|ABP33463.1| protein of unknown function DUF218 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 272

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 51/168 (30%), Gaps = 22/168 (13%)

Query: 41  VVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS-----KDILLQKIPIRQDLAECC-- 93
           V L     R+ +A EL+          SG    ++     +    +++   Q L++    
Sbjct: 107 VPLQSSAERVTKALELIRKYPNLPFIFSGYSGRLNPKGLSEADAFKQLIAEQGLSQETEK 166

Query: 94  -IDIGYKALNTEGNAQEASAWAEKNNFHH-------VLIVTHDYHMPRTFLELQRINSTV 145
                 ++ NT  N        +              L++T   HM R     Q     +
Sbjct: 167 TAHYENQSRNTYENVLYLRPMMQDFGARSESGAIQPWLLITSASHMYRAEKIFQ--MQGI 224

Query: 146 QFIPYPIISHDLEENSSIFKI-----KILRVLLIEYLKILLLSIQLSL 188
           + IP P+        +          +    L+ E + +L   I   L
Sbjct: 225 EVIPVPVDYQTANSLNWTSFDLEDGTQNWHKLVHEVVGLLAYWITGKL 272


>gi|113866057|ref|YP_724546.1| hypothetical protein H16_A0026 [Ralstonia eutropha H16]
 gi|113524833|emb|CAJ91178.1| hypothetical integral membrane protein [Ralstonia eutropha H16]
          Length = 253

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 66/194 (34%), Gaps = 21/194 (10%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHP---SVSAIVVLTGEPI----------RI 50
            W   ++    ++     F   + +      P    V AIV+L               R+
Sbjct: 60  LWQAAWIAFALWLATVAIFFYNIHRSTEAAIPGSSPVKAIVILGSGTPNCVASPTLVARL 119

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++  +  +     K+ +SG         +  ++ +  I + +A   +    ++ +TE N 
Sbjct: 120 DQGLKQAQRWPQAKVAVSGGQDFGLRCREADIMAEYLIDRGVAADRVVREGRSTSTEENL 179

Query: 108 QEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
             +    E+        +++VT D+H+ R     ++                L  N+ + 
Sbjct: 180 LFSRRLLEEQGIAATDPIVVVTSDFHVRRAVRIARKAGFGEVAGVGAGTPLYLRYNAWLR 239

Query: 165 KIKILRV--LLIEY 176
           +        +L+EY
Sbjct: 240 EYFAAISGWVLMEY 253


>gi|294507679|ref|YP_003571737.1| hypothetical protein SRM_01864 [Salinibacter ruber M8]
 gi|294344007|emb|CBH24785.1| Conserved hypothetical protein [Salinibacter ruber M8]
          Length = 180

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/146 (15%), Positives = 47/146 (32%), Gaps = 15/146 (10%)

Query: 63  EKIFISGVHHSVSKDILLQK-----IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
             +  SG      +    +      +     +    I +  K+ NT  NA   +   ++ 
Sbjct: 20  PLVIASGGTQPWKRPDAREAPATNVLLQDWGVPGDAILLESKSANTYENATRTAELLDRR 79

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP----IISHDLEENSSIFKIKILR--- 170
             + VL+VT   HMPR     +     ++ +P P    +   +      +     L    
Sbjct: 80  GLNCVLLVTSALHMPRALAVFRSA--GIKAVPAPTDVQVGDRNYTVLDVLPDAGALAGST 137

Query: 171 VLLIEYLKILLLSIQLSL-STQTASQ 195
             + EY+  L+   +  +     +  
Sbjct: 138 AAIREYVGYLVYDWRGWIDGPAGSPN 163


>gi|229167811|ref|ZP_04295543.1| hypothetical protein bcere0007_27710 [Bacillus cereus AH621]
 gi|228615627|gb|EEK72720.1| hypothetical protein bcere0007_27710 [Bacillus cereus AH621]
          Length = 210

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 62/195 (31%), Gaps = 21/195 (10%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R     L  +C I   + + ++  +  +    D     A +VL               RI
Sbjct: 11  RILQVFLLMICSIILYVSYAAYDIWSYRFKTDDGVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEEELEEARTARVYALKHGVKEEDILIETKSLFTEDNL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIRTYTIVSDPLHMKRAMKIAKHI--KIEAYASPTPTSAYKTLD-----T 183

Query: 168 ILRVLLIEYLKILLL 182
            +     E    +  
Sbjct: 184 EIPFFFKELCSYIGY 198


>gi|228959326|ref|ZP_04121021.1| hypothetical protein bthur0005_28140 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228800396|gb|EEM47318.1| hypothetical protein bthur0005_28140 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 219

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 66/193 (34%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL+              RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKANDDVKTDAGIVLSAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + E  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKQGVKEEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKQVGIENGIQTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|241207055|ref|YP_002978151.1| hypothetical protein Rleg_4373 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860945|gb|ACS58612.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 262

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 59/188 (31%), Gaps = 29/188 (15%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
           C+I    GF + +   +             +   G   R   A  L +     +I +SG 
Sbjct: 80  CMIVLGGGFENEVNTARHG-----------IEFNGGADRFIEALRLAQKFPQSRILVSGG 128

Query: 71  HH-----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
                          ++      +    +    ++  T  NA     +       + L++
Sbjct: 129 DGSMSGIYEGDAAASERFFPLFGVGRDRLIEERQSRTTFENAVNTKEFLASQGLSNCLLI 188

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISH---------DLEENSSIFKIKILRVLLIEY 176
           T  +HMPR+    +++   +  +P+P             D  + +     + +   + E+
Sbjct: 189 TSGFHMPRSVGIFRKL--GIDIVPWPTDYRTDGQVRLGLDFTQPN--LNAQNMATAIREW 244

Query: 177 LKILLLSI 184
             ++   +
Sbjct: 245 YGLVGYYL 252


>gi|152975811|ref|YP_001375328.1| hypothetical protein Bcer98_2067 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152024563|gb|ABS22333.1| protein of unknown function DUF218 [Bacillus cytotoxicus NVH
           391-98]
          Length = 209

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 58/201 (28%), Gaps = 20/201 (9%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R     L +     +    +           D     A VVL               RI 
Sbjct: 11  RVLQVFLLMISSMILFVSYAAYDIWSYRFKTDKVDTDAAVVLGAAAWNGKPSPVFRERIN 70

Query: 52  RAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A  L +N   +KI  +G       + +    +   +++++ +  I I  K+  TE N +
Sbjct: 71  HAISLYQNGNIKKIIFTGGTKFEAELEEARTAKAYALKRNVKDEDILIETKSRFTEDNLK 130

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            A     ++      IV+   HM R     + I   +     P  +   +          
Sbjct: 131 NAKQVGMEHGLQTYTIVSDPLHMKRAMQIAKHI--GMDAYASPTPTSAYKSLD-----TE 183

Query: 169 LRVLLIEYLKILLLSIQLSLS 189
           +     E    +     L + 
Sbjct: 184 IPFFFKELCSYIGYMTSLPIR 204


>gi|325677631|ref|ZP_08157283.1| hypothetical protein CUS_6193 [Ruminococcus albus 8]
 gi|324110599|gb|EGC04763.1| hypothetical protein CUS_6193 [Ruminococcus albus 8]
          Length = 252

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 62/197 (31%), Gaps = 27/197 (13%)

Query: 5   WYGLFVCLIFFIMGFIS---FIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
              +    +F   GFI        + +           IVVL  +            R++
Sbjct: 63  RVLVITAAVFLAAGFIYAGILSFKMYRAQENVPDDTELIVVLGCQVKGTRPSRMLRRRLD 122

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A E +E        +SG       +S+   +    I +   E  I +  K+ +T  N +
Sbjct: 123 VALEAMEKHPDAVCVVSGGQGYGEKISEAKAMHDYLISKGADESRILMEDKSTSTFENIK 182

Query: 109 EASAWAEKNNF-HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
                 +K  +   + IVT  +H  R  L  ++  +  +   Y   +      +      
Sbjct: 183 FTFEMTDKLGYGRDITIVTDGFHQYRASLIAKQEGAG-RITAYSAHTEPRYLLTFW---- 237

Query: 168 ILRVLLIEYLKILLLSI 184
                + E+L +    I
Sbjct: 238 -----VREWLGLTYFWI 249


>gi|108758987|ref|YP_633512.1| hypothetical protein MXAN_5362 [Myxococcus xanthus DK 1622]
 gi|15076969|gb|AAK83000.1|AF285783_5 unknown [Myxococcus xanthus]
 gi|108462867|gb|ABF88052.1| conserved hypothetical protein [Myxococcus xanthus DK 1622]
          Length = 258

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 59/160 (36%), Gaps = 14/160 (8%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIG 97
                 R+ R FELL      ++ +SG        +V +  +L +   +  +    I   
Sbjct: 101 YNAAAERVLRGFELLHEGRARRVLLSGGSLDPRPEAVVEADVLLRQLQQWGIPRERIVTE 160

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH-- 155
            ++ NT  NA E++   ++  +  +L+VT   HMPR           ++    P+ S   
Sbjct: 161 GRSRNTRENAVESARIIQERGWKSLLLVTSAAHMPRAAGCF--AAVGLRPDLLPVDSRAS 218

Query: 156 --DLEENSSIFKIKILRV---LLIEYLKILLLSIQLSLST 190
              L   S + +   L +    L E     +  ++   + 
Sbjct: 219 NTPLRRMSWLPRSGALNLSTDALRELAGRAVYRVRGWTAP 258


>gi|229161985|ref|ZP_04289961.1| hypothetical protein bcere0009_27680 [Bacillus cereus R309803]
 gi|228621466|gb|EEK78316.1| hypothetical protein bcere0009_27680 [Bacillus cereus R309803]
          Length = 219

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/193 (18%), Positives = 65/193 (33%), Gaps = 18/193 (9%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R F   L  +C     + + ++  +  +    D     A +VL               RI
Sbjct: 20  RIFQVFLLMICSAILYVSYAAYDIWSYRFKTNDGVKTDAGIVLGAASWNGKPSPVFKERI 79

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++Q + +  I I  K+L TE N 
Sbjct: 80  NHAISLYKNGDIKKIIFTGGTKFEAELEESRTARVYAMKQGVKDEDILIETKSLFTEENL 139

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 140 KNAKEVGIENGIRTYTIVSDPLHMKRAMRIAKHI--NIEAYASPTPTSAYK-TLDTEIPF 196

Query: 168 ILRVLLIEYLKIL 180
             + L   Y+  +
Sbjct: 197 FFKELFS-YIGYV 208


>gi|229085827|ref|ZP_04218054.1| hypothetical protein bcere0022_24320 [Bacillus cereus Rock3-44]
 gi|228697494|gb|EEL50252.1| hypothetical protein bcere0022_24320 [Bacillus cereus Rock3-44]
          Length = 209

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 56/206 (27%), Gaps = 20/206 (9%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R     L +     +    +           D     A +VL               RI 
Sbjct: 11  RILQVFLLMISSIILFVSYAAYDIWSYRFKTDEVDTDAAIVLGAASWNGKPSPVFRERIN 70

Query: 52  RAFELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A  L +N   +KI  +G         +    +   ++ D+ +  I I  ++  TE N +
Sbjct: 71  HAISLYKNGSIKKIIFTGGTKFEAEQEEARTAKAYALKHDVKDEDILIETQSRFTEDNLK 130

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            A      N      IV+   HM R     + I   ++    P  +   +          
Sbjct: 131 NAKQVGMDNGLQTYTIVSDPLHMKRAMKIAKHI--GMEAYSSPTPTSAYKTLD-----TE 183

Query: 169 LRVLLIEYLKILLLSIQLSLSTQTAS 194
           +     E    +     L L      
Sbjct: 184 IPFFFKELCSYIGYVASLPLRVLKGD 209


>gi|158313956|ref|YP_001506464.1| hypothetical protein Franean1_2122 [Frankia sp. EAN1pec]
 gi|158109361|gb|ABW11558.1| protein of unknown function DUF218 [Frankia sp. EAN1pec]
          Length = 228

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/202 (11%), Positives = 62/202 (30%), Gaps = 19/202 (9%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAF 54
                +  I  +   ++F +        D  +  A++VL               R++ A 
Sbjct: 28  RIVAIIVGIVLLGSVMTFGQVWWVGRGDDRRASDALIVLGASQYDGRPSAILAARLDHAL 87

Query: 55  ELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           EL  + +  ++   G +      ++          + +    + +  + ++T  +    +
Sbjct: 88  ELYRSGVAPRVITVGGNQPGDRFTEAEAAGSYLRDRGVPSSAVLVVPQGVDTLSSLTAVA 147

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV 171
              +   +   ++VT  +H  R+      +   V  +  P  S              +R 
Sbjct: 148 GLMDSRQWRSAVVVTDRWHSLRSRAIADDL--GVDAVTSPATSGPANRGF----GTQMRY 201

Query: 172 LLIEYLKILLLSIQLSLSTQTA 193
           +L E +      +    S   A
Sbjct: 202 ILREGIGYRFYQLFHRASPSAA 223


>gi|208779215|ref|ZP_03246561.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|208745015|gb|EDZ91313.1| conserved hypothetical protein [Francisella novicida FTG]
          Length = 231

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 66/205 (32%), Gaps = 21/205 (10%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   L +       G     ++     +   I    +   I++L             
Sbjct: 26  LRYFIVALTIVYYLIGNGVLGTILALPLKSESTDIKACANTKGIILLGAGINDAFGKLEP 85

Query: 47  ----PIRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G      +S+  +   +  +  + +  I +   +
Sbjct: 86  ALSAYDRILKTAEVYHQYPQQIIISGGAPFGEKLSEAEIYADVLDKLGIPKSKIILEKNS 145

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NA+        +   + L+    ++  R  +   +       I       +++  
Sbjct: 146 KNTYQNAEFIKKILMNDKNTYCLVTGGIHY-KRAKIIFDKFAINTISIASSKFVPNIKIL 204

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQ 185
            + +   I + ++ EYL I+ + + 
Sbjct: 205 PNSYNFYITQNIVHEYLGIIRIYLS 229


>gi|148652828|ref|YP_001279921.1| hypothetical protein PsycPRwf_1021 [Psychrobacter sp. PRwf-1]
 gi|148571912|gb|ABQ93971.1| protein of unknown function DUF218 [Psychrobacter sp. PRwf-1]
          Length = 267

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/203 (16%), Positives = 63/203 (31%), Gaps = 30/203 (14%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVS---AIVVLTGE----------PI 48
           R  W  L+   + +++ FI F   + +             AI+VL G             
Sbjct: 71  RMVWKLLWAIFVLWLISFIVFAFSLHKNIKQVDQPYETVAAIIVLGGGIQDGLPTPTLAS 130

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQ-DLAECCIDIGYKALNTE 104
           R++ A  L++ Q    +  SG        S+   + +       +    I     + +TE
Sbjct: 131 RLDAAAPLIKEQPQAVVITSGGIGMGEIRSEGEAMARYLYALYGIPLEHIQQEKNSTSTE 190

Query: 105 GNAQEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            N   +     +        + +VT D+H+PR+    +    T            +  NS
Sbjct: 191 ENFLFSQQILTEQGISLNDPIAVVTSDFHIPRSLAIAEHQGYTNLVALASTTPLSIRYNS 250

Query: 162 SIFKIKILRVLLIEYLKILLLSI 184
                        EY   +   +
Sbjct: 251 W----------FREYFAYISGWL 263


>gi|28897807|ref|NP_797412.1| hypothetical protein VP1033 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838515|ref|ZP_01991182.1| integral membrane protein [Vibrio parahaemolyticus AQ3810]
 gi|260876969|ref|ZP_05889324.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260898706|ref|ZP_05907202.1| conserved inner membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|260900663|ref|ZP_05909058.1| conserved inner membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|28806020|dbj|BAC59296.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748082|gb|EDM58941.1| integral membrane protein [Vibrio parahaemolyticus AQ3810]
 gi|308089504|gb|EFO39199.1| conserved inner membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308093685|gb|EFO43380.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308106719|gb|EFO44259.1| conserved inner membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|328473218|gb|EGF44066.1| hypothetical protein VP10329_21110 [Vibrio parahaemolyticus 10329]
          Length = 261

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 79/219 (36%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   ++  ++VL              
Sbjct: 40  FVVLFSFVGLFLVAFQPVSTKLLMPLEREHKAFLPVSGTIDYVMVLGNGHVVDDEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRAALMRLTEGIRILRMYPGAKLILSGYDGGSEISHARMMANVALALGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHD 156
            A +T   A++A+A+ ++     +++VT   HM R   E       ++ IP P    + D
Sbjct: 160 DAKDTWEEARQAAAFVQQ---KEIVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAID 214

Query: 157 LEENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
                        R L        EYL  +   ++ ++ 
Sbjct: 215 EVSQPWDKYSPKARYLEQTELFWHEYLGSVWQRLRDTVG 253


>gi|154249896|ref|YP_001410721.1| hypothetical protein Fnod_1217 [Fervidobacterium nodosum Rt17-B1]
 gi|154153832|gb|ABS61064.1| protein of unknown function DUF218 [Fervidobacterium nodosum
           Rt17-B1]
          Length = 219

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 59/170 (34%), Gaps = 18/170 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------- 47
           + + +    +   F      +++     +          IVVL G               
Sbjct: 16  LAFLFLSFALVFYFLTSNLFAYLISKTFVLKDTEDKGIFIVVLGGGVDEFSNNVEIGKHT 75

Query: 48  -IRIERAFELLENQIGEKIFISGVHHS-VSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
             R+ +A EL +N+  + I   G+    V + ++++ + +   + E  I +G KA NT  
Sbjct: 76  LRRLYKALELYKNRPRKIIVTGGIIDKGVPEALIMKNVLLNFGVPEEDIILGSKARNTFE 135

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
           N +               +VT   HM R+    ++    V F+   +   
Sbjct: 136 NGKCTFELIGDVPIT---LVTSTIHMKRSLFVFRKFFKDVSFVSADVPVD 182


>gi|86355763|ref|YP_467655.1| hypothetical protein RHE_CH00103 [Rhizobium etli CFN 42]
 gi|86279865|gb|ABC88928.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 262

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 63/209 (30%), Gaps = 32/209 (15%)

Query: 6   YGLFVCLIFFIMGFI-SFIRYVKQMHIPDHPSVSAIVVLTG-----------------EP 47
             LFV L       +   +         D  ++  ++VL G                   
Sbjct: 46  LILFVTLYTTAGNLLMQGLEQRFAKPAADPENLQCVIVLGGAFENEVNTARHGIEFNGGA 105

Query: 48  IRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYKALN 102
            R   A  L +     +I ISG                ++      + +  +    ++  
Sbjct: 106 DRFIEALRLAQKFPQSRILISGGDGSISGIYEGDAAASERFFPLFGIGKDRLIEERQSRT 165

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-------H 155
           T  NA     +       H L++T  +HMPR+    +++   +  +P+P           
Sbjct: 166 TFENAVNTREFLASQGLSHCLLITSGFHMPRSVGIFRKL--GIDIVPWPTDYRTDGQVRP 223

Query: 156 DLEENSSIFKIKILRVLLIEYLKILLLSI 184
            L+        + +   + E+  ++   +
Sbjct: 224 GLDFTQPNLNAQSMATAIREWYGLIGYYL 252


>gi|163940818|ref|YP_001645702.1| hypothetical protein BcerKBAB4_2882 [Bacillus weihenstephanensis
           KBAB4]
 gi|229133982|ref|ZP_04262803.1| hypothetical protein bcere0014_28980 [Bacillus cereus BDRD-ST196]
 gi|163863015|gb|ABY44074.1| protein of unknown function DUF218 [Bacillus weihenstephanensis
           KBAB4]
 gi|228649475|gb|EEL05489.1| hypothetical protein bcere0014_28980 [Bacillus cereus BDRD-ST196]
          Length = 210

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 62/195 (31%), Gaps = 21/195 (10%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R     L  +C I   + + ++  +  +    D     A +VL               RI
Sbjct: 11  RILQVFLLMICSIILYVSYAAYDIWSYRFKTDDGVKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYALKHGVKEEDILIETKSLFTEDNL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIRTYTIVSDPLHMKRAMKIAKHI--KIEAYASPTPTSAYKTLD-----T 183

Query: 168 ILRVLLIEYLKILLL 182
            +     E    +  
Sbjct: 184 EIPFFFKELCSYIGY 198


>gi|300854922|ref|YP_003779906.1| hypothetical protein CLJU_c17410 [Clostridium ljungdahlii DSM
           13528]
 gi|300435037|gb|ADK14804.1| uncharacterized conserved membrane protein [Clostridium ljungdahlii
           DSM 13528]
          Length = 204

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 49/149 (32%), Gaps = 13/149 (8%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------GEPIRIERAF 54
              F+ ++  ++     + Y              I++L                R+ +A 
Sbjct: 17  VLFFIIIVLVVINLYPLLFYKSPETKLKRDRYDVIIILGFPALQDGKPSPIMRERVIKAV 76

Query: 55  ELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           EL        I  SG   ++   +  ++        +   C+    K+ NT  N Q +  
Sbjct: 77  ELFNKGYANNIICSGGGVYNKYIEADIMANFAESLGIPNSCLIREDKSRNTYQNIQNSIK 136

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
             E   +   +IVT  +H+ R+   L + 
Sbjct: 137 IMEDKKWSSAMIVTSPWHLRRSNYFLSKF 165


>gi|182625897|ref|ZP_02953662.1| conserved hypothetical protein [Clostridium perfringens D str.
           JGS1721]
 gi|177908810|gb|EDT71308.1| conserved hypothetical protein [Clostridium perfringens D str.
           JGS1721]
          Length = 207

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 53/169 (31%), Gaps = 22/169 (13%)

Query: 32  PDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------------- 76
            +      I +       + E+A  L + ++ + +  SG      +              
Sbjct: 15  DEPKPCDLIFIPGSSKYEVSEKASLLYKQRLAKYVLPSGNFSCKLEKFPNEKIINKKYAG 74

Query: 77  -----DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129
                    +++  R D+    I +  K+ NT  NA  +    +  N      ++    +
Sbjct: 75  KYESDWEFCKEVLFRNDVPLESILVENKSTNTSENAFFSRKVTDDLNIEVKSAILCCQAF 134

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           H  R  +         QF   P+ +  + +++       +  +L E  K
Sbjct: 135 HARRALITYSLAYPNTQFYVVPVETQGISKDNWYKSDYGINRVLGELRK 183


>gi|118497421|ref|YP_898471.1| hypothetical protein FTN_0829 [Francisella tularensis subsp.
           novicida U112]
 gi|118423327|gb|ABK89717.1| conserved hypothetical membrane protein [Francisella novicida U112]
          Length = 239

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 66/205 (32%), Gaps = 21/205 (10%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   L +       G     ++     +   I    +   I++L             
Sbjct: 34  LRYFIVALTIVYYLIGNGVLGTILALPLKSESTDIKACANTKGIILLGAGINDAFGKLEP 93

Query: 47  ----PIRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G      +S+  +   +  +  + +  I +   +
Sbjct: 94  ALSAYDRILKTAEVYHQYPQQIIISGGAPFGEKLSEAEIYADVLDKLGIPKSKIILEKNS 153

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NA+        +   + L+    ++  R  +   +       I       +++  
Sbjct: 154 KNTYQNAEFIKKILINDKNTYCLVTGGIHY-KRAKIIFDKFAINTISIASSKFVPNIKIL 212

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQ 185
            + +   I + ++ EYL I+ + + 
Sbjct: 213 PNAYNFYITQNIVHEYLGIIRIYLS 237


>gi|255068087|ref|ZP_05319942.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
 gi|255047685|gb|EET43149.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
          Length = 195

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 61/201 (30%), Gaps = 23/201 (11%)

Query: 2   RYFWYGLFVCLIFF--IMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PI 48
           R+   GL   L+ +   + ++ +     +    +       V+L                
Sbjct: 3   RWIIGGLIPLLLIWETSVAWLHYQAVQAEKASQNIKPADIAVILGNSVNRRGKPNPCLRS 62

Query: 49  RIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+E    L        + +SG       ++   +Q + I   +    I I  K+ +T  N
Sbjct: 63  RVEAGVALYRQNKVSGLLMSGGTDGDGSNEAAAMQSMAIDMGIPPEHIRIENKSESTFEN 122

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
              ++   +     +V+IV+  +H+ R    + R         Y   S            
Sbjct: 123 IALSAPLLQD--VSNVIIVSDAFHLARAEWLVNRHLKGKNVQFYASGSCGD------STP 174

Query: 167 KILRVLLIEYLKILLLSIQLS 187
             LR L  E    +   I   
Sbjct: 175 NYLRKLSREIPAWIKAMIMHR 195


>gi|289664371|ref|ZP_06485952.1| hypothetical protein XcampvN_15203 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668148|ref|ZP_06489223.1| hypothetical protein XcampmN_06538 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 205

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 54/173 (31%), Gaps = 16/173 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W    + LI+ +      +    +           I+VL               RI  
Sbjct: 17  WGWRLCMLALIWLVAVAGWIVWIGDR---DQAAPADVIIVLGAAAYDARPSPVFEERIRH 73

Query: 53  AFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L       ++  +G   +    ++  + ++  +R  +    I I   +  T  N ++
Sbjct: 74  ALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQNLEQ 133

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           A    E++  H  +IV+   HM R     Q +         P         S 
Sbjct: 134 ARTLMERHGMHRAIIVSDPLHMARALRLSQELGIDALASSTPSTRFRSFHTSW 186


>gi|171910674|ref|ZP_02926144.1| hypothetical protein VspiD_05860 [Verrucomicrobium spinosum DSM
           4136]
          Length = 211

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/200 (14%), Positives = 52/200 (26%), Gaps = 19/200 (9%)

Query: 4   FWYGLFVCLIFFIMGFIS-FIRYVKQMHI------PDHPSVSAIVVLTGEP-IRIERAFE 55
           F     + ++  ++G    F   + +                AIVVL G    R   A +
Sbjct: 10  FRLVKLILVVAVLLGVAWIFRESLLRTAARTWVVDDPVLKADAIVVLGGGRDWRPFTAAD 69

Query: 56  LLENQIGEKIFISGVHH--------SVSKDILLQKIPIRQDLAECCIDI-GYKALNTEGN 106
           +        + ++              S+  +   +  ++ +    I   G    +T   
Sbjct: 70  MYLAGQSTVVLVTQPEKSPSQNLLQQPSEAEINTTVLTKKGVPSTAIRPLGQNVTSTRDE 129

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV--QFIPYPIISHDLEENSSIF 164
           A     W   +    +LI T  +H  R     QR             I      E     
Sbjct: 130 ALALRDWVIAHQAKDILIPTDPFHTRRARWIFQRALEGTGATVHVRAIPHPRYSETDWWR 189

Query: 165 KIKILRVLLIEYLKILLLSI 184
                     E  K L   +
Sbjct: 190 HEDGFIAFQTELAKSLYYLL 209


>gi|229189814|ref|ZP_04316825.1| hypothetical protein bcere0002_14880 [Bacillus cereus ATCC 10876]
 gi|228593622|gb|EEK51430.1| hypothetical protein bcere0002_14880 [Bacillus cereus ATCC 10876]
          Length = 194

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 9   MKGILVVIMICAVY--AGFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRI 65

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 66  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 125

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 126 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIVPSN------ 178

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 179 -----VREYLAITQYWFMNRI 194


>gi|228991869|ref|ZP_04151805.1| hypothetical protein bpmyx0001_26140 [Bacillus pseudomycoides DSM
           12442]
 gi|228997985|ref|ZP_04157586.1| hypothetical protein bmyco0003_25540 [Bacillus mycoides Rock3-17]
 gi|229005536|ref|ZP_04163248.1| hypothetical protein bmyco0002_24730 [Bacillus mycoides Rock1-4]
 gi|228755723|gb|EEM05056.1| hypothetical protein bmyco0002_24730 [Bacillus mycoides Rock1-4]
 gi|228761718|gb|EEM10663.1| hypothetical protein bmyco0003_25540 [Bacillus mycoides Rock3-17]
 gi|228767598|gb|EEM16225.1| hypothetical protein bpmyx0001_26140 [Bacillus pseudomycoides DSM
           12442]
          Length = 218

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 56/206 (27%), Gaps = 20/206 (9%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R     L +     +    +           D     A +VL               RI 
Sbjct: 20  RVLQVFLLMVSSIILFVSYAAYDIWSYRFKTDEVDTDAAIVLGAASWNGKPSPVFRERIN 79

Query: 52  RAFELLENQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A  L +N   +KI  +G         +    +   ++ ++ +  I I  ++  TE N +
Sbjct: 80  HAISLYKNGSIKKIIFTGGTKFEAEQEEARTAKAYALKHNVKDEDILIETQSRFTEDNLK 139

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            A      N  H   IV+   HM R     + I   +     P  +   +          
Sbjct: 140 NAKQVGIDNGLHTYTIVSDPLHMKRAMRIAKHI--GIDAYASPTPTSAYKTLD-----TE 192

Query: 169 LRVLLIEYLKILLLSIQLSLSTQTAS 194
           +     E    +     L L      
Sbjct: 193 IPFFFKELCSYIGYVASLPLRILKGD 218


>gi|302871560|ref|YP_003840196.1| hypothetical protein COB47_0901 [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302574419|gb|ADL42210.1| protein of unknown function DUF218 [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 195

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 65/194 (33%), Gaps = 16/194 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISF-IRYVKQMHIPDHPSVSAIVVLTGEPI----------R 49
           MR F   L   ++  I  F+      +             I+VL               R
Sbjct: 1   MRKFSRILLYSMVILIFIFVITEASIIVFGISAKPKKSDCIIVLGCAVYGNFPSPFFRER 60

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           + +AFEL +      I + G      ++S+    ++  I + +    I    ++ +T  N
Sbjct: 61  LNKAFELYKKDYARYIIVCGAKGAGENISEAEAGKRYLIGKGVLPEFILKEDRSFSTYEN 120

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
                    +  F   +IV++ +H+ R +L  +++   +      +             I
Sbjct: 121 LLNVKRIMNRRGFKSAIIVSNMFHLERAYLIAKKL--KINASVSGVYVQQYSYEEYKGFI 178

Query: 167 KILRVLLIEYLKIL 180
           + +  L  E  K L
Sbjct: 179 REIMALWYEIFKTL 192


>gi|291545639|emb|CBL18747.1| Uncharacterized conserved protein [Ruminococcus sp. SR1/5]
          Length = 198

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/166 (14%), Positives = 53/166 (31%), Gaps = 22/166 (13%)

Query: 32  PDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSV---------------- 74
                   I V      ++ E+A EL  N    KI  SG +                   
Sbjct: 17  DKPEKADVIFVPGNGYPQMAEKAAELYRNGFAPKILPSGRYSITAGRFTGVLDKKECYCG 76

Query: 75  ---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN--NFHHVLIVTHDY 129
              ++   L+ + ++  + E  I    +A  T  NA  +    ++   +    ++     
Sbjct: 77  TYKTEWDFLKDVLMQNGVPEEAILKEDQATYTYENAIYSRQVTDREYLDIKKAILCCKTC 136

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
           H  R  +  + +    +F         +++N+ I     +  ++ E
Sbjct: 137 HARRALMYYKLLYPDTEFFVSSCCVDSIDKNTWIMTNDGIDEVMGE 182


>gi|121635807|ref|YP_976052.1| putative periplasmic protein [Neisseria meningitidis FAM18]
 gi|120867513|emb|CAM11290.1| putative periplasmic protein [Neisseria meningitidis FAM18]
 gi|254672612|emb|CBA06344.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|325131248|gb|EGC53960.1| hypothetical protein NMBM6190_2077 [Neisseria meningitidis M6190]
 gi|325137422|gb|EGC60010.1| hypothetical protein NMBES14902_2053 [Neisseria meningitidis
           ES14902]
          Length = 218

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIDSVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|288916964|ref|ZP_06411336.1| protein of unknown function DUF218 [Frankia sp. EUN1f]
 gi|288351673|gb|EFC85878.1| protein of unknown function DUF218 [Frankia sp. EUN1f]
          Length = 202

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/202 (10%), Positives = 57/202 (28%), Gaps = 19/202 (9%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAF 54
              L    +  +    +F +        D  +   ++VL               R++ A 
Sbjct: 2   RIVLMAVALLLVGSAATFGQVWWVGRGDDRRASDTLIVLGASQYDGRPSAILAARLDHAL 61

Query: 55  ELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           EL    +  ++   G +      ++  +         +    +    +  +T  +    +
Sbjct: 62  ELYRAGVAPRVITVGGNQPGDRFTEAEVAATYLRDHGVPASAVLAVPQGRDTLSSMIAVA 121

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV 171
              +  ++   ++VT  +H  R+       +  +  +  P  S              +  
Sbjct: 122 GLMDSRHWGSAVVVTDRWHSLRSRTI--AADLGIAAVASPSTSGPANRGF----GTQVHY 175

Query: 172 LLIEYLKILLLSIQLSLSTQTA 193
           +L E +      +    S   A
Sbjct: 176 ILREGIGYRFYQLFHRASPAAA 197


>gi|228952097|ref|ZP_04114192.1| hypothetical protein bthur0006_15080 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|229069269|ref|ZP_04202559.1| hypothetical protein bcere0025_14740 [Bacillus cereus F65185]
 gi|229078899|ref|ZP_04211451.1| hypothetical protein bcere0023_15610 [Bacillus cereus Rock4-2]
 gi|229178126|ref|ZP_04305497.1| hypothetical protein bcere0005_14880 [Bacillus cereus 172560W]
 gi|228605256|gb|EEK62706.1| hypothetical protein bcere0005_14880 [Bacillus cereus 172560W]
 gi|228704313|gb|EEL56747.1| hypothetical protein bcere0023_15610 [Bacillus cereus Rock4-2]
 gi|228713756|gb|EEL65641.1| hypothetical protein bcere0025_14740 [Bacillus cereus F65185]
 gi|228807629|gb|EEM54153.1| hypothetical protein bthur0006_15080 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 194

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 9   MKGILVVIMICAVY--AGFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRI 65

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 66  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 125

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 126 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 178

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 179 -----VREYLAITQYWFMNRI 194


>gi|239624750|ref|ZP_04667781.1| exported protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239521136|gb|EEQ61002.1| exported protein [Clostridiales bacterium 1_7_47FAA]
          Length = 239

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 61/173 (35%), Gaps = 24/173 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV----SAIVVLTGEPI---------- 48
           +    L  CL+ F++      +  K +   +          I+VL               
Sbjct: 14  FLVLALAGCLVLFLVNLYIIRKEEKYIVSAEEARAFEDVDCIMVLGCGVRPDGSPSGMLN 73

Query: 49  -RIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEG 105
            R+ +   L +  + +++ +SG H  V+ D   L+++  I + +    I + +   +T  
Sbjct: 74  DRLVQGISLYKEDVSDRLLMSGDHGKVNYDEVNLMKQFAIDRGVPSENIFMDHAGFSTYE 133

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
           +   A    +      ++IVT  YHM R     Q +        Y + S    
Sbjct: 134 SMYRARDIFQ---VKKIVIVTQRYHMYRALYVAQAMGME----AYGVASDPRT 179


>gi|326563988|gb|EGE14237.1| hypothetical protein E9K_05094 [Moraxella catarrhalis 103P14B1]
 gi|326569481|gb|EGE19541.1| hypothetical protein E9U_07596 [Moraxella catarrhalis BC8]
 gi|326577008|gb|EGE26903.1| hypothetical protein E9Y_00691 [Moraxella catarrhalis 101P30B1]
 gi|326577466|gb|EGE27350.1| hypothetical protein EA1_03565 [Moraxella catarrhalis O35E]
          Length = 252

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 57/212 (26%), Gaps = 38/212 (17%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGE--------------- 46
              G+   L          +  +            A  IVVL G                
Sbjct: 33  ILIGIASALTPIFANLGVGLLNLYSALTLATVQDDATSIVVLGGGLTKNSAGTISLNHFT 92

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ-DLAECCIDIGYKALNTEG 105
             R   A  L +      I              L+   I      +  I     ++NT  
Sbjct: 93  QSRANAAIHLHKLYPLSIITSGAESPW------LRDYLIEHIGRTKVVIINENASMNTCE 146

Query: 106 NAQEASAWAEKNNFHHVL-IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           NA   +     +     + +VT  YHM R   +  +    +  IP P     L   SS  
Sbjct: 147 NAVFTAKLLSHHELSTTVYLVTDRYHMARARRQFAKA--GIHTIPAPAP---LAIRSSWQ 201

Query: 165 KIK----ILRVLLIEYLKILLLSIQLSLSTQT 192
             K      R  + E    L+   +  ++ QT
Sbjct: 202 NPKDNLIHTRRTIYE----LVALARDIITPQT 229


>gi|158424456|ref|YP_001525748.1| hypothetical protein AZC_2832 [Azorhizobium caulinodans ORS 571]
 gi|158331345|dbj|BAF88830.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS
           571]
          Length = 271

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 57/219 (26%), Gaps = 36/219 (16%)

Query: 4   FWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVSAIVVLT-------------- 44
           F       L+ F         +S +       + D   V  I++L               
Sbjct: 43  FAVLATAGLMGFGFSPAGNYLMSPLEERFPPFVGDGRPVDGIIMLGGAEVPEVSVVRGVT 102

Query: 45  ---GEPIRIERAFELLENQIGEKIFISGVHHSVSKD-----ILLQKIPIRQDLAECCIDI 96
                  R+     L       K+  SG      +        ++       L    +  
Sbjct: 103 ALNDAAERVLAFAALARRYPQAKLVFSGGSGEYDESMPAAQDAVRLAFADVGLDVTRVIY 162

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++ NT  NA E             L+VT  +HMPR     + +        YP+    
Sbjct: 163 ERRSRNTAQNAVETRKLITPVPGERWLLVTSAFHMPRAIGCFREV--GFPVTAYPVDYRT 220

Query: 157 LEEN-------SSIFKIKILRVLLIEYLKILLLSIQLSL 188
           L               + I  + + E++ +        +
Sbjct: 221 LGPGRLNGVFRRVASGLDITDIAVREWMGLGAYYASGRI 259


>gi|195536112|ref|ZP_03079119.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|194372589|gb|EDX27300.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
          Length = 241

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 66/205 (32%), Gaps = 21/205 (10%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   L +       G     ++     +   I    +   I++L             
Sbjct: 36  LRYFIVALTIVYYLIGNGVLGTILALPLKSESTDIKACANTKGIILLGAGINDAFGKLEP 95

Query: 47  ----PIRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G      +S+  +   +  +  + +  I +   +
Sbjct: 96  ALSAYDRILKTAEVYHQYPQQIIISGGAPFGEKLSEAEIYADVLDKLGIPKSKIILEKNS 155

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NA+        +   + L+    ++  R  +   +       I       +++  
Sbjct: 156 KNTYQNAEFIKKILINDKNTYCLVTGGIHY-KRAKIIFDKFAINTISIASSKFVPNIKIL 214

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQ 185
            + +   I + ++ EYL I+ + + 
Sbjct: 215 PNAYNFYITQNIVHEYLGIIRIYLS 239


>gi|289209654|ref|YP_003461720.1| hypothetical protein TK90_2494 [Thioalkalivibrio sp. K90mix]
 gi|288945285|gb|ADC72984.1| protein of unknown function DUF218 [Thioalkalivibrio sp. K90mix]
          Length = 215

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 60/219 (27%), Gaps = 40/219 (18%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVK------QMHIPDHPSVSAIVVLTGEPI-------- 48
                  +          S+                      AIVVL             
Sbjct: 1   MLLVIGLLLSYSLSTPVFSYALMKPLQEGFAPPDDNQLADAQAIVVLGAGYRSGAEEFSG 60

Query: 49  ---------RIERAFELLENQIGEKIFISGVHH-SVSKDILLQKIPIRQDLAECCIDIGY 98
                    R+  A  L        +   G     V +   + ++     +    I    
Sbjct: 61  ETVHDLALVRLRYAAYLHHRTGLPVMVSGGGPEERVPEADYMAEVLKEYGVHP--ILREP 118

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T GNA+ ++          V +V+H +HMPR     +R    ++ IP P  ++   
Sbjct: 119 NARDTWGNARHSAEQLHAEGIERVALVSHAHHMPRATWSFERA--GLEIIPAPTGAYVPR 176

Query: 159 ENSSIFKIKILR----------VLLIEYLKILLLSIQLS 187
           +N     ++  R          + L EY  +     Q  
Sbjct: 177 DNGW--SLEGFRPQASAVWASWLALHEYWGMAWYRWQYG 213


>gi|229018413|ref|ZP_04175281.1| hypothetical protein bcere0030_29410 [Bacillus cereus AH1273]
 gi|229024642|ref|ZP_04181087.1| hypothetical protein bcere0029_29550 [Bacillus cereus AH1272]
 gi|228736707|gb|EEL87257.1| hypothetical protein bcere0029_29550 [Bacillus cereus AH1272]
 gi|228742893|gb|EEL93025.1| hypothetical protein bcere0030_29410 [Bacillus cereus AH1273]
          Length = 210

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 62/195 (31%), Gaps = 21/195 (10%)

Query: 2   RYFWYGLF-VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           R     L  +C I   + + ++  +  +    D     A +VL               RI
Sbjct: 11  RILQVFLLMICSIILYVSYAAYDIWSYRFKTDDGMKTDAGIVLGAASWNGKPSPVFKERI 70

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N 
Sbjct: 71  NHAISLYKNGNIKKIIFTGGTKFEAELEEARTARVYAMKHGVKEEDILIETKSLFTEDNL 130

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +N      IV+   HM R     + I   ++    P  +   +         
Sbjct: 131 KNAKQVGIENGIRTYTIVSDPLHMKRAMRIAKHI--KIEAYASPTPTSAYKTLD-----T 183

Query: 168 ILRVLLIEYLKILLL 182
            +     E    +  
Sbjct: 184 EIPFFFKELCSYIGY 198


>gi|228964701|ref|ZP_04125808.1| hypothetical protein bthur0004_15450 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228794951|gb|EEM42450.1| hypothetical protein bthur0004_15450 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 194

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 9   MKGILVVIMICAVY--AGFLQY-HIYKHGHMNATYDADYIIVLGSKVNGAKPSYSLQYRI 65

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 66  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 125

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 126 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 178

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 179 -----VREYLAITQYWFMNRI 194


>gi|206970731|ref|ZP_03231683.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|206734367|gb|EDZ51537.1| conserved hypothetical protein [Bacillus cereus AH1134]
          Length = 192

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 7   MKGILVVIMICAVY--AGFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRI 63

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 64  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 124 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 176

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 177 -----VREYLAITQYWFMNRI 192


>gi|81300267|ref|YP_400475.1| hypothetical protein Synpcc7942_1458 [Synechococcus elongatus PCC
           7942]
 gi|81169148|gb|ABB57488.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 188

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/157 (19%), Positives = 59/157 (37%), Gaps = 8/157 (5%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L    +   +G +  +  V         S  AI VL G+P R + A EL +      I++
Sbjct: 4   LIPITLLLSLGVVWGLNRVAVAQ----RSPQAIFVLGGDPQREQFAAELAQTHPDLPIWV 59

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           S   +        + +  +  +    + + Y+A +T  N    +   ++    HV +VT 
Sbjct: 60  SSGSNP----EYAEWVFSQAGVPRSRLHLDYQATDTLSNFTSLADRFQQQGIQHVYLVTS 115

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           DYHM R  +    + ++      P+       + S  
Sbjct: 116 DYHMRRALVIANIVFASRGITFEPVPVPSDRASESWR 152


>gi|325922970|ref|ZP_08184680.1| hypothetical protein XGA_3712 [Xanthomonas gardneri ATCC 19865]
 gi|325546551|gb|EGD17695.1| hypothetical protein XGA_3712 [Xanthomonas gardneri ATCC 19865]
          Length = 205

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 55/173 (31%), Gaps = 16/173 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W    +  I+ +      +    +           I+VL               RI  
Sbjct: 17  WGWRLCMLAAIWLVGVAGWIVWIGDR---DQAAPADVIIVLGAAAYDARPSPVFEERIRH 73

Query: 53  AFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L       ++  +G   +    ++  + ++  +R  +    I I  ++  T  N Q+
Sbjct: 74  ALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETESRTTRQNLQQ 133

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           A A  E++  H  +IV+   HM R     Q +         P         S 
Sbjct: 134 ARALMERHGMHRAIIVSDPLHMARALRLSQELGVDALASSTPSTRFRSFHTSW 186


>gi|326561612|gb|EGE11950.1| hypothetical protein E9M_05753 [Moraxella catarrhalis 46P47B1]
 gi|326567638|gb|EGE17746.1| hypothetical protein E9O_00430 [Moraxella catarrhalis 12P80B1]
 gi|326574024|gb|EGE23973.1| hypothetical protein E9W_05894 [Moraxella catarrhalis CO72]
          Length = 252

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 57/212 (26%), Gaps = 38/212 (17%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGE--------------- 46
              G+   L          +  +            A  IVVL G                
Sbjct: 33  ILIGIASALTPIFANLGVGLLNLYSALTLATVQDDATSIVVLGGGLTKNSAGTISLNHFT 92

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ-DLAECCIDIGYKALNTEG 105
             R   A  L +      I              L+   I      +  I     ++NT  
Sbjct: 93  QSRANAAIHLHKLYPLSIITSGAESPW------LRDYLIEHIGRTKVVIINENASMNTCE 146

Query: 106 NAQEASAWAEKNNFHHVL-IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           NA   +     +     + +VT  YHM R   +  +    +  IP P     L   SS  
Sbjct: 147 NAVFTAKLLSHHELSTTVYLVTDRYHMARARRQFAKA--GIHTIPAPAP---LAIRSSWQ 201

Query: 165 KIK----ILRVLLIEYLKILLLSIQLSLSTQT 192
             K      R  + E    L+   +  ++ QT
Sbjct: 202 NPKDNLIHTRRTIYE----LVALARDIITPQT 229


>gi|315283550|ref|ZP_07871714.1| putative cytoplasmic protein [Listeria marthii FSL S4-120]
 gi|313612811|gb|EFR86789.1| putative cytoplasmic protein [Listeria marthii FSL S4-120]
          Length = 183

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 69/197 (35%), Gaps = 29/197 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG------------EPIRIERA 53
             L + +I FI   I             + +   ++VL                 R++ A
Sbjct: 1   IFLILIVIGFIYLLIVAAFMFSGARAKPNGNADTVLVLGARVNGDPAEPSSVLKERLDTA 60

Query: 54  FELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
              L      K+ +SG      S S+  ++++  + Q +A   I++  K+  TE N + +
Sbjct: 61  VAYLNENPTLKVIVSGGQGEDESASEASVMEEYLVNQGIARNRINVEDKSTRTEENLKYS 120

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR 170
                K N    +IVT DYHM R  +  +R           + +  L   S        +
Sbjct: 121 K---GKFNLGKTVIVTSDYHMYRALMLAKRQG---------VDASGLPAKS--QSAGKYK 166

Query: 171 VLLIEYLKILLLSIQLS 187
            ++ E L I    +   
Sbjct: 167 KMMRETLSITYAWVFDR 183


>gi|260101969|ref|ZP_05752206.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|260084229|gb|EEW68349.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
          Length = 309

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 73/200 (36%), Gaps = 29/200 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
           + W  +   +       +  +     +     P +  +VVL               RI R
Sbjct: 109 FLWLVIIYLVTIM---MMYTLTAWINLINWYVPHLDYVVVLGAGIMGKTVTPLLAARITR 165

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             E+ +   G K+ +SG       + +   + +  I   + +  I I  K+  T  N + 
Sbjct: 166 GIEIYQKNPGSKLIMSGGQGPGEDILEAEAMAEYAINLGIPKEDIIIENKSRTTNENLRF 225

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           + A  + N      IVT+ YH+ R  +  +R    +Q I Y   +         F +   
Sbjct: 226 SYALMKPN--SKFCIVTNSYHVYRALVLAKRQ--GLQCIGYGAKTK------WYFTLNAF 275

Query: 170 RVLLIEYLKILLLSIQLSLS 189
              + E++  L+++ ++ ++
Sbjct: 276 ---VREFIAYLVITKRIQIT 292


>gi|218709993|ref|YP_002417614.1| hypothetical protein VS_2012 [Vibrio splendidus LGP32]
 gi|218323012|emb|CAV19189.1| hypothetical protein VS_2012 [Vibrio splendidus LGP32]
          Length = 225

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 39/145 (26%), Gaps = 14/145 (9%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------DILLQKIP 84
           D      I VL     R+ E A EL    +   I  SG     ++             I 
Sbjct: 35  DITPSDCIFVLCSNDTRVAEYAAELYHQGVAPYIVFSGGLGRFTEGSFERSEAETFAAIA 94

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRIN 142
               + +  I I   A NT  N +       +       + +V   +   RT+    +  
Sbjct: 95  RDAGVPDSDIIIEKHATNTGENVRFTHKLLTERGLSPKRLTLVQKPFMEKRTYATFAKQW 154

Query: 143 STVQFIPYPIISHDLEENSSIFKIK 167
              +     + S        I    
Sbjct: 155 PD-EVTEIQVTSQW---QDWIDYFN 175


>gi|91228201|ref|ZP_01262183.1| hypothetical protein V12G01_20638 [Vibrio alginolyticus 12G01]
 gi|91188190|gb|EAS74491.1| hypothetical protein V12G01_20638 [Vibrio alginolyticus 12G01]
          Length = 261

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 78/219 (35%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   ++  ++VL              
Sbjct: 40  FVVLFSFVGIFLVAFQPVSTKLLMPLEREHKAFLPVSGTIDYVMVLGNGHVIDDEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRAALMRLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALALGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T   A++A+A+ ++     +++VT   HM R   E       ++ IP P     + 
Sbjct: 160 DAKDTWEEARQAAAFVQQ---KEIVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAIR 214

Query: 159 --ENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
                        R L        EYL  +   ++ ++ 
Sbjct: 215 EISQPWDKYSPKARYLEQTELYWHEYLGSIWQRLRDTVG 253


>gi|21241154|ref|NP_640736.1| hypothetical protein XAC0380 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21106459|gb|AAM35272.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 201

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 54/173 (31%), Gaps = 16/173 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W    + LI+ +      +    +           I+VL               RI  
Sbjct: 13  WGWRLCMLALIWLVAVAGWIVWIGDR---DQAAPADVIIVLGAAAYDARPSPVFEERIRH 69

Query: 53  AFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L       ++  +G   +    ++  + ++  +R  +    I I   +  T  N ++
Sbjct: 70  ALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPDAIVIETTSRTTRQNLEQ 129

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           A    E++  H  +IV+   HM R     Q +         P         S 
Sbjct: 130 ARTLMERHGLHRAIIVSDPLHMARALRLSQELGIDALASSTPSTRFRSFHTSW 182


>gi|326572756|gb|EGE22742.1| hypothetical protein E9S_00375 [Moraxella catarrhalis BC7]
          Length = 252

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 56/212 (26%), Gaps = 38/212 (17%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGE--------------- 46
              G+   L          +  +            A  IVVL G                
Sbjct: 33  ILIGIASALTPIFANLGVGLLNLYSALTLATVQDDATSIVVLGGGLTKNSAGTISLNHFT 92

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ-DLAECCIDIGYKALNTEG 105
             R   A  L +      I              L+          +  I     ++NT  
Sbjct: 93  QSRANAAIHLHKLYPLSIITSGAESPW------LRDYLTEHIGRTKVVIINENASMNTCE 146

Query: 106 NAQEASAWAEKNNFHHVL-IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           NA   +     +     + +VT  YHM R   +  +    +  IP P     L   SS  
Sbjct: 147 NAVFTAKLLSHHELSTTVYLVTDRYHMARARRQFAKA--GIHTIPAPAP---LAIRSSWQ 201

Query: 165 KIK----ILRVLLIEYLKILLLSIQLSLSTQT 192
             K      R  + E    L+   +  ++ QT
Sbjct: 202 NPKDNLIHTRRTIYE----LVALARDIITPQT 229


>gi|110802720|ref|YP_698276.1| hypothetical protein CPR_0952 [Clostridium perfringens SM101]
 gi|110683221|gb|ABG86591.1| conserved hypothetical protein [Clostridium perfringens SM101]
          Length = 199

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 53/169 (31%), Gaps = 22/169 (13%)

Query: 32  PDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------------- 76
            +      I +       + E+A  L + ++ + +  SG      +              
Sbjct: 15  DEPKPCDLIFIPCSSKYEVSEKASLLYKQRLAKYVLPSGKFSCKLEKFPNEKIINKKYAG 74

Query: 77  -----DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129
                    +++  R D+    I +  K+ NT  NA  +    +  N      ++    +
Sbjct: 75  KYESDWEFCKEVLFRNDVPLESILVENKSTNTSENAFFSRKVTDDLNIEVKSAILCCQAF 134

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           H  R  +         QF   P+ +  + +++       +  +L E  K
Sbjct: 135 HARRALITYSLAYPNTQFYVVPVETQGISKDNWYKSDYGINRVLGELRK 183


>gi|325830373|ref|ZP_08163830.1| hypothetical protein HMPREF9404_3217 [Eggerthella sp. HGA1]
 gi|325487840|gb|EGC90278.1| hypothetical protein HMPREF9404_3217 [Eggerthella sp. HGA1]
          Length = 236

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 66/221 (29%), Gaps = 47/221 (21%)

Query: 1   MRYFWYGLFVCLIFFIMGFIS-----FIRYVKQMHIPDHP---SVSAIVVLTGE------ 46
           ++     +  C++  +  F +           ++  P         AIVVL         
Sbjct: 19  LKTMLGLMLGCMLVVVAVFAATNVATIATTKDRIVEPQAAVGFDADAIVVLGASVFADGT 78

Query: 47  -----PIRIERAFELLENQIGEKIFISGVHHSV--SKDILLQKIPIRQDLAECCIDIGYK 99
                  R++    L +  +  K+ +SG + +V  ++  +++   I Q +    I   + 
Sbjct: 79  PSGILRDRLDDGIALYKEGVAPKLIMSGDNSTVSYNEVQVMKDYAISQGVPSYDIFCDHA 138

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
             +T  +   A           +++ T  YH+ R           +      + S   + 
Sbjct: 139 GFSTYESMYRAKHVF---GAERIVVATQTYHLYRALY----AAQGLGLESLGVASDYHD- 190

Query: 160 NSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITL 200
                           Y K L   ++          FF TL
Sbjct: 191 ----------------YSKQLQYDLREI--PARTKDFFKTL 213


>gi|168209439|ref|ZP_02635064.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC
           3626]
 gi|168212314|ref|ZP_02637939.1| conserved hypothetical protein [Clostridium perfringens CPE str.
           F4969]
 gi|170712354|gb|EDT24536.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC
           3626]
 gi|170716134|gb|EDT28316.1| conserved hypothetical protein [Clostridium perfringens CPE str.
           F4969]
          Length = 199

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 53/169 (31%), Gaps = 22/169 (13%)

Query: 32  PDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------------- 76
            +      I +       + E+A  L + ++ + +  SG      +              
Sbjct: 15  DEPKPCDLIFIPGSSKYEVSEKASLLYKQRLAKYVLPSGKFSCKLEKFPNEKIINKKYAG 74

Query: 77  -----DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129
                    +++  R D+    I +  K+ NT  NA  +    +  N      ++    +
Sbjct: 75  KYESDWEFCKEVLFRNDVPLESILVENKSTNTSENAFFSRKVTDDLNIEVKSAILCCQAF 134

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           H  R  +         QF   P+ +  + +++       +  +L E  K
Sbjct: 135 HARRALITYSLAYPNTQFYVVPVETQGISKDNWHKSDYGINRVLGELRK 183


>gi|218509953|ref|ZP_03507831.1| hypothetical protein RetlB5_22095 [Rhizobium etli Brasil 5]
          Length = 262

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 62/209 (29%), Gaps = 32/209 (15%)

Query: 6   YGLFVCLIFFIMGFI-SFIRYVKQMHIPDHPSVSAIVVLTG-----------------EP 47
             LFV L       +   +         D  ++  ++VL G                   
Sbjct: 46  LILFVTLYTTAGNLLMQGLEQRFAKPAADPENLQCMIVLGGAFENEVNTARHGIEFNGGA 105

Query: 48  IRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYKALN 102
            R   A  L +     +I +SG                ++      +    +    ++  
Sbjct: 106 DRFVEALRLAQKFPDSRILVSGGDGSMSGIYEGDAAASERFFPLFGIGRERLIEETQSRT 165

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-------H 155
           T  NA     +       H L++T  +HMPR+    +++   +  +P+P           
Sbjct: 166 TFENAVNTREFLASQGLSHCLLITSGFHMPRSVGIFRKL--GIDIVPWPTDYRTDGQVRP 223

Query: 156 DLEENSSIFKIKILRVLLIEYLKILLLSI 184
            L+        + +   + E+  ++   +
Sbjct: 224 GLDFTQPNLNAQNMATAIREWYGLVGYYL 252


>gi|88801181|ref|ZP_01116724.1| hypothetical protein MED297_12227 [Reinekea sp. MED297]
 gi|88776084|gb|EAR07316.1| hypothetical protein MED297_12227 [Reinekea sp. MED297]
          Length = 261

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/203 (12%), Positives = 57/203 (28%), Gaps = 31/203 (15%)

Query: 13  IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT----------GEPIRIERAFE------- 55
            + +  ++ +    +        +   I+VL                +  A E       
Sbjct: 56  FYPVGAWLVYPLEHRFKPPNTEQAPDGIIVLGGAWRTQSSVYWGQWELNHAAERDLAMLA 115

Query: 56  LLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
           L       ++  +G           +  + +++     L    +    ++ NT  NA+ +
Sbjct: 116 LARRFPEAELVFTGGSGKLFSQQFKEADVARQLYSDLGLNPVRVQFESESRNTYENARFS 175

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK--- 167
                 +      +VT  YHM R            + +PYP+     E  S         
Sbjct: 176 QKLINPDVADIWWLVTSAYHMTRATEVFC--GIGWRVVPYPVDHF-YEPGSWRPNWAFAD 232

Query: 168 ---ILRVLLIEYLKILLLSIQLS 187
               L  +  E+L + +      
Sbjct: 233 HLWELERVSREWLGLWVYRATGR 255


>gi|84391755|ref|ZP_00991657.1| hypothetical protein V12B01_03238 [Vibrio splendidus 12B01]
 gi|84376468|gb|EAP93347.1| hypothetical protein V12B01_03238 [Vibrio splendidus 12B01]
          Length = 194

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 34/123 (27%), Gaps = 10/123 (8%)

Query: 35  PSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------DILLQKIPIR 86
                I VL     R+ E A EL    +   I  SG     ++             I   
Sbjct: 6   TPSDCIFVLCSNDTRVAEYAAELYHQGVAPYIVFSGGVGRFTEGSFERSEAETFAAIARD 65

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINST 144
             + +  I I   A NT  N +       +       + +V   +   RT+    +    
Sbjct: 66  AGVPDSDIIIEKHATNTGENVRFTHELLTERGLSPKRLTLVQKPFMEKRTYATFSKQWPE 125

Query: 145 VQF 147
              
Sbjct: 126 ESV 128


>gi|291532233|emb|CBL05346.1| Uncharacterized conserved protein [Megamonas hypermegale ART12/1]
          Length = 194

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 65/183 (35%), Gaps = 23/183 (12%)

Query: 28  QMHIPDHPSVSAIVVLTGEP------------------IRIERAFELLENQIGEKIFISG 69
                  P+   I+VL G                     R+  A  L +      I   G
Sbjct: 10  YDPPKHLPNADVIIVLGGGATGDTPDVTGTGTLCSIPANRLLTAVRLQKKLGIPIIVSGG 69

Query: 70  --VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
                S  +  + ++I     ++E  I +  ++LNT  NA+ ++   +   +   L+VT 
Sbjct: 70  QIYEDSGREADIARRILKELGVSEDMILLENRSLNTTQNAEYSTNILKSRKYKQPLLVTS 129

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK-ILLLSIQL 186
            +HM R  +   ++   V  IPYP      +E    +         +E+    L  +++ 
Sbjct: 130 AFHMERAVVNFNKL--GVDVIPYPCDYMVNKEKVFHYNRLAPSSQALEFTAIYLQENLRT 187

Query: 187 SLS 189
            ++
Sbjct: 188 FVT 190


>gi|269967671|ref|ZP_06181721.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269827758|gb|EEZ82042.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 261

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 78/219 (35%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   ++  ++VL              
Sbjct: 40  FVVLFSFVGIFLVAFQPVSTKLLMPLEREHKAFLPVSGTIDYVMVLGNGHVIDDEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRAALMRLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALALGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T   A++A+A+ ++     +++VT   HM R   E       ++ IP P     + 
Sbjct: 160 DAKDTWEEARQAAAFVQQ---KEIVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAIS 214

Query: 159 --ENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
                        R L        EYL  +   ++ ++ 
Sbjct: 215 EISQPWDKYSPKARYLEQTELYWHEYLGSIWQRLRDTVG 253


>gi|157829194|ref|YP_001495436.1| hypothetical protein A1G_07445 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933919|ref|YP_001650708.1| hypothetical protein RrIowa_1586 [Rickettsia rickettsii str. Iowa]
 gi|157801675|gb|ABV76928.1| hypothetical protein A1G_07445 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165909006|gb|ABY73302.1| hypothetical protein RrIowa_1586 [Rickettsia rickettsii str. Iowa]
          Length = 171

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 67/152 (44%), Gaps = 7/152 (4%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L      ++ GF  ++  +    +  +   +AI+V  G   +IE     L+      +F
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNT-TNAIIVFVGGGHKIETGIAWLKAGYAPILF 63

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           I+G+  +    ILL++  +   + +  I    K ++ E N ++   +    N   +++V 
Sbjct: 64  ITGIESTEQLKILLKERNV---IEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVE 120

Query: 127 HDYHMPRTFLELQRINS---TVQFIPYPIISH 155
           H+Y+MP    +L++       +  +PYP+ S 
Sbjct: 121 HNYNMPFMLNKLEKAIPSSNNIYIVPYPVFSK 152


>gi|168216074|ref|ZP_02641699.1| conserved hypothetical protein [Clostridium perfringens NCTC 8239]
 gi|182381565|gb|EDT79044.1| conserved hypothetical protein [Clostridium perfringens NCTC 8239]
          Length = 207

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/169 (14%), Positives = 53/169 (31%), Gaps = 22/169 (13%)

Query: 32  PDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------------- 76
            +      I +       I E+A  L + ++ + +  SG      +              
Sbjct: 15  DEPKPCDLIFIPGSSKCEISEKASLLYKQRLAKYVLPSGKFSCKLEKFPNEKIINKKYAG 74

Query: 77  -----DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129
                    +++  R D+    I +  K+ NT  NA  +    +  N      ++    +
Sbjct: 75  KYESDWEFCKEVLFRNDVPLESILVENKSTNTSENAFFSRKVTDDLNIEVKSAILCCQAF 134

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
           H  R  +         QF   P+ +  + +++       +  +L E  K
Sbjct: 135 HARRALITYSLAYPNTQFYVVPVETQGISKDNWYKSDYGINRVLGELRK 183


>gi|34496963|ref|NP_901178.1| transmembrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34102819|gb|AAQ59183.1| probable transmembrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 254

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/214 (13%), Positives = 57/214 (26%), Gaps = 31/214 (14%)

Query: 2   RYFWYGLFVCLIFF-----IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           R                   +     +     +   D  +  AIVVL G           
Sbjct: 43  RVLLALGVALTYMLSIPQTAIWLAQGVERYPPIRPADLAAADAIVVLGGGKRPAPEFGGN 102

Query: 49  --------RIERAFELLENQIGEKIFISGVH-HSVSKDILLQKIPIRQDLAECCIDIGYK 99
                   R+  A  L        +   G       +  ++                  +
Sbjct: 103 APSSDTLARLRYAAYLARQSGKPVLVTGGSPLGGEPEGKVMASALHDDYGIRARWV-EDR 161

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP---IISHD 156
           +  T  NA+ ++   +      + +V+  +H+ R     Q     +Q  P P   +    
Sbjct: 162 SDTTLDNARLSAEMLKAAGATRIALVSQGWHLGRAVPFFQSQ--GLQVSPAPTGFVRYEG 219

Query: 157 LEENSSIFKIKIL---RVLLIEYLKILLLSIQLS 187
                 +   K +    VLL EY+ +L   ++  
Sbjct: 220 PAFTRYLPSGKAMGDCHVLLREYIGLLYYRLRPG 253


>gi|15893279|ref|NP_360993.1| hypothetical protein RC1356 [Rickettsia conorii str. Malish 7]
 gi|229587249|ref|YP_002845750.1| hypothetical protein RAF_ORF1242 [Rickettsia africae ESF-5]
 gi|29839740|sp|Q92FX1|Y1356_RICCN RecName: Full=Uncharacterized protein RC1356
 gi|15620500|gb|AAL03894.1| unknown [Rickettsia conorii str. Malish 7]
 gi|228022299|gb|ACP54007.1| Unknown [Rickettsia africae ESF-5]
          Length = 171

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 67/152 (44%), Gaps = 7/152 (4%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L      ++ GF  ++  +    +  +   +AI+V  G   +IE     L+      +F
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNT-TNAIIVFAGGGHKIETGIAWLKAGYAPILF 63

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           I+G+  +    ILL++  +   + +  I    K ++ E N ++   +    N   +++V 
Sbjct: 64  ITGIESTEQLKILLKERNV---IEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVE 120

Query: 127 HDYHMPRTFLELQRINS---TVQFIPYPIISH 155
           H+Y+MP    +L++       +  +PYP+ S 
Sbjct: 121 HNYNMPFMLNKLEKAIPSSNNIYIVPYPVFSK 152


>gi|190889771|ref|YP_001976313.1| hypothetical protein RHECIAT_CH0000139 [Rhizobium etli CIAT 652]
 gi|190695050|gb|ACE89135.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 262

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/209 (13%), Positives = 62/209 (29%), Gaps = 32/209 (15%)

Query: 6   YGLFVCLIFFIMGFI-SFIRYVKQMHIPDHPSVSAIVVLTG-----------------EP 47
             LFV L       +   +         D  ++  ++VL G                   
Sbjct: 46  LILFVTLYTTAGNLLMQGLEQRFAKPAADPENLQCMIVLGGAFENEVNTARHGIEFNGGA 105

Query: 48  IRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAECCIDIGYKALN 102
            R   A  L +     +I +SG                ++      +    +    ++  
Sbjct: 106 DRFVEALRLAQKFPQSRILVSGGDGSMSGIYEGDAAASERFFPLFGIGRDRLIEETQSRT 165

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-------H 155
           T  NA     +       H L++T  +HMPR+    +++   +  +P+P           
Sbjct: 166 TFENAVNTRDFLAGQGLSHCLLITSGFHMPRSVGIFRKL--GIDIVPWPTDYRTDGQVRP 223

Query: 156 DLEENSSIFKIKILRVLLIEYLKILLLSI 184
            L+        + +   + E+  ++   +
Sbjct: 224 GLDFTQPNLNAQNMATAIREWYGLVGYYL 252


>gi|161612436|ref|YP_001586401.1| hypothetical protein SPAB_00125 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194469326|ref|ZP_03075310.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197262481|ref|ZP_03162555.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198242615|ref|YP_002214051.1| hypothetical protein SeD_A0103 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205357053|ref|ZP_02344474.2| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205357529|ref|ZP_02571064.2| putative secreted protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205358348|ref|ZP_02655427.2| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|161361800|gb|ABX65568.1| hypothetical protein SPAB_00125 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194455690|gb|EDX44529.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197240736|gb|EDY23356.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197937131|gb|ACH74464.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205324427|gb|EDZ12266.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205331506|gb|EDZ18270.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205335130|gb|EDZ21894.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|321222331|gb|EFX47403.1| Putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 237

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 63/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 35  RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 94

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 95  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 154

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 155 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 207

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 208 QTRFLLRETFYYSGYRLLRYMPVQNNS 234


>gi|326803127|ref|YP_004320945.1| hypothetical protein HMPREF9243_0621 [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651604|gb|AEA01787.1| conserved hypothetical protein [Aerococcus urinae ACS-120-V-Col10a]
          Length = 190

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 57/182 (31%), Gaps = 2/182 (1%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           M+              +G     +++ Q   P    +  IV       R E+A +LL+  
Sbjct: 1   MKKKLLIGGSAFAALAIGLRYIYKHLDQGQAPQVSDL-IIVAEGPAVERAEKAVQLLKAA 59

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
                              L     +       +    +A +T  NA  +    +   +H
Sbjct: 60  YSRAEKNIVSPRYTDVGEDLFAGYQQLGAERENLIEENQATSTWTNATTSLDLMDDLGYH 119

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
             ++VT DYHM RT L  QR N    F    + +   +           ++ L E  K +
Sbjct: 120 SAIVVTSDYHMRRTRLAFQRANRDYGFQLTYVSA-YYQGQPYPKHPYTQKMALQELYKYI 178

Query: 181 LL 182
             
Sbjct: 179 GY 180


>gi|254228980|ref|ZP_04922401.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262394709|ref|YP_003286563.1| membrane protein [Vibrio sp. Ex25]
 gi|151938448|gb|EDN57285.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262338303|gb|ACY52098.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. Ex25]
          Length = 261

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 78/219 (35%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   ++  ++VL              
Sbjct: 40  FVVLFSFVGIFLVAFQPVSTKLLMPLEREHKAFLPVSGTIDYVMVLGNGHVIDDEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRAALMRLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALALGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T   A++A+A+ ++     +++VT   HM R   E       ++ IP P     + 
Sbjct: 160 DAKDTWEEARQAAAFVQQ---KEIVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAIS 214

Query: 159 --ENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
                        R L        EYL  +   ++ ++ 
Sbjct: 215 EISQPWDKYSPKARYLEQTELYWHEYLGSIWQRLRDTVG 253


>gi|304392434|ref|ZP_07374375.1| periplasmic protein [Ahrensia sp. R2A130]
 gi|303295538|gb|EFL89897.1| periplasmic protein [Ahrensia sp. R2A130]
          Length = 189

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 62/168 (36%), Gaps = 20/168 (11%)

Query: 33  DHPSVSAIVVLTGEPI-----------RIERAFELLENQIGEKIFISGV--HHSVSKDIL 79
           +  S  AIVVL                R   A  L +  +   + +SG    H  ++   
Sbjct: 2   ELKSAYAIVVLGAAVWKDGRASPALERRTRHAIALHQQGLAPILVLSGGLGRHPPTEAKA 61

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           + +I + + + +  + +  ++ NT  N   ++A   +   + VL+V+  YH+PR  +  +
Sbjct: 62  MAEICMGEGVPQAALLLEGRSTNTFENVAFSAALLREKRVNSVLVVSDAYHLPRAKMCFR 121

Query: 140 RINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
            +     FI     +               R  L E + I    + LS
Sbjct: 122 YLG----FIATGSAAVAGPTTPWYR---TARYWLREIVAIPYYRLSLS 162


>gi|237746467|ref|ZP_04576947.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229377818|gb|EEO27909.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 203

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 51/171 (29%), Gaps = 23/171 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           +R      F+ + +       F        +    +  A ++L               RI
Sbjct: 5   LRILVIAAFLFVAYIFCSIALFS------TVDQKKTADAAIILGAAAWYKRPSPVFEERI 58

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
                L EN    K+ ++G        S+  + ++  +   + E  I I   +  T  N 
Sbjct: 59  RHGLWLYENGYVRKLILTGGKSKNAPYSEAFVARRYALSHAIPENDILIEEASQTTRENL 118

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
             A A  + N     LIV+   HM R       I   +    +   +    
Sbjct: 119 LNAKAIMQANGLSTALIVSDPIHMKRAM----HIAGDIGMTAWSSPTPSTR 165


>gi|16763488|ref|NP_459103.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|205351438|ref|YP_002225239.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207855611|ref|YP_002242262.1| hypothetical protein SEN0100 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|16418596|gb|AAL19062.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|205271219|emb|CAR36007.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206707414|emb|CAR31687.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261245331|emb|CBG23119.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|301156727|emb|CBW16201.1| probable secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911068|dbj|BAJ35042.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|323128416|gb|ADX15846.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326621795|gb|EGE28140.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326626461|gb|EGE32804.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332987050|gb|AEF06033.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 206

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 63/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 4   RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 63

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 64  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 124 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 176

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 177 QTRFLLRETFYYSGYRLLRYMPVQNNS 203


>gi|262404134|ref|ZP_06080689.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC586]
 gi|262349166|gb|EEY98304.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC586]
          Length = 283

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 80/234 (34%), Gaps = 40/234 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F + F       +  +       +P   +V  ++VL              
Sbjct: 40  LVVLFSLTGIFFISFQPIATRLLMPLERTYTAFLPVEGTVDYVMVLGNGHVVDDDIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG      VS   ++ ++ +   + +  I +  
Sbjct: 100 ELSRAALMRLAEGIRINRMYPGSKMILSGYAGGSEVSHARMMARVALALGVPKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHD 156
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P     H 
Sbjct: 160 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFEAA--GLNPIPAPTNFLGHL 214

Query: 157 LEENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFF-ITLIEE 203
                    I   R L        E L +L   ++ +++    +      +IEE
Sbjct: 215 NIAQPWDKYIPKARYLEQTEQYWYETLGLLWQKLRDTVAGDVETPLANPAVIEE 268


>gi|308070011|ref|YP_003871616.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
 gi|305859290|gb|ADM71078.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
          Length = 249

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 50/198 (25%), Positives = 73/198 (36%), Gaps = 30/198 (15%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP------------------IRIERAFELL 57
           + G +      KQ   P       IVVL G                     R+  A  L 
Sbjct: 54  LAGDLLISSLEKQYPQPRTVQGDVIVVLGGGATQGTPDINGQGNLLGSAANRLLTAARLH 113

Query: 58  ENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
           E      +F  G     S ++  + Q+  +   +    I I  ++LNT+ NA   S   E
Sbjct: 114 EATGLPILFSGGQVFGDSGNEANIAQRQLLGLGIPAKDILIENRSLNTQQNAVYTSQILE 173

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS--------HDLEENSSIFKIK 167
           K+     ++VT  +HMPR  LE QR    VQ I YP           +  + + S   + 
Sbjct: 174 KHQLTRPVLVTSAFHMPRAALEFQRA--GVQAIAYPTDYLASEKLSLYAGKLSPSAGAMS 231

Query: 168 ILRVLLIEYLKILLLSIQ 185
                L EYL IL L ++
Sbjct: 232 TTGTALKEYLGILALKLK 249


>gi|258621490|ref|ZP_05716524.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258586878|gb|EEW11593.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 287

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 36/236 (15%), Positives = 79/236 (33%), Gaps = 41/236 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 49  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTIDYVMVLGNGHVVDDDIPPTS 108

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG       S   ++ ++ +   + +  I +  
Sbjct: 109 ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSEFSHARMMARVALALGVPKSDIILLE 168

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 169 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 223

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLI--EEI 204
                    I   R L        E L +L   ++ +++    +     +I   E+
Sbjct: 224 NIAQPWDKYIPKARYLEQTEQYWHETLGLLWQKLRDTVAGDVNTAPAEPIINVPEV 279


>gi|170726063|ref|YP_001760089.1| hypothetical protein Swoo_1709 [Shewanella woodyi ATCC 51908]
 gi|169811410|gb|ACA85994.1| protein of unknown function DUF218 [Shewanella woodyi ATCC 51908]
          Length = 264

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 58/216 (26%), Gaps = 37/216 (17%)

Query: 1   MRYFWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVSAIVVLTGEPI------- 48
           +R       V L+F           S +     ++    P    ++VL            
Sbjct: 39  VRSLLSLAIVLLVFLSSTPGSNLLSSPLENKYSVNSNTIPKGCLVMVLGSGHDESISGTA 98

Query: 49  ----------RIERAFELLENQIGEKIF---ISGVHHSVSKDILLQKIPIRQDLAECCID 95
                     R+             K+     SG   ++S   ++ +  I   +    I 
Sbjct: 99  VQKLSSTALARLSEGIRQYNLGSDCKLVVSGWSGGEGTLSHAEVMAEAAIELGIDNERII 158

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
               A +T   A+          F    +VT   HMPR+    Q     +   P    + 
Sbjct: 159 RFPLARDTIEEAEFLKWEIGNYPFR---LVTSASHMPRSMAIFQ----NIGLAPQAAPTD 211

Query: 156 DLEEN-SSIF----KIKILRVLLIEYLKILLLSIQL 186
            +             +   +  + EYL  L   I+ 
Sbjct: 212 FMTRQGRWWRLDAENLWSSQRAIHEYLGRLWFKIKY 247


>gi|322615919|gb|EFY12836.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620704|gb|EFY17564.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623945|gb|EFY20782.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627393|gb|EFY24184.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322630700|gb|EFY27464.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638080|gb|EFY34781.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640566|gb|EFY37217.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647705|gb|EFY44190.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648055|gb|EFY44522.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656912|gb|EFY53198.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657377|gb|EFY53649.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663697|gb|EFY59897.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666530|gb|EFY62708.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672311|gb|EFY68423.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676377|gb|EFY72448.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679530|gb|EFY75575.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686141|gb|EFY82125.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323194985|gb|EFZ80171.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200106|gb|EFZ85193.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201073|gb|EFZ86142.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209470|gb|EFZ94403.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212278|gb|EFZ97102.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216583|gb|EGA01309.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222478|gb|EGA06848.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225789|gb|EGA10009.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323228670|gb|EGA12799.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236716|gb|EGA20792.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239783|gb|EGA23830.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242169|gb|EGA26198.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249406|gb|EGA33322.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252259|gb|EGA36110.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256650|gb|EGA40380.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261316|gb|EGA44903.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265504|gb|EGA49000.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323271708|gb|EGA55126.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 206

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 64/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI+    + Q             +V                R+
Sbjct: 4   RYITRIAAGIILIMATVFINNAIAIYQFSQQDQTRVADCAIVAGAGVSGKTPSPVFQARL 63

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 64  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 124 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 176

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 177 QTRFLLRETFYYSGYRLLRYMPVQNNS 203


>gi|194446096|ref|YP_002039329.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194404759|gb|ACF64981.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
          Length = 206

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 63/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 4   RYITRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 63

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 64  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 124 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 176

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 177 QTRFLLRETFYYSGYRLLRYMPVQNNS 203


>gi|89092000|ref|ZP_01164955.1| hypothetical protein MED92_07531 [Oceanospirillum sp. MED92]
 gi|89083735|gb|EAR62952.1| hypothetical protein MED92_07531 [Oceanospirillum sp. MED92]
          Length = 272

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 50/153 (32%), Gaps = 16/153 (10%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIG 97
                 R+     L+      ++  +G              + Q     Q L    + I 
Sbjct: 104 FNSGAERLMVLPALMLRNPKLQVIYTGGSGSIFRPGYRGADVAQNWLSEQGL-AGRLIIE 162

Query: 98  YKALNTEGNAQEASAWAEKNNFHH---VLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
             + NT  NA        +         L++T  +HMPR+    ++    +  +PYP+  
Sbjct: 163 RDSRNTYQNALYTRELINELGADSQGSWLLITSAFHMPRSVGVFRKA--GIDVVPYPVDY 220

Query: 155 HDLEENSSIFKIKI----LRVLLIEYLKILLLS 183
             + EN     +      L + + E++ +L   
Sbjct: 221 R-VAENRWRPSLNRNMADLNLAVREWIGLLAYY 252


>gi|267991770|gb|ACY86655.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
          Length = 250

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 63/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 48  RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 107

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 108 DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 167

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 168 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 220

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 221 QTRFLLRETFYYSGYRLLRYMPVQNNS 247


>gi|218235669|ref|YP_002366399.1| hypothetical protein BCB4264_A1680 [Bacillus cereus B4264]
 gi|218163626|gb|ACK63618.1| conserved hypothetical protein [Bacillus cereus B4264]
          Length = 192

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 7   MKGILVVIMICAVY--AGFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKTSYSLQYRI 63

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 64  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 124 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 176

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 177 -----IREYLAITQYWFMNRI 192


>gi|254252544|ref|ZP_04945862.1| hypothetical protein BDAG_01779 [Burkholderia dolosa AUO158]
 gi|124895153|gb|EAY69033.1| hypothetical protein BDAG_01779 [Burkholderia dolosa AUO158]
          Length = 303

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/209 (11%), Positives = 59/209 (28%), Gaps = 35/209 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFE 55
           R+              G++           V  +  P+    + ++++     R     +
Sbjct: 87  RFIAIAAVALFWLLSAGWLAAPLIAWAEAGVTPVERPEMRGQTTLILIGAGTHRTGTGLQ 146

Query: 56  --------------LLENQIG----EKIFISGVHHSVS---KDILLQKIPIRQDLAECCI 94
                         L            + +SG         +  +  +  + + +A   +
Sbjct: 147 PPPDGNARIVKIAALYRACRQRAAHCTVVMSGGDPQHHGETEAAVYGRQLVAEGIAPADL 206

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +   +  T  NA+  ++     +    ++VT  Y M R  L+ +R        P P+ +
Sbjct: 207 VLEPNSRTTYENAKFTASILRSRHDDARILVTSSYQMRRALLDFRRFG----IDPQPVYA 262

Query: 155 HDLEE-NSS---IFKIKILRVLLIEYLKI 179
           +              +      L E + I
Sbjct: 263 NRRTPRTGWLPRWRNLVNADQALHELIGI 291


>gi|313669320|ref|YP_004049604.1| periplasmic protein [Neisseria lactamica ST-640]
 gi|313006782|emb|CBN88252.1| putative periplasmic protein [Neisseria lactamica 020-06]
          Length = 218

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  QERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEIAEDL--GVRVYMSATPTTRFDAGN 187


>gi|255019747|ref|ZP_05291824.1| hypothetical protein ACA_2404 [Acidithiobacillus caldus ATCC 51756]
 gi|254970815|gb|EET28300.1| hypothetical protein ACA_2404 [Acidithiobacillus caldus ATCC 51756]
          Length = 267

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 70/223 (31%), Gaps = 38/223 (17%)

Query: 1   MRYFWYGLFVCLIFFIM---------GFISFIRYVKQMHIPDHPSVSAIVVLTGEP---- 47
           +R   + L +     +            +  +       +   P V AIVVL G      
Sbjct: 36  VRALGWSLLLAAGVGLYLSATGVGARWLVLPLENRYPPLLHPQPGVGAIVVLGGGEVARP 95

Query: 48  -------------IRIERAFELLENQIGEKIFISGVHHS--VSKDILLQKIPIRQDLAEC 92
                        +R+E A +L +      +   G        +   + ++         
Sbjct: 96  PGDGGDMANARTLMRLEAAAKLAKQSALPIVTSGGAPRFGAPPEATTMARLLRESFAVHN 155

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I I  ++ NT  NA ++S    +   H V +VT   HMPR     +R    +  +P P 
Sbjct: 156 PIWIEGRSFNTAANAFDSSKLLAQKGIHRVYLVTSALHMPRAMAWFRRA--GLDPVPVPC 213

Query: 153 ISHDLEE-----NSSIF---KIKILRVLLIEYLKILLLSIQLS 187
                        S +     ++     + EYL +  L +Q  
Sbjct: 214 DYRLDRGLTSGYESWLPRAIYLEASSEAIHEYLGLFWLHLQER 256


>gi|90421278|ref|ZP_01229163.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334463|gb|EAS48266.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 211

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 42/127 (33%), Gaps = 7/127 (5%)

Query: 43  LTGEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIG 97
           L     R+    EL +     K+  SG         + +    + +     LA   + + 
Sbjct: 79  LNDAADRVTAGMELAQRYPKAKLLFSGGVAALLEEDIPETEAAEALYRGLGLAPDRLLLD 138

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
            +A +T  NA  A   A+       ++VT   HMPR     +        +PYP+     
Sbjct: 139 GRARDTFENAVFAKELAQPKPGEVWVLVTSASHMPRAVGCFRVA--GFDIVPYPVDYRTP 196

Query: 158 EENSSIF 164
              +   
Sbjct: 197 SGPALWR 203


>gi|200389290|ref|ZP_03215902.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199606388|gb|EDZ04933.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 237

 Score = 71.8 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 64/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 35  RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 94

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 95  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 154

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S   K  
Sbjct: 155 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWAK-- 208

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 209 -TRFLLRETFYYSGYRLLRYMPVQNNS 234


>gi|313896016|ref|ZP_07829570.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975441|gb|EFR40902.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 258

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 59/145 (40%), Gaps = 22/145 (15%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPI------------------RIERAFELLENQIGEKIFIS 68
           +   +P+HP    I++L G  I                  R+  A  L        +   
Sbjct: 73  RTYPVPEHPQGDVIIMLGGGAIGGVQDVDGEGMLAPSPASRLLTAVRLHRLYGLPILLSG 132

Query: 69  GV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           G     + ++  + +++ I   + E  I    ++L T  NA+ ++    +  F H ++VT
Sbjct: 133 GQVFKDTGTEAEIARRVLISLGVPEEQIYTESESLTTGQNARYSAEILHREGFMHPILVT 192

Query: 127 HDYHMPRTFLELQRINSTVQFIPYP 151
             +H+PR  L  +++   ++  PYP
Sbjct: 193 SAFHLPRAVLNFEKL--GIEVTPYP 215


>gi|228920427|ref|ZP_04083772.1| hypothetical protein bthur0011_14410 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228839057|gb|EEM84353.1| hypothetical protein bthur0011_14410 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 194

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 78/201 (38%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 9   MKGILGVIMICAVY--AGFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRI 65

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++ E  I +  K+ +T+ N 
Sbjct: 66  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIVEDRIIMEDKSTSTDENI 125

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 126 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 178

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 179 -----VREYLAITQYWFMNRI 194


>gi|295705080|ref|YP_003598155.1| hypothetical protein BMD_2965 [Bacillus megaterium DSM 319]
 gi|294802739|gb|ADF39805.1| conserved hypothetical protein [Bacillus megaterium DSM 319]
          Length = 187

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 69/197 (35%), Gaps = 26/197 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+      F+  +   +  ISF  Y +  H P   +   ++VL  +            R+
Sbjct: 1   MKKKMIYTFIGSLVLYIAIISFYMY-QTAHKPVPQNADYVLVLGSKVDGDQMSPSLKERV 59

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A   L+     K+ ++G       +S+     +   ++ + +  I    ++ +T  N 
Sbjct: 60  KTALSYLQAHQQTKVIVTGGKGSDEEISEAEAAYRFLRKEGIKKNRIIKENQSTSTFENF 119

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
                  +  +   V++V++D+H+ R  +  +R        P    +             
Sbjct: 120 TFTKQKVDIQH-KKVVLVSNDFHLFRASIIAKRQ--GFDVYPLGAKTP---------NSI 167

Query: 168 ILRVLLIEYLKILLLSI 184
            L+    EY  IL   +
Sbjct: 168 KLQAYFREYAAILKTWL 184


>gi|90414034|ref|ZP_01222018.1| hypothetical protein P3TCK_06857 [Photobacterium profundum 3TCK]
 gi|90324956|gb|EAS41477.1| hypothetical protein P3TCK_06857 [Photobacterium profundum 3TCK]
          Length = 217

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 47/144 (32%), Gaps = 13/144 (9%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDI 78
             +          I VL    +R+ E A +L        I  SG    ++       +  
Sbjct: 15  YHLLNQTLEKSDCIFVLCSNDVRVAEHAAKLYLAGYAPYIVFSGGEGELTKGLFGCSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
               I     +    I I  ++ NT  N Q      E  +   + +++V   +   RTF 
Sbjct: 75  YFAHIAADMGVPLEKILIEPQSTNTGENVQFTRELLESKDLTPNKMILVQKPFMERRTFA 134

Query: 137 ELQRINSTVQFIPYPIISHDLEEN 160
            + R     + I   + S ++  +
Sbjct: 135 TVMRQWPGKEII---VTSPNITFD 155


>gi|157965010|ref|YP_001499834.1| hypothetical protein RMA_1350 [Rickettsia massiliae MTU5]
 gi|157844786|gb|ABV85287.1| hypothetical protein RMA_1350 [Rickettsia massiliae MTU5]
          Length = 171

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 69/152 (45%), Gaps = 7/152 (4%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L      ++ GF  ++  +    +  +   +AI+V  G   +IE    LL+      +F
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNT-TNAIIVFAGGGHKIETGSALLKAGYAPILF 63

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           I+G+  +     LL++  +   + +  I    K ++ E N ++A  +    N   +++V 
Sbjct: 64  ITGIESTEQLKNLLKERNV---IEQQVILAPSKIMSEEDNIKKAVDFIVTYNLTSIILVE 120

Query: 127 HDYHMPRTFLELQRIN---STVQFIPYPIISH 155
           H+Y+MP    +L+++      +  +PYP+ S 
Sbjct: 121 HNYNMPFMLNKLEKVIHSSHNIYIVPYPVFSK 152


>gi|332184005|gb|AEE26259.1| putative exported protein [Francisella cf. novicida 3523]
          Length = 228

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 65/204 (31%), Gaps = 21/204 (10%)

Query: 1   MRYFWYGLFVCLIFF----IMGFISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   + +         +   ++     +   I    +   I++L             
Sbjct: 26  LRYFIVAITIIYYLIGNGILGSILAIPLKSESTDIKACANTKGIILLGAGINQAFGKLQP 85

Query: 47  ----PIRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G       S+  +   +  +  + +  I +   +
Sbjct: 86  ALSAYDRILKTAEVYHQYPQQIIISGGAPFGEKSSEAEIYADVLYKLGIPKSKIILEKNS 145

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NA+        +   + L VT   H  R  +   +       I       +++  
Sbjct: 146 KNTYQNAEFIKKMLVDDKITYCL-VTSGIHYKRAKIIFDKFAINTISIASSKFVPNIKIL 204

Query: 161 SSIFKIKILRVLLIEYLKILLLSI 184
            + +   I + ++ EYL I+ + +
Sbjct: 205 PNAYNFYITQNIIHEYLGIVKIYL 228


>gi|197337877|ref|YP_002158482.1| hypothetical protein VFMJ11_A0934 [Vibrio fischeri MJ11]
 gi|197315129|gb|ACH64578.1| conserved hypothetical protein [Vibrio fischeri MJ11]
          Length = 217

 Score = 71.8 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 32/167 (19%), Positives = 58/167 (34%), Gaps = 11/167 (6%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG-------VHHSVSKDI 78
             +   +     AI VL    +R+ E A +L  +     +  SG          ++S+  
Sbjct: 15  YHLVNQEIRKSDAIFVLCSYDLRVAEHAAQLYLDGYAPLLIFSGAQGRATEGLFTLSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMPRTFL 136
               +     +    I +  KA NT  N     A  ++ N     +L+V   Y   R   
Sbjct: 75  TFANVAKDMGVPSSAIIVETKATNTGENIFFTQALLKEKNISISSLLLVQKPYMERRLLA 134

Query: 137 ELQRINSTVQF-IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
              +  + ++F I  P IS        I    I  ++L E  ++ + 
Sbjct: 135 TFLKNWNDIEFCISSPNISFINYPTDEITFDHIASIILGELHRLKVY 181


>gi|325127259|gb|EGC50197.1| hypothetical protein NMXN1568_2007 [Neisseria meningitidis N1568]
          Length = 214

 Score = 71.4 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|94313597|ref|YP_586806.1| hypothetical protein Rmet_4675 [Cupriavidus metallidurans CH34]
 gi|93357449|gb|ABF11537.1| conserved hypothetical protein; putative membrane protein
           [Cupriavidus metallidurans CH34]
          Length = 270

 Score = 71.4 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 66/205 (32%), Gaps = 33/205 (16%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA------IVVLTGE---------- 46
           + W   +  LI +++    F ++++       P+ SA      IV+L             
Sbjct: 72  WLWRAGWAGLIVWLVSVAMFFQHMRHGIADLAPNASAAGAPVAIVILGSGSPNCEVSPTL 131

Query: 47  PIRIERAFELLENQIGEKIFISGVHHS----VSKDILLQKIPIRQDLAECCIDIGYKALN 102
             R++   +         + +SG         ++  ++    +   L    +    ++ +
Sbjct: 132 AARLDEGLQQASRFPAASVVVSGGQDFGRLPCTEAGIMGDYLLAHGLVPERLIREDRSTS 191

Query: 103 TEGNAQEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           T  N Q +     ++       VL+VT D+H+ R     ++   T            +  
Sbjct: 192 TAENMQFSREVLARHGVRATDPVLVVTSDFHLLRAERIARKAGFTTLSGAAAATPLYIRY 251

Query: 160 NSSIFKIKILRVLLIEYLKILLLSI 184
           N+           L EY   +   +
Sbjct: 252 NAW----------LREYFAYISGWV 266


>gi|315647696|ref|ZP_07900797.1| hypothetical protein PVOR_20324 [Paenibacillus vortex V453]
 gi|315276342|gb|EFU39685.1| hypothetical protein PVOR_20324 [Paenibacillus vortex V453]
          Length = 202

 Score = 71.4 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 56/165 (33%), Gaps = 10/165 (6%)

Query: 26  VKQMHIPDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFISG----VHHSVSKDILL 80
           V+            I V  G    R+ +A EL  +     I  +G          +  ++
Sbjct: 23  VESEVDDGTQLADIIFVFGGKNLDRVWKAVELYNDGRAPYILFAGGDRFGEWDQPEATMM 82

Query: 81  QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRTFL 136
           +   ++  +    I I   + +T+ N   +    ++         +L V+   HM R  L
Sbjct: 83  RDEAVKMGVPPESIFIETMSNHTKENVIASLIVLDRALGLQQIQRLLFVSAPSHMRRCQL 142

Query: 137 ELQRIN-STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
            L+       +F+  P        ++   +   ++  + E  K++
Sbjct: 143 LLKTFMPPWYEFVWSPDHRAKGRRDNWWTEPVEVKRAMGELHKVI 187


>gi|329118151|ref|ZP_08246863.1| protein of hypothetical function DUF218 [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327465811|gb|EGF12084.1| protein of hypothetical function DUF218 [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 222

 Score = 71.4 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 55/166 (33%), Gaps = 16/166 (9%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV---SAIVVLTGEPI----------RI 50
            W G  + +   ++ F+     V +      P      A VVL               RI
Sbjct: 18  LWRGFAISVALVLLFFVWCAWSVYRTGRDGLPQGYTGDAAVVLGAAAWDARPSPVFRERI 77

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L  +    K+  +G       +S+  + ++  ++Q +    I +  K+  T  N 
Sbjct: 78  NHAVGLYRSGRVRKLVFTGGAVKKGYMSEGEVGRRYALKQGVPAEDILLENKSRTTYENL 137

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
               A   +     ++IV+   H+ R     + +    Q  P P  
Sbjct: 138 AYLRAPLREAGLRKIVIVSDPPHLARAAAVARDLGLDAQVSPTPTT 183


>gi|241760602|ref|ZP_04758694.1| periplasmic protein [Neisseria flavescens SK114]
 gi|241318783|gb|EER55309.1| periplasmic protein [Neisseria flavescens SK114]
          Length = 218

 Score = 71.4 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 64/202 (31%), Gaps = 25/202 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFI----SFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+ +      +  + G        I       +P      A VVL             
Sbjct: 11  LRYYLFRGLALSVLLVCGIFLAGTWQIYRTGLQTLPKDAHADAAVVLGAAAWDKRPSPVF 70

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L ++    KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 71  RERINHAITLYQSHRVGKIIFTGSTSKKGFMTEAEVGRRYALKQGIPAHNILFENTSRNT 130

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQFIPYPIISHDLEENSS 162
             N +        N    +++V+  YH+ R       +  S  QF   P    D      
Sbjct: 131 YENLRNIIPIMHANGVGSIIVVSDPYHLARAEEMAADLGLSDAQFSATPTTRFDERSKK- 189

Query: 163 IFKIKILRVLLIEYLKILLLSI 184
                  + L+ E   + L  I
Sbjct: 190 ------AKFLMQESYSLFLYRI 205


>gi|309379839|emb|CBX21615.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 218

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEIAEDL--GVRVYMSATPTTRFDAGN 187


>gi|84621867|ref|YP_449239.1| hypothetical protein XOO_0210 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188574494|ref|YP_001911423.1| hypothetical protein PXO_03633 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58424447|gb|AAW73484.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84365807|dbj|BAE66965.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188518946|gb|ACD56891.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 205

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/199 (16%), Positives = 62/199 (31%), Gaps = 27/199 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W      LI+ +      +    +           I+VL               RI  
Sbjct: 17  WGWRLCMPALIWLVAVAGWIVWIGDR---DQAAPADVIIVLGAAAYDARPSPVFEERIRH 73

Query: 53  AFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L       ++  +G   +    ++  + ++  +R  +    I I   +  T  N ++
Sbjct: 74  ALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQNLEQ 133

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           A    E++  H  +IV+   HM R      R++  +        +      S        
Sbjct: 134 ARTLMERHGMHRAIIVSDPLHMARAL----RLSQELGIDALASSTPSTRFRSFHTSW--- 186

Query: 170 RVLLIEYLKILLLSIQLSL 188
           R LL E    L    +  L
Sbjct: 187 RFLLQE----LYYFHRDLL 201


>gi|323467429|gb|ADX71116.1| Membrane protein [Lactobacillus helveticus H10]
          Length = 343

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 34/200 (17%), Positives = 73/200 (36%), Gaps = 29/200 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
           + W  +   +       +  +     +     P +  +VVL               RI R
Sbjct: 143 FLWLVIIYLVTIM---MMYTLTAWINLINWHVPHLDYVVVLGAGIIGKTVTPLLAARITR 199

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             E+ +   G K+ +SG       + +   + +  I   + +  I I  K+  T  N + 
Sbjct: 200 GIEIYQKNPGSKLIMSGGQGPGEDIPEAEAMAEYAINLGIPKEDIIIENKSRTTNENLRF 259

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           + A  + N      IVT+ YH+ R  +  +R    +Q I Y   +         F +   
Sbjct: 260 SHALMKPN--SKFCIVTNSYHVYRALVLAKRQ--GLQCIGYGAKTK------WYFTLNAF 309

Query: 170 RVLLIEYLKILLLSIQLSLS 189
              + E++  L+++ ++ ++
Sbjct: 310 ---VREFIAYLVITKRIQIT 326


>gi|224581941|ref|YP_002635739.1| secreted protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224466468|gb|ACN44298.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 237

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 64/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q    +        +V                R+
Sbjct: 35  RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRIADCAIVAGAGVSGKTPSPVFQARL 94

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 95  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 154

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 155 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 207

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 208 QTRFLLRETFYYSGYRLLRYMPVQNNS 234


>gi|205360555|ref|ZP_02684196.2| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205348825|gb|EDZ35456.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 237

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 63/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 35  RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 94

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 95  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 154

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 155 RYAKQILREQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 207

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 208 QTRFLLRETFYYSGYRLLRYMPVQNNS 234


>gi|163802067|ref|ZP_02195963.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sp. AND4]
 gi|159174208|gb|EDP59016.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sp. AND4]
          Length = 268

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 81/219 (36%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  +  F++ F       +  +    +  +P   S+  ++VL              
Sbjct: 40  FVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFLPVSGSIDYVMVLGNGHVVDNEIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +  
Sbjct: 100 QLSRTALMRLTEGIRILRMYPGAKLILSGYAGGSEISHARMMANVALSLGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T   A++A+A+ ++ +    ++VT   HM R   E       ++ IP P     ++
Sbjct: 160 DAEDTWEEARQAAAFVKQKDI---VLVTSASHMKRALYEFHAA--GIKPIPAPTNFMAID 214

Query: 159 --ENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
             E S        R L        E+L  L   ++ ++ 
Sbjct: 215 EIEQSWQKYAPKARYLEQTELYWYEFLGGLWQKLRDNVG 253


>gi|160941542|ref|ZP_02088874.1| hypothetical protein CLOBOL_06440 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435507|gb|EDP13274.1| hypothetical protein CLOBOL_06440 [Clostridium bolteae ATCC
           BAA-613]
          Length = 238

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 63/173 (36%), Gaps = 24/173 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV----SAIVVLTGE-----------P 47
               GL  CL  F++      +    +   D  +       I+VL               
Sbjct: 14  LLVLGLAGCLFLFLINLYMIRKEKPNIISSDDAAALGDVDCIMVLGCSVRPDGTPSGMLR 73

Query: 48  IRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEG 105
            R+++  EL E+ + +++ +SG H   + D +  +++  I + +    I + +   +T  
Sbjct: 74  DRLDKGIELYEDGVSDRLLMSGDHGRKNYDEVNRMKQYAIDEGIPSGDIFMDHAGFSTYE 133

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
           +   A    +      ++IVT  YHM R     Q +        Y + S   +
Sbjct: 134 SMYRARDIFQ---VKKIIIVTQRYHMYRALYVAQAMGME----AYGVESDPRQ 179


>gi|309390074|gb|ADO77954.1| protein of unknown function DUF218 [Halanaerobium praevalens DSM
           2228]
          Length = 253

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 65/209 (31%), Gaps = 26/209 (12%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------I 48
             + +F+         +  +    + ++ +      IVVL G                  
Sbjct: 47  LIFLIFLATAVGARVLVHPLENYAERNLVEVSQKYPIVVLGGGSNYYSAKKTTPSTHSLQ 106

Query: 49  RIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R+ + +EL  +     I+  G      ++S+     +      +         KA  T  
Sbjct: 107 RLVKGYELHRSLKTPLIYSGGVAIGQQNISEADAASEFLQDLGMDLEFYFSETKAQTTFE 166

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           NA     W +++    V + T  YHM R+    +     ++ +P         + S +  
Sbjct: 167 NAAYLRKWIKQHQVKKVYLFTSAYHMLRSMTVFKAQ--QIEVLPVHSGFIYNHKLSWLDY 224

Query: 166 IKILRVL------LIEYLKILLLSIQLSL 188
                 L      L E++ +    ++  +
Sbjct: 225 FPSRGALNANLTALHEWIGLFWYYLKGRI 253


>gi|150020778|ref|YP_001306132.1| hypothetical protein Tmel_0886 [Thermosipho melanesiensis BI429]
 gi|149793299|gb|ABR30747.1| protein of unknown function DUF218 [Thermosipho melanesiensis
           BI429]
          Length = 236

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 74/200 (37%), Gaps = 25/200 (12%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-------------- 47
           R+F        +     F  FI  +  +     P    IVVL G                
Sbjct: 38  RFFIILSITLYVISTPIFNFFISKLFIVDTKPIPKDGTIVVLGGGIVNYANNIEIGTHTL 97

Query: 48  IRIERAFELLENQIGEKIFISGVH-HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
            R+ + +E+ + +  + +   GV    + +  +++   I+  +++  I     +  T+ N
Sbjct: 98  KRLLKGWEIYKEKRLKIVVAGGVIGDGIREADVMKDFLIKLGVSKDDIITENTSRTTKEN 157

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIP----YPIISHD--LEEN 160
           A+  S   +  N    ++VT   HM R  +  ++   +   IP    YPI      L+  
Sbjct: 158 AKNVSKITKDPNI---ILVTSFLHMKRAKMLFEKYTQS-NIIPVVCDYPIDLRKNFLDFL 213

Query: 161 SSIFKIKILRVLLIEYLKIL 180
            S   I    ++  E+L IL
Sbjct: 214 PSPRGIYTFSLITHEFLGIL 233


>gi|308388228|gb|ADO30548.1| putative periplasmic protein [Neisseria meningitidis alpha710]
          Length = 214

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKHPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|74316470|ref|YP_314210.1| transmembrane protein [Thiobacillus denitrificans ATCC 25259]
 gi|74055965|gb|AAZ96405.1| probable transmembrane protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 251

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 70/207 (33%), Gaps = 28/207 (13%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------------R 49
            L+     ++ G +     +     P      AIVVL+G                    R
Sbjct: 48  ALYALSTPWVGGLLLKSLEISVPVDPARLQADAIVVLSGGRRMASREYGGDTLNGISLER 107

Query: 50  IERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +  A  L        +   G     ++++  +L ++       E        AL T  NA
Sbjct: 108 LRYAVRLHRATGLPLLVTGGNPGGGTLAEGQILAQVLRDDYGIEPRWV-EDAALTTWDNA 166

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI---ISHDLEENSSIF 164
           + ++   +K+  H + +VTH +H+ R     +     ++ IP  I    +        + 
Sbjct: 167 RLSAPLLKKSGVHRIALVTHAWHLRRAVPLFEAQ--ELEVIPAGIQFASTDLDRILDLLP 224

Query: 165 KIKILR---VLLIEYLKILLLSIQLSL 188
               LR     L E+L IL   ++ + 
Sbjct: 225 TPAGLRDSSFALHEWLGILWYKLRSNF 251


>gi|94969638|ref|YP_591686.1| hypothetical protein Acid345_2611 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551688|gb|ABF41612.1| protein of unknown function DUF218 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 202

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/198 (11%), Positives = 58/198 (29%), Gaps = 24/198 (12%)

Query: 6   YGLFVCLIFFIMGFISFIRY----VKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
               V  +        +       ++Q    +   V AIVV                R++
Sbjct: 11  IAALVLTVVVAGALFFYAWTCVRVMQQAETDERRPVDAIVVFGAAEYSGRPSPVLKARLD 70

Query: 52  RAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
              +L    +   +  +G        S+  + +   ++  + +  +    +  +T  +A+
Sbjct: 71  HGLDLFRQDMAPFVITTGGAGGDLHFSEGGVGRDYLLKNGVPDASLIGETQGGDTAQSAE 130

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             +     N     L V+  YH+ R     +R+        Y          +   +   
Sbjct: 131 RVAVIMRTNGMKTCLAVSDAYHLFRV----KRMMEEQGMECYGSPRPGSVPRTFWARFWA 186

Query: 169 LRVLLIEYLKILLLSIQL 186
           ++    E     L  +++
Sbjct: 187 IQ---REAFSYCLWKLRV 201


>gi|228932998|ref|ZP_04095861.1| hypothetical protein bthur0009_14690 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228826599|gb|EEM72370.1| hypothetical protein bthur0009_14690 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
          Length = 194

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 70/184 (38%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 24  GFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHKKAIAIV 82

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++ ++AE  I +   + +T+ N + +      +N    +I
Sbjct: 83  SGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDTSTSTDENIKFSKPLI-PDNMKKGMI 141

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 142 VTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IREYLAITQYWF 190

Query: 185 QLSL 188
              +
Sbjct: 191 MDRI 194


>gi|166714094|ref|ZP_02245301.1| hypothetical protein Xoryp_22305 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 205

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/173 (15%), Positives = 53/173 (30%), Gaps = 16/173 (9%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
           + W      LI+ +      +    +           I+VL               RI  
Sbjct: 17  WGWRLCMPALIWLVAVTGWIVWIGDR---DQAAPADVIIVLGAAAYDARPSPVFEERIRH 73

Query: 53  AFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L       ++  +G   +    ++  + ++  +R  +    I I   +  T  N ++
Sbjct: 74  ALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQNLEQ 133

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           A    E++  H  +IV+   HM R     Q +         P         S 
Sbjct: 134 ARTLMERHGMHRAIIVSDPLHMARALRLSQELGIDALASSTPSTRFRSFHTSW 186


>gi|49184541|ref|YP_027793.1| hypothetical protein BAS1526 [Bacillus anthracis str. Sterne]
 gi|49477297|ref|YP_035830.1| hypothetical protein BT9727_1498 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|165869545|ref|ZP_02214204.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167633396|ref|ZP_02391721.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|167639097|ref|ZP_02397370.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170686196|ref|ZP_02877418.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170706539|ref|ZP_02896999.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|177650599|ref|ZP_02933566.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190566262|ref|ZP_03019180.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|254683202|ref|ZP_05147063.1| hypothetical protein BantC_05040 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254723792|ref|ZP_05185578.1| hypothetical protein BantA1_15178 [Bacillus anthracis str. A1055]
 gi|254734554|ref|ZP_05192266.1| hypothetical protein BantWNA_05205 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254740963|ref|ZP_05198651.1| hypothetical protein BantKB_08062 [Bacillus anthracis str. Kruger
           B]
 gi|254755205|ref|ZP_05207239.1| hypothetical protein BantV_22267 [Bacillus anthracis str. Vollum]
 gi|254759741|ref|ZP_05211765.1| hypothetical protein BantA9_15636 [Bacillus anthracis str.
           Australia 94]
 gi|270000571|ref|NP_844092.2| hypothetical protein BA_1645 [Bacillus anthracis str. Ames]
 gi|49178468|gb|AAT53844.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
 gi|49328853|gb|AAT59499.1| conserved hypothetical protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|164714985|gb|EDR20503.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167512887|gb|EDR88260.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|167531434|gb|EDR94112.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|170128637|gb|EDS97504.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170669893|gb|EDT20634.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|172083743|gb|EDT68803.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190562397|gb|EDV16364.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|269850294|gb|AAP25578.2| conserved hypothetical protein [Bacillus anthracis str. Ames]
          Length = 192

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 74/194 (38%), Gaps = 26/194 (13%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELL 57
             + +    MGF+ +    K   +        I+VL  +            RI++A E L
Sbjct: 12  GIIMVCVVYMGFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYL 70

Query: 58  ENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           ++       +SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +    
Sbjct: 71  KSHEKAIAIVSGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI 130

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             +N    +IVT+D+HM R      +    ++ +P       +  ++           + 
Sbjct: 131 -PDNMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IR 178

Query: 175 EYLKILLLSIQLSL 188
           EYL I        +
Sbjct: 179 EYLAITQYWFMDRI 192


>gi|260881233|ref|ZP_05403953.2| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
 gi|260849348|gb|EEX69355.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
          Length = 266

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 62/175 (35%), Gaps = 29/175 (16%)

Query: 5   WYGLFVCLIFFIMGFIS-----FIRYVKQMHIPDHPSVSAIVVLTGEPI----------- 48
            + L         G ++     ++    Q   P+ P+   I++L G              
Sbjct: 56  LFALTFAFYLLCTGLVAEKTMGWLESAYQ--PPERPAGDVIIMLGGGAYSDTPDVDGTGT 113

Query: 49  -------RIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYK 99
                  R+  A  L        +   G     + ++  + +++ +   + E  I    +
Sbjct: 114 LCASPASRLLTAVRLQRQLDVPILLSGGQVYEDTGAEAKIAKRVLMSLGVPEDKILTETR 173

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
           ++NT  NA+ ++    +N   H ++VT  +HM R+ L   +    V   P+P   
Sbjct: 174 SINTSQNARFSAEILRENGLSHPILVTSAFHMKRSVLNFAKQ--GVAVEPFPTDY 226


>gi|220929859|ref|YP_002506768.1| hypothetical protein Ccel_2459 [Clostridium cellulolyticum H10]
 gi|220000187|gb|ACL76788.1| protein of unknown function DUF218 [Clostridium cellulolyticum H10]
          Length = 256

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 72/202 (35%), Gaps = 31/202 (15%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMH----IPDHPSVSAIVVLTGE----------PI 48
            F   + V    F++  +SFI     +           V +++VL               
Sbjct: 63  LFGKLIKVFTGLFLVWLVSFIIITAIIITSAIPDKEQQVDSVIVLGAGLKGETPTLVLKK 122

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++   E  +     +I +SG      ++++   +++  ++ ++ E  I    ++ +T  
Sbjct: 123 RLDYTLEYYKLNPDVRIIVSGGQGKGETITEAEAMKRYLVKHNIHENIILKEERSTSTYE 182

Query: 106 NAQEASAWAEK---NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           N Q +    E         V+I+T+D+HM R  +  +R        PY I S        
Sbjct: 183 NMQYSKNLYENTMGKPLGKVMIITNDFHMFRAKILAKRAG----LKPYGISSG----TPW 234

Query: 163 IFKIKILRVLLIEYLKILLLSI 184
                   V L EY  +    +
Sbjct: 235 YLYPN---VCLREYFALFKSLL 253


>gi|296112949|ref|YP_003626887.1| hypothetical protein MCR_0726 [Moraxella catarrhalis RH4]
 gi|295920643|gb|ADG60994.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
          Length = 235

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 57/212 (26%), Gaps = 38/212 (17%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGE--------------- 46
              G+   L          +  +            A  IVVL G                
Sbjct: 16  ILIGIASALTPIFANLGVGLLNLYSALTLATVQDDATSIVVLGGGLTKNSAGTISLNHFT 75

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ-DLAECCIDIGYKALNTEG 105
             R   A  L +      I              L+   I      +  I     ++NT  
Sbjct: 76  QSRANAAIHLHKLYPLSIITSGAESPW------LRDYLIEHIGRTKVVIINENASMNTCE 129

Query: 106 NAQEASAWAEKNNFHHVL-IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           NA   +     +     + +VT  YHM R   +  +    +  IP P     L   SS  
Sbjct: 130 NAVFTAKLLSHHELSTTVYLVTDRYHMARARRQFAKA--GIHTIPAPAP---LAIRSSWQ 184

Query: 165 KIK----ILRVLLIEYLKILLLSIQLSLSTQT 192
             K      R  + E    L+   +  ++ QT
Sbjct: 185 NPKDNLIHTRRTIYE----LVALARDIITPQT 212


>gi|220935848|ref|YP_002514747.1| hypothetical protein Tgr7_2685 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997158|gb|ACL73760.1| conserved protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 251

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 65/210 (30%), Gaps = 31/210 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI--------------- 48
             +        F    ++ +     +  P   +  AIVVL G                  
Sbjct: 38  IAWLYVAATPLFAGWLLAGLERGYPVAPPLPEAAGAIVVLAGGRHPDAPEYGGETVSPHS 97

Query: 49  --RIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             R+     L  +     +   G        ++  LL  +   +           ++ NT
Sbjct: 98  LERLRYGARLHRDTGLPLLVSGGRVRGDEPAAEADLLADVLEGELGVAVR-WRETESRNT 156

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS-----HDLE 158
             NA  ++    +    H L+V+H  HMPR     QR    +   P+P +          
Sbjct: 157 CENALFSAHLLAEAGIEHALLVSHALHMPRAVWCFQRT--ELAVTPFPTLPMGDLSRHRG 214

Query: 159 ENSSIFKIKILRV---LLIEYLKILLLSIQ 185
               + + + L +    L EYL ++   ++
Sbjct: 215 ITVVLPQPRALWLTGQALHEYLGLVWYRVK 244


>gi|220910044|ref|YP_002485355.1| hypothetical protein Cyan7425_4689 [Cyanothece sp. PCC 7425]
 gi|219866655|gb|ACL46994.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 262

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 75/230 (32%), Gaps = 45/230 (19%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVK------QMHIPDHPSVSAIVVLT----------- 44
           R+    + + L   ++G   ++          Q      P+ +AIVVL            
Sbjct: 35  RWAAIAMVLSLSLLLIGSNYWVSRWLLQTLETQNLPGSLPNAAAIVVLGGAIKGADPPRP 94

Query: 45  -----GEPIRIERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIPIRQDLAEC 92
                    R+  A +L  +     + +SG   S         +   +  +     +   
Sbjct: 95  WIEVAEAGDRLLYAAKLYRDGKAPLVILSGGRISWLSTATAAPESADMAILIETMGVPAS 154

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
            +     +LNT  NA       ++ N    +L+VT  +HMPR      R+   +  I  P
Sbjct: 155 ALLQDSTSLNTYQNAVNVQKILKEKNITGSILLVTSAFHMPRALAIFNRL--GIPAIAAP 212

Query: 152 IISHD-------------LEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
              H              L    S   ++   + L EY+ +++  ++  L
Sbjct: 213 TDFHTTQTAELSGAIGFLLSLLPSAETLQNTTLALKEYVGLVVYRLRGWL 262


>gi|261391563|emb|CAX48996.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           8013]
          Length = 218

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIDSVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|238651121|ref|YP_002916979.1| hypothetical protein RPR_07675 [Rickettsia peacockii str. Rustic]
 gi|238625219|gb|ACR47925.1| hypothetical protein RPR_07675 [Rickettsia peacockii str. Rustic]
          Length = 171

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 67/152 (44%), Gaps = 7/152 (4%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L      ++ GF  ++  +    +  +   +AI+V  G   +IE     L+      +F
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNT-TNAIIVFAGGGHKIETGIAWLKAGYAPILF 63

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           I+G+  +    ILL++  +   + +  I    K ++ E N ++   +    N   +++V 
Sbjct: 64  ITGIESTEQLKILLKERNV---IEQQVIFAPNKIISEEDNIKKVVDFIVTYNLTSIILVE 120

Query: 127 HDYHMPRTFLELQRINS---TVQFIPYPIISH 155
           H+Y+MP    +L++       +  +PYP+ S 
Sbjct: 121 HNYNMPFMLNKLEKAIPSSNNIYIVPYPVFSK 152


>gi|229012351|ref|ZP_04169528.1| hypothetical protein bmyco0001_27960 [Bacillus mycoides DSM 2048]
 gi|228748987|gb|EEL98835.1| hypothetical protein bmyco0001_27960 [Bacillus mycoides DSM 2048]
          Length = 210

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 62/190 (32%), Gaps = 20/190 (10%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFE 55
           + L +C I   + + ++  +  +    D     A +VL               RI  A  
Sbjct: 16  FLLMICSIILYVSYAAYDIWSYRFKTDDGVKTDAGIVLGAASWNGKPSPVFKERINHAIS 75

Query: 56  LLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           L +N   +KI  +G       + +    +   ++  + E  I I  K+L TE N + A  
Sbjct: 76  LYKNGNIKKIIFTGGTKFEAELEEARTARVYALKHGVKEEDILIETKSLFTEDNLKNAKQ 135

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
              +N      IV+   HM R     + I   ++    P  +   +          +   
Sbjct: 136 VGIENGIRTYTIVSDPLHMKRAMKIAKHI--KIEAYASPTPTSAYKTLD-----TEIPFF 188

Query: 173 LIEYLKILLL 182
             E    +  
Sbjct: 189 FKELCSYIGY 198


>gi|194448844|ref|YP_002044067.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205359241|ref|ZP_02668425.2| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194407148|gb|ACF67367.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205337510|gb|EDZ24274.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 249

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 63/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 47  RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 106

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 107 DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 166

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 167 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 219

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 220 QTRFLLRETFYYSGYRLLRYMPVQNNS 246


>gi|62178663|ref|YP_215080.1| hypothetical protein SC0093 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62126296|gb|AAX63999.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|322713116|gb|EFZ04687.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 206

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 64/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPS-VSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q    +        +V                R+
Sbjct: 4   RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRIADCAIVAGAGVSGKTPSPVFQARL 63

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 64  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S      
Sbjct: 124 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWA--- 176

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 177 QTRFLLRETFYYSGYRLLRYMPVQNNS 203


>gi|152993138|ref|YP_001358859.1| hypothetical protein SUN_1551 [Sulfurovum sp. NBC37-1]
 gi|151424999|dbj|BAF72502.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 248

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 63/215 (29%), Gaps = 33/215 (15%)

Query: 2   RYFWYGLFVCLIFFIMGF----ISFIRYVKQMHIPDHPSVSAIVVLTG------------ 45
           R+F  G+   ++     F    +  +         +  +   I VL              
Sbjct: 39  RFFLVGILWIILLSYAPFSSLLLLPLERQFSSVDLNGTNAGYIHVLGTAHVAREGIPLSS 98

Query: 46  -----EPIRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGY 98
                   R+     L +   G K+  SG      +S       +     + E  I +  
Sbjct: 99  ELDPSGLARVTEGVLLYKQHKGMKLVFSGYGKDEPLSNAKCSAALAQALGVREEDIIVFE 158

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
              +T   A   S  A+     HV++VT   HM R     ++    ++ I  P      +
Sbjct: 159 TPKDTLEEAGAMSEMAQ---GKHVVLVTSASHMLRASRLFKKA--GIKVIEAPTDFKVKK 213

Query: 159 ENSSIFKIKI-----LRVLLIEYLKILLLSIQLSL 188
            +  +                EYL +L   ++  +
Sbjct: 214 PDDLLQLPGAEGLRRSETAFHEYLGLLWFWLKGDI 248


>gi|258627463|ref|ZP_05722244.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258580269|gb|EEW05237.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 287

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 74/219 (33%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   +V  I+VL              
Sbjct: 49  LVVLFSFTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTVDYIMVLGNGHVVDDDIPPTS 108

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG       S   ++ ++ +   + +  I +  
Sbjct: 109 ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSEFSHARMMARVALALGVPKSDIILLE 168

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 169 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 223

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
                    I   R L        E L +L   ++ +++
Sbjct: 224 NIAQPWDKYIPKARYLEQTEQYWYETLGLLWQKLRDTVA 262


>gi|322435976|ref|YP_004218188.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX9]
 gi|321163703|gb|ADW69408.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX9]
          Length = 218

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 57/166 (34%), Gaps = 16/166 (9%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHI--PDHPSVSAIVVLTGE----------PIR 49
           R F    F  L+   MG+ S++     +           AI V                R
Sbjct: 23  RRFLLWCFCFLVLAAMGWSSWVVRQINLVAAQDQAQPADAIAVFGAAEYSGRPSPVYHAR 82

Query: 50  IERAFELLENQIGEKIFISGVHHSVS----KDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           ++ A  L   QI   +   G          +  + +   +   +    I     +++TE 
Sbjct: 83  LDHAVTLYRKQIAPIVITFGGGSDKDSGKTEGGVGRDYLLANGIPFDKIIAETHSVDTEQ 142

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
             +  +  AE+NN  H+++V+ + H+ R     +R    V   P P
Sbjct: 143 QVELLAQIAEENNLSHIVLVSDNTHLFRIQELCRRAGLDVYTSPRP 188


>gi|195873701|ref|ZP_02698260.2| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195632873|gb|EDX51327.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 237

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 63/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 35  RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 94

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 95  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 154

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  +   +  S      
Sbjct: 155 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRATRYK--SWWA--- 207

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 208 QTRFLLRETFYYSGYRLLRYMPVQNNS 234


>gi|15675952|ref|NP_273070.1| EpiH/GdmH-related protein [Neisseria meningitidis MC58]
 gi|7225229|gb|AAF40483.1| EpiH/GdmH-related protein [Neisseria meningitidis MC58]
 gi|316984529|gb|EFV63495.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325129274|gb|EGC52113.1| hypothetical protein NMBOX9930304_1979 [Neisseria meningitidis
           OX99.30304]
 gi|325139474|gb|EGC62014.1| periplasmic protein [Neisseria meningitidis CU385]
 gi|325199239|gb|ADY94694.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
          Length = 214

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|299138643|ref|ZP_07031821.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX8]
 gi|298599279|gb|EFI55439.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX8]
          Length = 203

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 25/190 (13%), Positives = 51/190 (26%), Gaps = 9/190 (4%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL--TGEPIRIERAFELLENQ 60
                    +I  ++G    +R    + +        IVVL    +  R   A  LL   
Sbjct: 5   RVIRASIAIIILLLVGAFRVVRSGSYLVVNQPERSDVIVVLAGDHDDHRYWGALALLRAG 64

Query: 61  IGEKIFISGVHHSVS----KDILLQKIPIRQDLAECCI-DIGYKALNTEGNAQEASAWAE 115
            G+K+ +             +     +       +  I        +T   A        
Sbjct: 65  YGQKMVMDASSDLTYGQTSAERAAAFVRQSAGSNQSQISICTITNDSTVQEAANIRNCLA 124

Query: 116 --KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    L+VT D+H  R    ++       +    +    +         +  +  L
Sbjct: 125 GLHPAPQSALLVTSDFHTRRALSIVRSRLPQYHWSVAAVNDSTIFGQPWWSNREWAKTAL 184

Query: 174 IEYLKILLLS 183
            E+ K++   
Sbjct: 185 YEWEKLVWWR 194


>gi|113477800|ref|YP_723861.1| hypothetical protein Tery_4400 [Trichodesmium erythraeum IMS101]
 gi|110168848|gb|ABG53388.1| protein of unknown function DUF218 [Trichodesmium erythraeum
           IMS101]
          Length = 273

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 28/233 (12%), Positives = 66/233 (28%), Gaps = 48/233 (20%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPD----------HPSVSAIVVLTGE-------- 46
                + ++      +  +   +Q+                   AIV+L           
Sbjct: 42  LIITALIVMIISSAPVFAVWSAQQVEEDAIEIVSVSACCDEKADAIVLLGQGTTQPIVPD 101

Query: 47  ---------PIRIERAFELLENQIGEKIFISGVHH-----SVSKDILLQKIPIRQDLAEC 92
                      RI  A EL +  +   I +S         +  +   + ++ +  ++   
Sbjct: 102 RIQIQLTKTAERITYAAELYKKGLAPYIIVSAGPRIGEDINTIEAEDITRVLVLLNVPRT 161

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
            I I   +     +A E      +      V++V+    + R  L    I   ++ IP P
Sbjct: 162 AIIIEPHSSTVYESAIETREILNERGLDPTVILVSSAIQIRRASLTFTDI--GMKVIPAP 219

Query: 152 IISHDLEEN----------SSIFKIKILRV---LLIEYLKILLLSIQLSLSTQ 191
              + +                   + + +   +  EYL +    ++  L+  
Sbjct: 220 TDFNTVNPYENSSYRFVLADFFPNTEAISLTTEVWEEYLALFYYFLRGWLAPS 272


>gi|241668569|ref|ZP_04756147.1| hypothetical protein FphipA2_07371 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 239

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 70/207 (33%), Gaps = 21/207 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIR----YVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   + +       G I+ I      ++   I    +  AI++L             
Sbjct: 34  LRYFVIIVTIIYYLVGNGLIANILAKPIRLESTDIKQCANTKAIILLGAGINQAFDKLEP 93

Query: 47  ----PIRIERAFELLENQIGEKIFISGVHHSVS--KDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G        +  +   I  +  + +  I +  ++
Sbjct: 94  SLSAYDRILKTAEVYNQYPQDIIISGGSPSGYKLSEAEVYADILYKLGIPKSKIRLEKQS 153

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NAQ        +N  + LI    ++  R  L     N     I    ++ ++   
Sbjct: 154 KNTYENAQFTKKILSDHNNTYCLITGGIHYQ-RAKLIFDSFNINTINIASSKLAPEISFL 212

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQLS 187
            S +   I + ++ EYL I+   + + 
Sbjct: 213 PSAYSFYITQAIIHEYLGIIKFYLSVK 239


>gi|59713990|ref|YP_206765.1| hypothetical protein VF_A0807 [Vibrio fischeri ES114]
 gi|59482238|gb|AAW87877.1| hypothetical protein VF_A0807 [Vibrio fischeri ES114]
          Length = 217

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/167 (18%), Positives = 58/167 (34%), Gaps = 11/167 (6%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG-------VHHSVSKDI 78
             +   +     AI VL    +R+ E A +L  +     +  SG          ++S+  
Sbjct: 15  YHLVNQEIRKSDAIFVLCSYDLRVAEHAAQLYLDGYAPLLIFSGAQGRATEGLFTLSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
               +     +    I +  KA NT  N     A  ++ N     +++V   Y   R   
Sbjct: 75  TFANVAKDMGVPSSAIIVETKATNTGENIFFTQALLKERNISVSSLILVQKPYMERRLLA 134

Query: 137 ELQRINSTVQF-IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
              +  + ++F I  P IS        I    I  ++L E  ++ + 
Sbjct: 135 TFLKNWNDIEFCISSPNISFINYPTDEITFDHIASIILGELHRLKVY 181


>gi|42519211|ref|NP_965141.1| hypothetical protein LJ1286 [Lactobacillus johnsonii NCC 533]
 gi|41583499|gb|AAS09107.1| hypothetical protein LJ_1286 [Lactobacillus johnsonii NCC 533]
          Length = 346

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 73/200 (36%), Gaps = 27/200 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
           Y +  L +  + FIM  +  +     +       +  +VVL               RI R
Sbjct: 141 YLFINLVIIYLIFIM-MMYTLTSWINLVNIKTKKLDYVVVLGAGLMGKKVTPLLAARINR 199

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             E+     G KI +SG       + + + + K    + + +  I +  K+  T  N   
Sbjct: 200 GIEVYRRNPGSKIIMSGGQGPGEEIPEAVAMAKYAEEKGVPKQDIIVEDKSKTTRENLIF 259

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           +    +        IVT+ YH+ R  +  +R+   +Q I Y   +         F +   
Sbjct: 260 SHKLMKP--DSRFAIVTNSYHVYRALVLAKRL--GLQCIGYGAKTK------WYFTLNAF 309

Query: 170 RVLLIEYLKILLLSIQLSLS 189
              + E++  L ++ +L LS
Sbjct: 310 ---VREFIAYLTITWRLQLS 326


>gi|329930281|ref|ZP_08283883.1| hypothetical protein HMPREF9412_2885 [Paenibacillus sp. HGF5]
 gi|328935150|gb|EGG31634.1| hypothetical protein HMPREF9412_2885 [Paenibacillus sp. HGF5]
          Length = 202

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 53/159 (33%), Gaps = 10/159 (6%)

Query: 32  PDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISG----VHHSVSKDILLQKIPIR 86
               +   I V       R+ +A EL        I  +G         ++  +++   +R
Sbjct: 29  DGRQTGDCIFVFGGRNLDRVWKAVELYNIGRAPYILFTGGDRFGEWEQTEAAMMRDEAMR 88

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRTFLELQRIN 142
             +    I +   + +T+ N   +    ++         +L+V+   HM R  L L+   
Sbjct: 89  MGIPAEAILMETMSNHTKENIMASLIVLDRALGLERIQRILLVSAPGHMRRCQLMLKTFM 148

Query: 143 STVQFIPY-PIISHDLEENSSIFKIKILRVLLIEYLKIL 180
                  + P        ++     +  + +L E  K++
Sbjct: 149 PPWYEYVWCPDDRSHGRRDNWWIDPEEEKRVLGELKKVI 187


>gi|325133332|gb|EGC55998.1| hypothetical protein NMBM13399_2155 [Neisseria meningitidis M13399]
          Length = 218

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 63/178 (35%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F   +F  ++ F   +  +       +P H    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFTSSVWAVYRTGGQVLPPHVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|325135386|gb|EGC58007.1| periplasmic protein [Neisseria meningitidis M0579]
 gi|325201201|gb|ADY96655.1| conserved hypothetical protein [Neisseria meningitidis M01-240149]
 gi|325207058|gb|ADZ02510.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33]
          Length = 214

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 64/178 (35%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F   +F F++ F   +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|56750108|ref|YP_170809.1| hypothetical protein syc0099_d [Synechococcus elongatus PCC 6301]
 gi|56685067|dbj|BAD78289.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 188

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/157 (19%), Positives = 59/157 (37%), Gaps = 8/157 (5%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFI 67
           L    +   +G +  +  V         S  AI VL G+P R + A EL +      I++
Sbjct: 4   LIPITLLLSLGVVWGLNRVAVAQ----RSPQAIFVLGGDPQREQFAAELAQTHPDLPIWV 59

Query: 68  SGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
           S   +        + +  +  +    + + Y+A +T  N    +   ++    HV +VT 
Sbjct: 60  SSGSNP----EYAEWVFGQAGVPRSRLHLDYQATDTLSNFTSLADRFQQQGIQHVYLVTS 115

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           DYHM R  +    + ++      P+       + S  
Sbjct: 116 DYHMRRALVIANIVFASRGITFEPVPVPFDRASESWR 152


>gi|218767273|ref|YP_002341785.1| putative periplasmic protein [Neisseria meningitidis Z2491]
 gi|121051281|emb|CAM07557.1| putative periplasmic protein [Neisseria meningitidis Z2491]
 gi|319409538|emb|CBY89825.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           WUE 2594]
          Length = 218

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 64/178 (35%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F   +F F++ F   +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKHPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|261252482|ref|ZP_05945055.1| hypothetical protein VIA_002504 [Vibrio orientalis CIP 102891]
 gi|260935873|gb|EEX91862.1| hypothetical protein VIA_002504 [Vibrio orientalis CIP 102891]
          Length = 211

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 37/121 (30%), Gaps = 10/121 (8%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I VL    IR+ E A  L      + +  SG    ++       +      I 
Sbjct: 22  QLEKSDCIFVLGSNDIRVAEHAANLYLQGWADWLIFSGGVGRLTQGTFETSEAETFAAIA 81

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH--HVLIVTHDYHMPRTFLELQRIN 142
               +    I I  +A NT  N +      ++ +      ++V   Y   RT    ++  
Sbjct: 82  QTMGVPHHAIIIENQATNTGENVRFTHQLLKERSIDVSSFILVQKPYMERRTLATFEKQW 141

Query: 143 S 143
            
Sbjct: 142 P 142


>gi|238911156|ref|ZP_04654993.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 206

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 64/207 (30%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI     + Q             +V                R+
Sbjct: 4   RYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQARL 63

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 64  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S   K  
Sbjct: 124 RYAKQILRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTCYK--SWWAK-- 177

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 178 -TRFLLRETFYYSGYRLLRYMPVQNNS 203


>gi|262171274|ref|ZP_06038952.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus MB-451]
 gi|261892350|gb|EEY38336.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus MB-451]
          Length = 277

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 74/219 (33%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 40  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTIDYVMVLGNGHVVDDDIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG       S   ++ ++ +   + +  I +  
Sbjct: 100 ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSEFSHARMMARVALALGVPKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 160 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 214

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
                    I   R L        E L +L   ++ +++
Sbjct: 215 NIAQPWDKYIPKARYLEQTEQYWYETLGLLWQKLRDTVA 253


>gi|323496573|ref|ZP_08101626.1| hypothetical protein VISI1226_13176 [Vibrio sinaloensis DSM 21326]
 gi|323318319|gb|EGA71277.1| hypothetical protein VISI1226_13176 [Vibrio sinaloensis DSM 21326]
          Length = 208

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 43/123 (34%), Gaps = 10/123 (8%)

Query: 31  IPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQK 82
             +  +   I VL    +R+ E A  L       KI  SG    ++       +     +
Sbjct: 17  NHELKASECIFVLGSNDLRVAEYAATLYHQGWANKILFSGGFGRLTAGNFDRSEAETFAQ 76

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMPRTFLELQR 140
           +     +    I I  KA NT  N Q ++   +++N  F   ++V   Y   RT     +
Sbjct: 77  VARDLGVPAQDILIEDKATNTGENVQFSAELLKQHNLCFSSFILVQKPYMERRTLATFTK 136

Query: 141 INS 143
              
Sbjct: 137 QWP 139


>gi|320530702|ref|ZP_08031746.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
 gi|320136989|gb|EFW28927.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
          Length = 258

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 59/145 (40%), Gaps = 22/145 (15%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPI------------------RIERAFELLENQIGEKIFIS 68
           +   +P+HP    I++L G  I                  R+  A  L        +   
Sbjct: 73  RTYPVPEHPQGDVIIMLGGGAIGGVQDVDGEGMLAPSPASRLLTAVRLHRLYGLPILLSG 132

Query: 69  GV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           G     + ++  + +++ I   + E  I    ++L T  NA+ ++    +  F H ++VT
Sbjct: 133 GQVFKDTGTEAEIARRVLISLGVPEEQIYTESESLTTRQNARYSAEILHREGFTHPILVT 192

Query: 127 HDYHMPRTFLELQRINSTVQFIPYP 151
             +H+PR  L  +++   ++  PYP
Sbjct: 193 SAFHLPRAVLNFEKL--GIEVTPYP 215


>gi|326561174|gb|EGE11539.1| hypothetical protein E9G_04999 [Moraxella catarrhalis 7169]
 gi|326567938|gb|EGE18035.1| hypothetical protein E9Q_04434 [Moraxella catarrhalis BC1]
          Length = 252

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 57/212 (26%), Gaps = 38/212 (17%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSA--IVVLTGE--------------- 46
              G+   L          +  +            A  IVVL G                
Sbjct: 33  ILIGVASALTPIFANLGVSLLNLYSALTLATVQDDATSIVVLGGGLTKNSAGTISLNHFT 92

Query: 47  PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQ-DLAECCIDIGYKALNTEG 105
             R   A  L +      I              L+   I      +  I     ++NT  
Sbjct: 93  QSRANAAIHLHKLYPLSIITSGAESPW------LRDYLIEHIGRTKVVIINENASMNTCE 146

Query: 106 NAQEASAWAEKNNFHHVL-IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
           NA   +     +     + +VT  YHM R   +  +    +  IP P     L   SS  
Sbjct: 147 NAVFTAKLLSHHELSTTVYLVTDRYHMARARRQFAKA--GIHTIPAPAP---LAIRSSWQ 201

Query: 165 KIK----ILRVLLIEYLKILLLSIQLSLSTQT 192
             K      R  + E    L+   +  ++ QT
Sbjct: 202 NPKDNLIHTRRTIYE----LVALARDIITPQT 229


>gi|261401556|ref|ZP_05987681.1| putative periplasmic protein [Neisseria lactamica ATCC 23970]
 gi|269208394|gb|EEZ74849.1| putative periplasmic protein [Neisseria lactamica ATCC 23970]
          Length = 218

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|168186754|ref|ZP_02621389.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
 gi|169295259|gb|EDS77392.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
          Length = 253

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/194 (17%), Positives = 65/194 (33%), Gaps = 28/194 (14%)

Query: 4   FWYGLFVCLIFFIMGFISF-IRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
             + L VC+   I  FI      +       +P    I+VL               R++R
Sbjct: 62  LRFVLKVCISLGIASFIILESLIIYSGISNKNPKSDYIIVLGAAVHGDYMSLILKERVDR 121

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           + E L      K+ +SG       +++   +++  +   +    I     +  T  N + 
Sbjct: 122 SLEYLREYPSTKVIVSGGKGPGEFITEAEAMKRYLVENGVKNSQIIKEENSRTTAENFKY 181

Query: 110 ASAWAEKNNFHHV---LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           +S   E  +        +VT ++HM R  +  +R  S ++    P   H     +     
Sbjct: 182 SSKIIENMDKERTPTVSVVTTNFHMLRAKMLAKR--SGLKVNGIPARGHISSAPNYY--- 236

Query: 167 KILRVLLIEYLKIL 180
                 + EY   +
Sbjct: 237 ------IREYFAFI 244


>gi|59802238|ref|YP_208950.1| hypothetical protein NGO1925 [Neisseria gonorrhoeae FA 1090]
 gi|161869022|ref|YP_001598188.1| periplasmic protein [Neisseria meningitidis 053442]
 gi|194099817|ref|YP_002002952.1| Periplasmic protein [Neisseria gonorrhoeae NCCP11945]
 gi|239999990|ref|ZP_04719914.1| Periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|240013062|ref|ZP_04719975.1| Periplasmic protein [Neisseria gonorrhoeae DGI18]
 gi|240017631|ref|ZP_04724171.1| Periplasmic protein [Neisseria gonorrhoeae FA6140]
 gi|240081888|ref|ZP_04726431.1| Periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|240114167|ref|ZP_04728657.1| Periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|240116805|ref|ZP_04730867.1| Periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|240119033|ref|ZP_04733095.1| Periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|240122252|ref|ZP_04735214.1| Periplasmic protein [Neisseria gonorrhoeae PID24-1]
 gi|240122429|ref|ZP_04735385.1| Periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|240126722|ref|ZP_04739608.1| Periplasmic protein [Neisseria gonorrhoeae SK-92-679]
 gi|240127142|ref|ZP_04739803.1| Periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
 gi|254493442|ref|ZP_05106613.1| periplasmic protein [Neisseria gonorrhoeae 1291]
 gi|260441598|ref|ZP_05795414.1| Periplasmic protein [Neisseria gonorrhoeae DGI2]
 gi|268595796|ref|ZP_06129963.1| periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|268597985|ref|ZP_06132152.1| periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|268600240|ref|ZP_06134407.1| periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|268602480|ref|ZP_06136647.1| periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|268604748|ref|ZP_06138915.1| periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|268681017|ref|ZP_06147879.1| periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|268685301|ref|ZP_06152163.1| periplasmic protein [Neisseria gonorrhoeae SK-92-679]
 gi|268685499|ref|ZP_06152361.1| periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291044968|ref|ZP_06570677.1| periplasmic protein [Neisseria gonorrhoeae DGI2]
 gi|293398039|ref|ZP_06642245.1| periplasmic protein [Neisseria gonorrhoeae F62]
 gi|296313265|ref|ZP_06863206.1| putative periplasmic protein [Neisseria polysaccharea ATCC 43768]
 gi|59719133|gb|AAW90538.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|161594575|gb|ABX72235.1| periplasmic protein [Neisseria meningitidis 053442]
 gi|193935107|gb|ACF30931.1| Periplasmic protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512482|gb|EEH61827.1| periplasmic protein [Neisseria gonorrhoeae 1291]
 gi|268549185|gb|EEZ44603.1| periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|268551773|gb|EEZ46792.1| periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|268584371|gb|EEZ49047.1| periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|268586611|gb|EEZ51287.1| periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|268588879|gb|EEZ53555.1| periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|268621301|gb|EEZ53701.1| periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|268625585|gb|EEZ57985.1| periplasmic protein [Neisseria gonorrhoeae SK-92-679]
 gi|268625783|gb|EEZ58183.1| periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291011862|gb|EFE03858.1| periplasmic protein [Neisseria gonorrhoeae DGI2]
 gi|291611985|gb|EFF41054.1| periplasmic protein [Neisseria gonorrhoeae F62]
 gi|296840237|gb|EFH24175.1| putative periplasmic protein [Neisseria polysaccharea ATCC 43768]
 gi|317165286|gb|ADV08827.1| hypothetical protein NGTW08_1872 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 218

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|258627444|ref|ZP_05722225.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258580250|gb|EEW05218.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 214

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 39/122 (31%), Gaps = 10/122 (8%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIP 84
              S   I+VL    +R+ E A +L    I   +  SG            ++      I 
Sbjct: 21  QPESADVILVLGSNDVRVAEHAAKLYHQGIAPCVLFSGGLGRFTQGVFQHTEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N + +      +      +L+V   Y   R +    +  
Sbjct: 81  KEAGVPEQAILLETQSTNSGENVRFSHQLLTQKAQPIKRILLVQKPYMERRAYATFMKQW 140

Query: 143 ST 144
             
Sbjct: 141 PD 142


>gi|227890086|ref|ZP_04007891.1| membrane protein [Lactobacillus johnsonii ATCC 33200]
 gi|227849530|gb|EEJ59616.1| membrane protein [Lactobacillus johnsonii ATCC 33200]
          Length = 346

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 76/212 (35%), Gaps = 27/212 (12%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
           Y +  L +  + FIM  +  +     +       +  +VVL               RI R
Sbjct: 141 YLFINLVIIYLIFIM-MMYTLTSWINLVNIKTKKLDYVVVLGAGLMGKKVTPLLAARINR 199

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             E+     G KI +SG       + + + + K    + + +  I +  K+  T  N   
Sbjct: 200 GIEVYRRNPGSKIIMSGGQGPGEEIPEAVAMAKYAEEEGIPKQDIIVEDKSKTTRENLIF 259

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           +    +        IVT+ YH+ R  +  +R+   +Q I Y   +         F +   
Sbjct: 260 SHRLMKP--DSRFAIVTNSYHVYRALVLAKRL--GLQCIGYGAKTK------WYFTLNAF 309

Query: 170 RVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
              + E++  L ++ +L LS        + ++
Sbjct: 310 ---VREFIAYLTITWRLQLSVVGCIGLGVVVL 338


>gi|149191740|ref|ZP_01869980.1| hypothetical protein VSAK1_04082 [Vibrio shilonii AK1]
 gi|148834429|gb|EDL51426.1| hypothetical protein VSAK1_04082 [Vibrio shilonii AK1]
          Length = 297

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 82/232 (35%), Gaps = 39/232 (16%)

Query: 5   WYGLFVCLIFFIMGFISF-------IRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              L      F++ F          +       +P + ++  ++VL G            
Sbjct: 40  LIILVSLCGTFLISFQPLSSRLLMPLERQYSAFLPINETIDYVMVLGGGHVVDDQIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L    G K+ +SG      VS    + K+ +   +A+  I +  
Sbjct: 100 ELSRASLMRLSEGIRILRMYPGAKLILSGYDGGTGVSHARTMAKVALALGIAKPDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHD 156
            A +T   A++A+ + +      +++VT   HM R   E +     +  +P P    +  
Sbjct: 160 TAKDTWEEARQAAGFVQN---KKLVLVTSASHMKRAMHEFEAA--GLNPLPAPTNFLAQK 214

Query: 157 LEENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIE 202
             E +        R L        E + ++  +++  ++ +   +F  ++ E
Sbjct: 215 DIEQAWQKYTPSSRYLEQTERYWHETMGLIWQNLRDWVANEGNQEFLPSVSE 266


>gi|262165865|ref|ZP_06033602.1| hypothetical protein VMA_002314 [Vibrio mimicus VM223]
 gi|262025581|gb|EEY44249.1| hypothetical protein VMA_002314 [Vibrio mimicus VM223]
          Length = 214

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 39/122 (31%), Gaps = 10/122 (8%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIP 84
              S   I+VL    +R+ E A +L    I   +  SG            ++      I 
Sbjct: 21  QPESADVILVLGSNDVRVAEHAAKLYHQGIAPCVLFSGGLGRFTQGVFQHTEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N + +      +      +L+V   Y   R +    +  
Sbjct: 81  KEAGVPEQAILLETQSTNSGENVRFSHQLLTQKAQPIKRILLVQKPYMERRAYATFMKQW 140

Query: 143 ST 144
             
Sbjct: 141 PD 142


>gi|254455840|ref|ZP_05069269.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082842|gb|EDZ60268.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 228

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 64/197 (32%), Gaps = 32/197 (16%)

Query: 19  FISFIRYVKQMHIPDH-PSVSAIVV-----------------LTGEPIRIERAFELLENQ 60
            ++++    Q+  P +     +IVV                       RI     L + +
Sbjct: 35  LVAYLESDYQLSKPSNIEPADSIVVLSGMIRTINSKDGLDYEFGEASDRIFAGINLFKEK 94

Query: 61  IGEKIFISGVHHSV----SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
              K+ ++           +   L++I I   ++E  I +     NT+  A+       +
Sbjct: 95  KAPKLILTRGKLPWSVGIPEGEYLKEIAINNGISENNILLTENVENTDQEAKAIKKLLSE 154

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI-------KIL 169
           +    VL+VT  +HMPR     +     +  +P+P+         +              
Sbjct: 155 DK-SKVLLVTSAFHMPRAQKVFEAA--GINVVPFPVDFQKGLSKITFMSFIPSANALSGT 211

Query: 170 RVLLIEYLKILLLSIQL 186
              + E +  +  +++ 
Sbjct: 212 SFFVREMIGRIYYNLKY 228


>gi|325143566|gb|EGC65887.1| hypothetical protein NMBM01240013_2108 [Neisseria meningitidis
           M01-240013]
 gi|325205110|gb|ADZ00563.1| conserved hypothetical protein [Neisseria meningitidis M04-240196]
          Length = 218

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 64/178 (35%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F   +F F++ F   +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|209551623|ref|YP_002283540.1| hypothetical protein Rleg2_4052 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537379|gb|ACI57314.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 262

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 61/188 (32%), Gaps = 29/188 (15%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGV 70
           C+I    GF + +   +   I  + +            R   A  L +     +I +SG 
Sbjct: 80  CMIVLGGGFENEVNTARHG-IEFNAAAD----------RFVEALRLAQKFPQSRILVSGG 128

Query: 71  HH-----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
                          ++      + +  +    ++  T  NA     +       + L++
Sbjct: 129 DGSLSGIYEGDAAASERFFPLFGVGKDRLIEERQSRTTFENAVNTKEFLASQGLANCLLI 188

Query: 126 THDYHMPRTFLELQRINSTVQFIPYPIISH---------DLEENSSIFKIKILRVLLIEY 176
           T  +HMPR+    +++   +  +P+P             D  + +     + +   + E+
Sbjct: 189 TSGFHMPRSVGIFRKL--GIDIVPWPTDYRTDGRVKAGLDFTQPN--LNAQNMATAIREW 244

Query: 177 LKILLLSI 184
             ++   +
Sbjct: 245 YGLVGYYL 252


>gi|160902984|ref|YP_001568565.1| hypothetical protein Pmob_1541 [Petrotoga mobilis SJ95]
 gi|160360628|gb|ABX32242.1| protein of unknown function DUF218 [Petrotoga mobilis SJ95]
          Length = 214

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 71/214 (33%), Gaps = 38/214 (17%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSA-----------IVVLTGE------------ 46
           VC++ +I     F + +       +P V+            IVVL G             
Sbjct: 2   VCIVIYIFSSGWFAKIIVLPLENRYPPVNVSQLDDTQEKGVIVVLGGGIIPETPREGSGE 61

Query: 47  -----PIRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYK 99
                  R+   F L +N     +   G  +   + +  ++++  ++  +    I +   
Sbjct: 62  LSDSAMKRVYEGFLLYKNLQIPIVVTGGKLLGTEIPEAQIMKEELLKMGVKPNDIYVEPL 121

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           A NT+ NA+      E +    + ++T   H+PR     +     +  +P P       E
Sbjct: 122 AKNTKQNAEFTLTLLESDEVQKIYLITSAIHLPRAMNYFKSYT-NIDVVPVPTDYKISRE 180

Query: 160 N-SSIFKIKILRVL------LIEYLKILLLSIQL 186
                  +  +R L        EYL ++   I  
Sbjct: 181 ELKWYDFLPDMRFLEATSSAWHEYLGLVKFKISG 214


>gi|325143399|gb|EGC65728.1| hypothetical protein NMB9615945_0016 [Neisseria meningitidis
           961-5945]
          Length = 218

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|34581055|ref|ZP_00142535.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262440|gb|EAA25944.1| unknown [Rickettsia sibirica 246]
          Length = 171

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 66/149 (44%), Gaps = 7/149 (4%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66
            L      ++ GF  ++  +    +  +   +AI+V  G   +IE     L+      +F
Sbjct: 5   FLLTIFALWVGGFGYYLYLINSYKLNSNT-TNAIIVFAGGGHKIETGIAWLKAGYAPILF 63

Query: 67  ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           I+G+  +    ILL++  +   + +  I    K ++ E N ++   +    N   +++V 
Sbjct: 64  ITGIESTEQLKILLKERNV---IEQQVIFAPNKIMSEEDNIKKVVDFIVTYNLTSIILVE 120

Query: 127 HDYHMPRTFLELQRINS---TVQFIPYPI 152
           H+Y+MP    +L++       +  +PYP+
Sbjct: 121 HNYNMPFMLNKLEKAIPSSNNIYIVPYPV 149


>gi|255744859|ref|ZP_05418809.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholera CIRS 101]
 gi|262161858|ref|ZP_06030876.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae INDRE 91/1]
 gi|262189661|ref|ZP_06048039.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae CT 5369-93]
 gi|255737330|gb|EET92725.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholera CIRS 101]
 gi|262028590|gb|EEY47245.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae INDRE 91/1]
 gi|262034459|gb|EEY52821.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae CT 5369-93]
 gi|327484319|gb|AEA78726.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio cholerae LMA3894-4]
          Length = 273

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 79/234 (33%), Gaps = 42/234 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 40  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTLDYVMVLGNGHVIDDDIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG      VS   ++ ++ +   + +  I +  
Sbjct: 100 ELTRAALMRLTEGIRISRMYPGSKLILSGYAGGSEVSHARMMARVALALGVPKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 160 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 214

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIEEI 204
                    I   R L        E L ++  +++ +++  +       L   +
Sbjct: 215 NIIQPWDKYIPRSRYLEQTEQYWHETLGLMWQTLRDTVAGDSGE---PVLTPPV 265


>gi|196033543|ref|ZP_03100955.1| conserved hypothetical protein [Bacillus cereus W]
 gi|195993977|gb|EDX57933.1| conserved hypothetical protein [Bacillus cereus W]
          Length = 192

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 75/194 (38%), Gaps = 26/194 (13%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELL 57
             + +    MGF+ +    K   +        I+VL  +            R+++A E L
Sbjct: 12  GIIMVCVVYMGFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRMDKAAEYL 70

Query: 58  ENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           ++       +SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +    
Sbjct: 71  KSHEKAIAIVSGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI 130

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             +N    +IVT+D+HM R      + N  ++ +P       +  ++           + 
Sbjct: 131 -PDNMKKGMIVTNDFHMFRAKKIAAKQNLQLEGLPAATPKRIVIPSN-----------IR 178

Query: 175 EYLKILLLSIQLSL 188
           EYL I        +
Sbjct: 179 EYLAITQYWFMDRI 192


>gi|262171294|ref|ZP_06038972.1| hypothetical protein VII_002110 [Vibrio mimicus MB-451]
 gi|261892370|gb|EEY38356.1| hypothetical protein VII_002110 [Vibrio mimicus MB-451]
          Length = 214

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 39/122 (31%), Gaps = 10/122 (8%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIP 84
              S   I+VL    +R+ E A +L    I   +  SG            ++      I 
Sbjct: 21  QPESADVILVLGSNDVRVAEHAAKLYHQGIAPCVLFSGGLGRFTQGVFQHTEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  K+ N+  N + +      +      +L+V   Y   R +    +  
Sbjct: 81  KEAGVPEQAILLETKSTNSGENVRFSHQLLTQKAQPIKRILLVQKPYMERRAYATFMKQW 140

Query: 143 ST 144
             
Sbjct: 141 PD 142


>gi|254671270|emb|CBA08572.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
          Length = 218

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIIFTGGRSKKGYMTEAEVGRRYALKQGIPPRNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|121727926|ref|ZP_01680974.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147675084|ref|YP_001217265.1| hypothetical protein VC0395_A1321 [Vibrio cholerae O395]
 gi|121629776|gb|EAX62192.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|146316967|gb|ABQ21506.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227013622|gb|ACP09832.1| conserved hypothetical protein [Vibrio cholerae O395]
          Length = 282

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 78/234 (33%), Gaps = 42/234 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 49  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTLDYVMVLGNGHVIDDDIPPTS 108

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG      VS   ++ ++ +   + +  I +  
Sbjct: 109 ELTRAALMRLTEGIRISRMYPGSKLILSGYAGGSEVSHARMMARVALALGVPKSDIILLE 168

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 169 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 223

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIEEI 204
                    I   R L        E L ++  +++ +++          L   +
Sbjct: 224 NIIQPWDKYIPRSRYLEQTEQYWHETLGLMWQTLRDTVA---GDSSEPVLTPPV 274


>gi|325917198|ref|ZP_08179425.1| hypothetical protein XVE_3418 [Xanthomonas vesicatoria ATCC 35937]
 gi|325536588|gb|EGD08357.1| hypothetical protein XVE_3418 [Xanthomonas vesicatoria ATCC 35937]
          Length = 183

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 52/166 (31%), Gaps = 16/166 (9%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLEN 59
           + LI+ +      +    +           I+VL               RI  A +L   
Sbjct: 2   LALIWLVAVAAWIVWVGDR---DQAAPADVIIVLGAAAYDARPSPVFEERIRHALDLYGQ 58

Query: 60  QIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
               ++  +G   +    ++  + ++  +R  +    I I   +  T  N  +A A  E+
Sbjct: 59  GYAPRLLFTGGFGNGARFAESQVARRYALRHGVPPEAIVIETSSRTTRQNLLQARALMER 118

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           +  H  +IV+   HM R     Q +         P         S 
Sbjct: 119 HGMHRAIIVSDPLHMARALRLCQELGVDALASSTPSTRFRSFHTSW 164


>gi|298370445|ref|ZP_06981761.1| membrane protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281905|gb|EFI23394.1| membrane protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 199

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/165 (17%), Positives = 57/165 (34%), Gaps = 17/165 (10%)

Query: 2   RYFWYG-LFVCLIFFIMGFIS---FIRY---VKQMHIPDHPSVSAIVVLTGEPI------ 48
           +  W G   V L   + G++    F R    V+ +   D   +  I V            
Sbjct: 4   KILWIGTGLVILWLLLFGWVWGNNFYRSRQPVESIAPADTAVILGISVHDEGRQNPCLIS 63

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK--DILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+E   EL +    +K+ +SG  +         + +   +  +    I++   +  T  N
Sbjct: 64  RVEAGVELWKAGKVKKLIMSGGMNHDGYVGAQSMMQTAEKMGIPREVIELEDHSETTHQN 123

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP 151
               +   E+     V+IV+  YH+PR      ++        + 
Sbjct: 124 ILYTAPMIEQ--DKSVVIVSSAYHIPRARWIAGKLWRRKNIQTFA 166


>gi|258621860|ref|ZP_05716890.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258585798|gb|EEW10517.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 214

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 39/122 (31%), Gaps = 10/122 (8%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIP 84
              S   I+VL    +R+ E A +L    I   +  SG            ++      I 
Sbjct: 21  QPESADVILVLGSNDVRVAEHAAKLYHQGIAPCVLFSGGLGRFTQGVFQHTEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  K+ N+  N + +      +      +L+V   Y   R +    +  
Sbjct: 81  KEAGVPEQAILLETKSTNSGENVRFSHQLLTQKAQPIKRILLVQKPYMERRAYATFMKQW 140

Query: 143 ST 144
             
Sbjct: 141 PD 142


>gi|260223391|emb|CBA33910.1| hypothetical protein Csp_B21400 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 256

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/157 (12%), Positives = 48/157 (30%), Gaps = 12/157 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCIDI 96
           ++     R+  +  L        +  +G          S+    ++      +    +  
Sbjct: 102 LINDGGERLAVSAALALRHPALPLVYTGGEGDPAGGGPSEAARARQFYESFRIPAVQVRY 161

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
             ++ NT  NA   +     N     L++T  +HMPR+    ++         YP+    
Sbjct: 162 EAESRNTYENAVLTAKLPGVNPQDRWLLMTSAWHMPRSMATFEKA--GWNVTAYPVDYRA 219

Query: 157 LEENSSIFKI-----KILRVLLIEYLKILLLSIQLSL 188
            +                +++L E + +    +   L
Sbjct: 220 EDVTVWTRYSLLGGVSDWQLVLNELVGLAAYRLTGRL 256


>gi|228907351|ref|ZP_04071209.1| hypothetical protein bthur0013_15180 [Bacillus thuringiensis IBL
           200]
 gi|228852212|gb|EEM97008.1| hypothetical protein bthur0013_15180 [Bacillus thuringiensis IBL
           200]
          Length = 194

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 9   MKCILVVIMICAVYM--GFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRI 65

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 66  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 125

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 126 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 178

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 179 -----VREYLAITQYWFMNRI 194


>gi|329930832|ref|ZP_08284231.1| hypothetical protein HMPREF9412_4101 [Paenibacillus sp. HGF5]
 gi|328934534|gb|EGG31039.1| hypothetical protein HMPREF9412_4101 [Paenibacillus sp. HGF5]
          Length = 217

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 66/202 (32%), Gaps = 21/202 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R   Y L   ++  +         ++        +    ++L               R+E
Sbjct: 21  RRGIYTLLSLVVLGVFWSGYAYWKIESAVSRPAENADVGIILGASMWGDQPSPGLRERLE 80

Query: 52  RAFELLENQIGEKIFISGVHHSV----SKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
            A         +   ++G         ++   ++   +   + E  I +  +A +T  N 
Sbjct: 81  HALVEYNAGRFDTFIVTGGLDKPEYNYTEAEGMRNFLVEAGVPEERIFLENEATSTYENL 140

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             + A  E++ ++  +IVTHDYH  R       +            S  L E++ +   K
Sbjct: 141 LYSQAIMEEHGWNTAIIVTHDYHGTRAMEVATALGYDQ-------PSMSLTESTVLPMAK 193

Query: 168 ILRVLLIEYLKILLLSIQLSLS 189
                ++ Y K     + +++ 
Sbjct: 194 HKSREVLAYTKWTADRLLIAMG 215


>gi|326204163|ref|ZP_08194023.1| protein of unknown function DUF218 [Clostridium papyrosolvens DSM
           2782]
 gi|325985674|gb|EGD46510.1| protein of unknown function DUF218 [Clostridium papyrosolvens DSM
           2782]
          Length = 256

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 66/200 (33%), Gaps = 28/200 (14%)

Query: 2   RYFWYGLFVCLIFFIMGFISF-IRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           R          + +++ F       +          V +++VL               R+
Sbjct: 65  RKLIKVFTGLFLIWLVSFAIITAVIITSAMSDKEQKVDSVIVLGAGLKGETPTLVLKKRL 124

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +   +  ++    KI +SG      ++++   +++  ++ D+ E  I     + +T  N 
Sbjct: 125 DYTLDYYKSNPDVKIIVSGGQGIGETITEAEAMKRYLVKHDIPENIILKEESSTSTYENM 184

Query: 108 QEASAWAEK---NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
             +    E         V+I+T+D+HM R  +  +R         Y I S          
Sbjct: 185 LYSKKAYENTIGKPLDKVMIITNDFHMFRAKILAKRAG----LKAYGISSG----TPWYI 236

Query: 165 KIKILRVLLIEYLKILLLSI 184
                 V L EY  +    I
Sbjct: 237 YPN---VCLREYFALFKSLI 253


>gi|229085586|ref|ZP_04217821.1| hypothetical protein bcere0022_21960 [Bacillus cereus Rock3-44]
 gi|228697734|gb|EEL50484.1| hypothetical protein bcere0022_21960 [Bacillus cereus Rock3-44]
          Length = 150

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 55/150 (36%), Gaps = 14/150 (9%)

Query: 50  IERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           +E+A  L E  +   I  SG +      ++   L+KI +   + E  I    KA +T  N
Sbjct: 1   MEKAASLYEQGLAPYIVPSGGYKHHVGTTEWDFLRKIGVEHGVPETAILREDKAQHTLEN 60

Query: 107 AQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINS-TVQFIPYPIISH-DLEENSS 162
           A+ +     K     + V+IV    H  R  L  Q       +F   P++    + + + 
Sbjct: 61  ARLSLEVLHKTGVYPNKVIIVCKAGHSRRALLCYQAEFPKETEFFVAPVVDRYGITKENW 120

Query: 163 IFKIKILRVLLIEYLK-------ILLLSIQ 185
                 +  ++ E  K        +   ++
Sbjct: 121 FSTEIGISRIMTEVEKIGKYFSPYIQTWLK 150


>gi|218896648|ref|YP_002445059.1| hypothetical protein BCG9842_B3664 [Bacillus cereus G9842]
 gi|218542086|gb|ACK94480.1| conserved hypothetical protein [Bacillus cereus G9842]
          Length = 192

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+     + +C ++   GF+ +    K  H+        I+VL  +            RI
Sbjct: 7   MKCILVVIMICAVYM--GFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRI 63

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N 
Sbjct: 64  DKAAEYLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             +       +    +IVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 124 TFSKPLI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN------ 176

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 177 -----VREYLAITQYWFMNRI 192


>gi|162454961|ref|YP_001617328.1| hypothetical protein sce6679 [Sorangium cellulosum 'So ce 56']
 gi|161165543|emb|CAN96848.1| hypothetical protein sce6679 [Sorangium cellulosum 'So ce 56']
          Length = 208

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/195 (13%), Positives = 56/195 (28%), Gaps = 14/195 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------IRIERAF 54
               +         ++          PD     A+V L  +             R   A 
Sbjct: 16  VIGLMAFAVAAFTPVAAPLDRWMASAPDAGQADAVVALGADVDPDGRLPEDSLRRAVEAV 75

Query: 55  ELLENQIGEKIFISGVHHSV-SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
            L        + + G  +   S+     ++  R  +    +    + L T   AQ ++  
Sbjct: 76  ALYREGRAPLVLMLGSRNGPASEAESRARLAQRLGVPASALLTEPRGLTTAVEAQRSAEL 135

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                   +L+VT  + + R     +R     + +  P+       N    ++  +  LL
Sbjct: 136 LLPRGARRILLVTGAHRIARARRLFERA--GFEVLAAPVPEGSPASNIPGERLSAIGRLL 193

Query: 174 IEYLKILLLSIQLSL 188
            E     L  ++  +
Sbjct: 194 QELAARALSRLRGEV 208


>gi|319947862|ref|ZP_08022049.1| hypothetical protein ES5_00997 [Dietzia cinnamea P4]
 gi|319438468|gb|EFV93401.1| hypothetical protein ES5_00997 [Dietzia cinnamea P4]
          Length = 205

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 57/192 (29%), Gaps = 21/192 (10%)

Query: 5   WYGLFVCLIFFIM-GFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERA 53
           W      L+  ++ GFI+F R      I D     AIVVL               R+E A
Sbjct: 7   WVLTIALLLCLVIPGFIAF-RVWHVARIDDRTPADAIVVLGAAQYNGVPTPVFQARLEHA 65

Query: 54  FELLENQIGEKIFISGVHHSVSKDILL---QKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
             L +  +  +I   G              +    R  +    +       NTEG+    
Sbjct: 66  ALLHDEGVAPQIITVGGGQPGDLYTEAGSGRAYLTRLGVPPEAVLAVETGTNTEGSLDAV 125

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILR 170
           +          V++V+   H  R+ +  +              S      +   +   + 
Sbjct: 126 AQTVRDQGGQSVVLVSDPTHSYRSRMMARDAGLD------AWTSPTRHGPAVWTRENQIM 179

Query: 171 VLLIEYLKILLL 182
            ++ E   +L  
Sbjct: 180 SIIRETGAVLWY 191


>gi|262404114|ref|ZP_06080669.1| hypothetical protein VOA_002104 [Vibrio sp. RC586]
 gi|262349146|gb|EEY98284.1| hypothetical protein VOA_002104 [Vibrio sp. RC586]
          Length = 215

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/151 (12%), Positives = 45/151 (29%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIP 84
                  I+VL    +R+ E A +L    I  ++  SG            ++  +   + 
Sbjct: 21  QPEPADVILVLGSNDVRVAEHAAKLYHQGIAPRVLFSGGLGRFTQGVFQQTEAEIFAALA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KEAGVPEKAILLETQSTNSGENILFSHHLLAQQAQPIQRILLVQKPYMERRAYATFMKQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S  +     +        ++
Sbjct: 141 PD-TIESVQVTSSGVSFFDYLTSELTSDFVI 170


>gi|254877103|ref|ZP_05249813.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843124|gb|EET21538.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 231

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 70/207 (33%), Gaps = 21/207 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIR----YVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   + +       G I+ I      ++   I    +  AI++L             
Sbjct: 26  LRYFVIIVTIIYYLVGNGLIANILAKPIRLESTDIKQCANTKAIILLGAGINQAFDKLEP 85

Query: 47  ----PIRIERAFELLENQIGEKIFISGVHHSVS--KDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G        +  +   I  +  + +  I +  ++
Sbjct: 86  SLSAYDRILKTAEVYNQYPQDIIISGGSPSGYKLSEAEVYADILYKLGIPKSKIRLEKQS 145

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NAQ        +N  + LI    ++  R  L     N     I    ++ ++   
Sbjct: 146 KNTYENAQFTKKILSDHNNTYCLITGGIHYQ-RAKLIFDSFNINTINIASSKLAPEISFL 204

Query: 161 SSIFKIKILRVLLIEYLKILLLSIQLS 187
            S +   I + ++ EYL I+   + + 
Sbjct: 205 PSAYSFYITQAIIHEYLGIIKFYLSVK 231


>gi|119358364|ref|YP_913008.1| hypothetical protein Cpha266_2596 [Chlorobium phaeobacteroides DSM
           266]
 gi|119355713|gb|ABL66584.1| protein of unknown function DUF218 [Chlorobium phaeobacteroides DSM
           266]
          Length = 250

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 71/217 (32%), Gaps = 35/217 (16%)

Query: 3   YFWYGLFVCLIFFIMGFISFIR---YVKQMHIPDHPSVSAIVVL---------------T 44
           +    L+V  +     F++ +    Y  +      P   A+VVL                
Sbjct: 36  FGVALLWVFSMPVTGDFLTRLVCGVYSFRGSAASLPDADAVVVLSGMIERVDGAPLGEWG 95

Query: 45  GEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYK 99
               R +   EL        +  +G         V +  LL +  +   ++   I +  K
Sbjct: 96  EAVDRFDGGIELFRAGKAPLLVFTGGWIPWRPDRVPEGELLSRRAVLLGVSPEAIRVTEK 155

Query: 100 ALNTEGNAQEASAWAEK--NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII---- 153
             NT   A            +   V++VT  YHM R+ L  +R    ++ IP+P+     
Sbjct: 156 VENTAEEAVAVRRLLGSGLGSEKTVILVTSAYHMHRSVLLFRRE--GLRVIPFPVDFSFG 213

Query: 154 -SHDLEENSSIFKIKILRV---LLIEYLKILLLSIQL 186
               L   S +     LR+    L E L I    ++ 
Sbjct: 214 GPESLTVLSFLPDAGALRLSERALRELLGIAFYRVKG 250


>gi|90424829|ref|YP_533199.1| hypothetical protein RPC_3338 [Rhodopseudomonas palustris BisB18]
 gi|90106843|gb|ABD88880.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB18]
          Length = 264

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 49/154 (31%), Gaps = 20/154 (12%)

Query: 46  EPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKA 100
              RI    +L       +I  SG         V++  +  ++     +A   I +  ++
Sbjct: 105 SAERIVVMLQLARRFPDARIVFSGGSANLLQAPVAEAPIAGRLLHSFGIAPERIVLEDRS 164

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
             T  NA    A          L+VT  +HMPR+    + +        YP+   D    
Sbjct: 165 RTTAENAAFTRALVTPAAGERWLLVTSAFHMPRSIAAFRAV--GFDVEAYPV---DWRTR 219

Query: 161 SSIFKIKILRVL----------LIEYLKILLLSI 184
             I        L          + E++ ++   +
Sbjct: 220 GWIDAAMPFDRLSAGLARTDVAVHEWVGLIAYRL 253


>gi|121534257|ref|ZP_01666081.1| protein of unknown function DUF218 [Thermosinus carboxydivorans
           Nor1]
 gi|121307027|gb|EAX47945.1| protein of unknown function DUF218 [Thermosinus carboxydivorans
           Nor1]
          Length = 192

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 57/164 (34%), Gaps = 13/164 (7%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVHH 72
           +  +    +        I+VL  +           +R++ A +L +      I +SG   
Sbjct: 24  VPIIAVGQLAKPEPGDVIIVLGAKLIGHEPSTMLRLRLDEAAKLYQAGYAPFIIVSGAQG 83

Query: 73  S---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDY 129
               +S+   ++   I   +    I +  K+ NT+ N   + A   ++     +IV++  
Sbjct: 84  CDEVISEAAAMRNYLIAHGVPADRILLEDKSFNTQQNLANSLAIMREHGLQRAIIVSNAS 143

Query: 130 HMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
           H+ R  +    +       P P+ ++         +     + L
Sbjct: 144 HIRRALVIAHNLGMEASGAPAPMANNAYLTTKQYVREGAAMLAL 187


>gi|114319324|ref|YP_741007.1| hypothetical protein Mlg_0162 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225718|gb|ABI55517.1| protein of unknown function DUF218 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 247

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 55/183 (30%), Gaps = 30/183 (16%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPI-----------------RIERAFELLENQIGEKIFISG 69
             +         AIVVL                      R+  A  L        I   G
Sbjct: 64  PPVQPAQLRDAQAIVVLGAGYRSGADEFSGETVNDLALVRLRYAAYLHRETGLPVIASGG 123

Query: 70  V-HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
                  +   + ++     +    I    +A +T GNAQ  +    +     V +V+H 
Sbjct: 124 AATDREPEARWMAEVLAEFGVDP--ILTESEARDTWGNAQHTAELLARQGLSRVALVSHA 181

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI-----FKIKILR---VLLIEYLKIL 180
           +HMPR     ++    V  +P P  +    +          +   LR   + + EYL + 
Sbjct: 182 HHMPRAVWAFEQA--GVTVLPAPTGAFVPHDRGWSWGMLRPQANALRMSWLAMHEYLGLF 239

Query: 181 LLS 183
              
Sbjct: 240 WYR 242


>gi|294675706|ref|YP_003576321.1| hypothetical protein RCAP_rcc00149 [Rhodobacter capsulatus SB 1003]
 gi|294474526|gb|ADE83914.1| protein of unknown function DUF218 [Rhodobacter capsulatus SB 1003]
          Length = 187

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/175 (17%), Positives = 56/175 (32%), Gaps = 10/175 (5%)

Query: 25  YVKQMHIPDHPSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVS---KDILL 80
                       V    V        +  A  L  + +   + ISG   +V    +    
Sbjct: 11  SAFLFKKCPPEPVDLAFVFCSPSVSSLHPAIALYRSGLTRTLLISGAGTAVDGSAEWSFY 70

Query: 81  QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN----NFHHVLIVTHDYHMPRTFL 136
           +   +R  +AE  + +   A NT  NA   +A             + +    +HM R  +
Sbjct: 71  RDHALRAGVAESALLLEKNARNTAENAAFGAALIGTELGWAKIRSLAVCAKPFHMRRALM 130

Query: 137 ELQRINS-TVQFIPYPII-SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
            L+R     V+ +  P     DL   +     +  + +  E  KI   +++  L 
Sbjct: 131 TLRRHVPPEVRLVAQPPDDPGDLSAETWWQTAQGRKRIFTELGKIGEYALKGDLG 185


>gi|86147081|ref|ZP_01065398.1| hypothetical protein MED222_12213 [Vibrio sp. MED222]
 gi|85835146|gb|EAQ53287.1| hypothetical protein MED222_12213 [Vibrio sp. MED222]
          Length = 225

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 36/122 (29%), Gaps = 10/122 (8%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------DILLQKIP 84
           D      I VL     R+ E A EL   +I   I  SG     ++             I 
Sbjct: 35  DITPSDCIFVLCSNDTRVAEYAAELYHQKIAPYIVFSGGMGRFTEGSFERSEAETFASIA 94

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRIN 142
               + +  I I   A NT  N +       +       + +V   +   RT+    +  
Sbjct: 95  RDSGVPDLDIIIEKHATNTGENVRFTYELLAQRGLSPKRLTLVQKPFMEKRTYATFCKQW 154

Query: 143 ST 144
             
Sbjct: 155 PD 156


>gi|225019145|ref|ZP_03708337.1| hypothetical protein CLOSTMETH_03097 [Clostridium methylpentosum
           DSM 5476]
 gi|224948092|gb|EEG29301.1| hypothetical protein CLOSTMETH_03097 [Clostridium methylpentosum
           DSM 5476]
          Length = 188

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 62/173 (35%), Gaps = 10/173 (5%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVK---QMHIPDHPSVSAIVVLTGEPIRIERAFELLEN 59
           +      V   F + GF S+         + +  H       V+     R+++A E L+ 
Sbjct: 11  FGALFALVISCFMLFGFRSYQGRDFDGTVIVLGCHIKGDQPSVMLAG--RLDKAAEFLKE 68

Query: 60  QIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
                  +SG        S+  +++K    + ++   I    +++NT+ N + +    E+
Sbjct: 69  NPRANCIVSGGRGKDEMYSEAEIMKKYLTEKGISPQRILEENQSVNTQTNLRNSKQMMEE 128

Query: 117 NNF-HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
                  +IVT  +H  R  L   RI    Q +P       L     + +I  
Sbjct: 129 KGLGKTAVIVTDRFHQYRAQLCADRIQLNSQSVPCETRPDLLVA-FWLREIPA 180


>gi|54309547|ref|YP_130567.1| hypothetical protein PBPRA2380 [Photobacterium profundum SS9]
 gi|46913983|emb|CAG20765.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 284

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 66/209 (31%), Gaps = 32/209 (15%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------- 47
           F     V         +  +    Q  +P    V  I+VL                    
Sbjct: 46  FLGIFMVSFQPIATSLLRPLETENQPFVPSSTPVDYIMVLGSGHVIDKAMPITSELSRAA 105

Query: 48  -IRIERAFELLENQIGEKIFIS--GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
            +R+     +     G K+ +S  G    +S+  ++ K+ +   + +  I +   A +T 
Sbjct: 106 LMRLSEGMRIYRLFPGSKLILSGYGGGSDISQARMMAKVALALGVNKSDILLLETARDTW 165

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDLEENSS 162
             A +A++        ++++VT   HM R   E  +    +   P P    + +  +   
Sbjct: 166 EEAFQAASVV---GDKNMVLVTSASHMTRALYEFNQA--GLTPTPAPTNFLASNKIKQPW 220

Query: 163 IFKIKILRVL------LIEYLKILLLSIQ 185
                  + L        E +  +   I+
Sbjct: 221 DRYAPKAKYLEQTERYWHETMGQIWQRIR 249


>gi|296502298|ref|YP_003663998.1| hypothetical protein BMB171_C1462 [Bacillus thuringiensis BMB171]
 gi|296323350|gb|ADH06278.1| putative cytoplasmic protein [Bacillus thuringiensis BMB171]
          Length = 192

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 72/185 (38%), Gaps = 26/185 (14%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIF 66
           +GF+ +    K   +        I+VL  +            RI++A E L++       
Sbjct: 21  VGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHDKAIAI 79

Query: 67  ISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           +SG       +S+ + ++   ++  +AE  I +  K+ +T+ N + +      +N    +
Sbjct: 80  VSGGKGKGEDISEALAMKNELMKLKIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGM 138

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           IVT+D+HM R     ++    ++ +P       +  ++           + EYL I    
Sbjct: 139 IVTNDFHMFRAKKIAEKQGLQLEGLPAKTPKPIIIPSN-----------VREYLAITQYW 187

Query: 184 IQLSL 188
               +
Sbjct: 188 FMNRI 192


>gi|257790208|ref|YP_003180814.1| hypothetical protein Elen_0438 [Eggerthella lenta DSM 2243]
 gi|257474105|gb|ACV54425.1| protein of unknown function DUF218 [Eggerthella lenta DSM 2243]
          Length = 215

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 64/217 (29%), Gaps = 47/217 (21%)

Query: 5   WYGLFVCLIFFIMGFIS-----FIRYVKQMHIPDHP---SVSAIVVLTGE---------- 46
              +  C++  +  F +           ++  P         AIVVL             
Sbjct: 2   LGLMLGCMLVVVAVFAATNVATIATTKDRIVEPQAAVGFDADAIVVLGASVFADGTPSGI 61

Query: 47  -PIRIERAFELLENQIGEKIFISGVHHSV--SKDILLQKIPIRQDLAECCIDIGYKALNT 103
              R++    L +  +  K+ +SG + +V  ++  +++   I Q +    I   +   +T
Sbjct: 62  LRDRLDDGIALYKEGVAPKLIMSGDNSTVSYNEVQVMKDYAISQGVPSYDIFCDHAGFST 121

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             +   A           +++ T  YH+ R           +      + S   +     
Sbjct: 122 YESMYRAKHVF---GAERIVVATQTYHLYRALY----AAQGLGLDSLGVASDYHD----- 169

Query: 164 FKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITL 200
                       Y K L   ++          FF TL
Sbjct: 170 ------------YSKQLQYDLREI--PARTKDFFKTL 192


>gi|293401028|ref|ZP_06645173.1| putative membrane protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306054|gb|EFE47298.1| putative membrane protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 261

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 65/177 (36%), Gaps = 13/177 (7%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIV---VLTGE-----PIRIER 52
           +R   Y     +I   +G  S I Y            + I+   +           R+ER
Sbjct: 71  LRRIVYLCTTIIIILFLGLQSCILYQGMHTDKQQGEAAIILGAQLHGSSISRLLRYRLER 130

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             +  E      + +SG      + S+   +++  I+  +AE  I +   ++NT+ N   
Sbjct: 131 GIQFAEEYPNTYLIVSGGKGQAETCSEASAMKQYLIQHGVAESRILMEDASMNTQENLAF 190

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           +    EK +     I+T+D+HM R        +  + +  YP  S      +  F+ 
Sbjct: 191 SKVLMEKYHIKSASIITNDFHMFRAG--FIATSLGLSYHNYPARSDLDLAPNFYFRE 245


>gi|91204866|ref|YP_537221.1| hypothetical protein RBE_0051 [Rickettsia bellii RML369-C]
 gi|157826504|ref|YP_001495568.1| hypothetical protein A1I_00645 [Rickettsia bellii OSU 85-389]
 gi|91068410|gb|ABE04132.1| unknown [Rickettsia bellii RML369-C]
 gi|157801808|gb|ABV78531.1| hypothetical protein A1I_00645 [Rickettsia bellii OSU 85-389]
          Length = 174

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 65/159 (40%), Gaps = 8/159 (5%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60
           +R     +      +  GF+ ++  V       +   +AI+V  G   +IE    LL+  
Sbjct: 2   IRKIALTILTIFAIWASGFVYYLYLVNSYKPSSNT-ANAIIVFAGGGHKIETGIALLKAG 60

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
               +FI+G+  S     LL++      L +  I    + ++ E   ++AS +  K N  
Sbjct: 61  YAPILFITGIETSDQLKNLLKE---NNVLEQQVILAPNQIMSEEDYIKKASDFILKYNIT 117

Query: 121 HVLIVTHDYHMPRTFLELQRINS----TVQFIPYPIISH 155
            V +V ++Y +P     L    S     +   PYP+I+ 
Sbjct: 118 SVRLVAYNYDIPSIVNNLTTAISSSNNNIYIAPYPVIAK 156


>gi|262165878|ref|ZP_06033615.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus VM223]
 gi|262025594|gb|EEY44262.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus VM223]
          Length = 278

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 74/219 (33%), Gaps = 39/219 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   S+  +++L              
Sbjct: 40  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGSIDYVMILGSGHVVDDDIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG       S   ++ ++ +   + +  I +  
Sbjct: 100 ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSEFSHARMMARVALALGVPKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 160 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 214

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLS 189
                    I   R L        E L +L   ++ +++
Sbjct: 215 NIAQPWDKYIPKARYLEQTEQYWYETLGLLWQKLRDTVA 253


>gi|323139875|ref|ZP_08074903.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
 gi|322394871|gb|EFX97444.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
          Length = 199

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 56/171 (32%), Gaps = 10/171 (5%)

Query: 31  IPDHPSVSAIVVLTGEPIR-IERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIR 86
                +V   +VL    I  I  A  L    +  +I ++G      S  +  + +   + 
Sbjct: 29  SHQPENVDVALVLGSPSISNILPAVSLYMQGMTRRIVVTGHGPADGSEPEWRVYRDYALS 88

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKN----NFHHVLIVTHDYHMPRTFLELQRIN 142
             + E  I +   A NT  N   +           N   + I +   H  R ++  +R  
Sbjct: 89  AGVPEAAILVEPHARNTLENFVFSDRLIADEIGWSNIGSMAICSKPLHARRAYMTARRHF 148

Query: 143 ST--VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQ 191
               V  +  P    D++ +           ++ E  +I   +++  LS  
Sbjct: 149 PKDVVLLMTPPKHPADIQADDWWRTPVGRERVMGELRRIGEYAVKGDLSID 199


>gi|304388801|ref|ZP_07370857.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|304337253|gb|EFM03431.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
          Length = 218

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 59/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F       +      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|292670312|ref|ZP_06603738.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292648043|gb|EFF66015.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 252

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 51/147 (34%), Gaps = 22/147 (14%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP------------------IRIERAFELLENQIGEKIFIS 68
           +   +P HP    IV+L G                     R+     L        +   
Sbjct: 67  RTYEVPVHPQGDIIVMLGGGAIADVRDVDGTGMLAQSPSSRLLAVLRLHRRYHLPILLSG 126

Query: 69  GV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           G     + S+  + +++     +    I +   +  T  NA+ ++    +  F H ++VT
Sbjct: 127 GQVFSDTGSEAEIARRVLRSLGVPSEMIYVETHSRTTGQNARYSAEILRREGFAHPILVT 186

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPII 153
             +H+PR  L  ++    V   PYP  
Sbjct: 187 SAFHLPRAVLNFEKE--GVAVTPYPTD 211


>gi|332701660|ref|ZP_08421748.1| protein of unknown function DUF218 [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332551809|gb|EGJ48853.1| protein of unknown function DUF218 [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 263

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 63/211 (29%), Gaps = 36/211 (17%)

Query: 4   FWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLT----------------- 44
           F     + L    +G   +S +       +     V  I+VL                  
Sbjct: 43  FALAGLLILAVLPVGQALMSPLEERFPRPVEMPAEVEGIIVLGGYQDLLVFENRGQPELT 102

Query: 45  GEPIRIERAFELLENQIGEKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYK 99
               R+    EL       K+ +SG    +      +  + +         +  +     
Sbjct: 103 AAADRLVAFVELARRYPHAKLVVSGGSGMLLRQDLKESDVTRAALACLGFDDSRVIYEEI 162

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           +  T  NA  +      +     L+VT   HMPR     +      + +PYP+    +  
Sbjct: 163 SRTTHENAMVSR----PSQDGLWLLVTSASHMPRAVGVFRAQ--DWRVLPYPVDYRTVAG 216

Query: 160 NSSIFKIKILRVL------LIEYLKILLLSI 184
               F  +  + L      + E++ +++  +
Sbjct: 217 MVWEFPFQTGQRLALVSAAMREWVGLVVYRL 247


>gi|325197310|gb|ADY92766.1| conserved hypothetical protein [Neisseria meningitidis G2136]
          Length = 218

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 63/178 (35%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVCLIF-FIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F   +F  ++ F   +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFTSSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKRPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|198284290|ref|YP_002220611.1| hypothetical protein Lferr_2201 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|198248811|gb|ACH84404.1| protein of unknown function DUF218 [Acidithiobacillus ferrooxidans
           ATCC 53993]
          Length = 264

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 70/221 (31%), Gaps = 37/221 (16%)

Query: 2   RYFWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVS---AIVVLTGEPI----- 48
           R         L FF         +  +                  AI+VL G  +     
Sbjct: 40  RVLMLLALGTLYFFSTAIGARLLLLPLEDRYPPLTKPLHGADTPQAIIVLGGGEVMQSPG 99

Query: 49  ------------RIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCI 94
                       R+  A +L        I   G     +      ++ I  +    +  I
Sbjct: 100 SNQETANARTLVRLLAAAQLARQTGLPIIPSGGAPRLGAPAEALTMEFILRQDLGVQSTI 159

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
               ++ NT  NA +++A   +++ H   +VT   HMPR     +R    V+ +P P   
Sbjct: 160 WPETQSYNTAANATDSAAILAEHHGHQAYLVTSALHMPRAVAWFRRA--GVKVVPVPTDY 217

Query: 155 -----HDLEENSSIFKIKILRV---LLIEYLKILLLSIQLS 187
                + L   S + +   L +      EYL +L L IQ  
Sbjct: 218 RLDRVNGLRLESWLPRAIYLEISSEASHEYLGLLWLWIQEQ 258


>gi|163790688|ref|ZP_02185115.1| hypothetical protein CAT7_00865 [Carnobacterium sp. AT7]
 gi|159873989|gb|EDP68066.1| hypothetical protein CAT7_00865 [Carnobacterium sp. AT7]
          Length = 196

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 56/146 (38%), Gaps = 5/146 (3%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL-TGEPIRIERAFELLENQI 61
             + G+ +  +  ++G    I     +          I+V    E +R  RA ELL    
Sbjct: 7   IIFIGVVIVFMCLVIGVSYPIIINNLIIDEGPVQSDVIIVPEGQEYVRAYRAAELLHEG- 65

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
                 SG       D    +      +++  I    KA +T  NA       E++ F  
Sbjct: 66  ---FSTSGQIIVSPIDKATVQGYKEFWVSQEQIIPETKATSTYENAVITLRMMEEHGFDS 122

Query: 122 VLIVTHDYHMPRTFLELQRINSTVQF 147
            +IV+ DYHM RT L  +RINS   F
Sbjct: 123 AIIVSSDYHMRRTKLIYERINSDYDF 148


>gi|238927939|ref|ZP_04659699.1| protein of hypothetical function DUF218 [Selenomonas flueggei ATCC
           43531]
 gi|238884272|gb|EEQ47910.1| protein of hypothetical function DUF218 [Selenomonas flueggei ATCC
           43531]
          Length = 253

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 53/147 (36%), Gaps = 22/147 (14%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP------------------IRIERAFELLENQIGEKIFIS 68
           +   +P+ P    I++L G                     R+  A+ L        +   
Sbjct: 68  RTYPVPEVPQGDVIIMLGGGAIADVQDVDGMGMLAQSPSSRLLAAYRLHLRTHLPILLSG 127

Query: 69  GV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           G     + S+  + +++     + +  I +  ++L T  NA   +    +    H ++VT
Sbjct: 128 GQVFSDTGSEAEIARRVLRSLGVPDEMIRVETRSLTTGQNAHYTAEILRREGLMHPILVT 187

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPII 153
             +H+PR  L  ++    +   PYP  
Sbjct: 188 SAFHLPRAVLNFEKQ--GITVTPYPTD 212


>gi|294627587|ref|ZP_06706170.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667213|ref|ZP_06732434.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598218|gb|EFF42372.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602994|gb|EFF46424.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 183

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 60/181 (33%), Gaps = 25/181 (13%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELL 57
           L +  +  + G+I ++                I+VL               RI  A +L 
Sbjct: 2   LALIWLVAVAGWIVWVGDR-----DQAAPADVIIVLGAAAYDARPSPVFEERIRHALDLY 56

Query: 58  ENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
                 ++  +G   +    ++  + ++  +R  +    I I   +  T  N ++A    
Sbjct: 57  AQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPDAIVIETTSRTTRQNLEQARTLM 116

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
           E++  H  +IV+   HM R      R++  +        +      S        R LL 
Sbjct: 117 ERHGLHRAIIVSDPLHMARAL----RLSQELGIDALASSTPSTRFRSFHTSW---RFLLQ 169

Query: 175 E 175
           E
Sbjct: 170 E 170


>gi|218667128|ref|YP_002426951.1| hypothetical protein AFE_2571 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|218519341|gb|ACK79927.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 266

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 70/221 (31%), Gaps = 37/221 (16%)

Query: 2   RYFWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVS---AIVVLTGEPI----- 48
           R         L FF         +  +                  AI+VL G  +     
Sbjct: 42  RVLMLLALGTLYFFSTAIGARLLLLPLEDRYPPLTKPLHGADTPQAIIVLGGGEVMQSPG 101

Query: 49  ------------RIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCI 94
                       R+  A +L        I   G     +      ++ I  +    +  I
Sbjct: 102 SNQETANARTLVRLLAAAQLARQTGLPIIPSGGAPRLGAPAEALTMEFILRQDLGVQSTI 161

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
               ++ NT  NA +++A   +++ H   +VT   HMPR     +R    V+ +P P   
Sbjct: 162 WPETQSYNTAANATDSAAILAEHHGHQAYLVTSALHMPRAVAWFRRA--GVKVVPVPTDY 219

Query: 155 -----HDLEENSSIFKIKILRV---LLIEYLKILLLSIQLS 187
                + L   S + +   L +      EYL +L L IQ  
Sbjct: 220 RLDRVNGLRLESWLPRAIYLEISSEASHEYLGLLWLWIQEQ 260


>gi|325203138|gb|ADY98591.1| conserved hypothetical protein [Neisseria meningitidis M01-240355]
          Length = 218

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 60/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F      L+      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPLLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKHPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|114776481|ref|ZP_01451526.1| probable transmembrane protein [Mariprofundus ferrooxydans PV-1]
 gi|114553311|gb|EAU55709.1| probable transmembrane protein [Mariprofundus ferrooxydans PV-1]
          Length = 257

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 51/153 (33%), Gaps = 12/153 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGY 98
           +     +R   A +L      +     G         + +++ ++ IR  +    I    
Sbjct: 104 LHDDGLMRTLYAADLALKSNLDVYATGGAFKPGQAEPEGLIMARMLIRFGVDPEHIHSEN 163

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
           +A  T  N        +K   H +++VT  +HMPR+    + +   +  I  P       
Sbjct: 164 RARTTWENGLYIRDMMKKAGIHRIILVTTAWHMPRSVRVFESL--GMHVIAAPCSYRAGR 221

Query: 159 ENSSIFKIKILRVL-------LIEYLKILLLSI 184
           +   +        +       L EYL +L   +
Sbjct: 222 QAYDLRSYLPRWNVLSDSGDGLHEYLGLLWYRL 254


>gi|329667272|gb|AEB93220.1| hypothetical protein LJP_0894 [Lactobacillus johnsonii DPC 6026]
          Length = 346

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 74/200 (37%), Gaps = 27/200 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
           Y +  L +  + FIM  +  +     +       +  +VVL               RI R
Sbjct: 141 YLFINLVIIYLIFIM-MMYTLTSWINLVNIKTKKLDYVVVLGAGLMGKKVTPLLAARINR 199

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             E+     G KI +SG       + + + + K    + +++  I +  K+  T  N   
Sbjct: 200 GIEVYRRNPGSKIIMSGGQGPGEEIPEAVAMAKYAEEKGISKQDIIVEDKSKTTRENLIF 259

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           +    +        IVT+ YH+ R  +  +R+   +Q I Y   +         F +   
Sbjct: 260 SHRLMKP--DSRFAIVTNSYHVYRALVLAKRL--GLQCIGYGAKTK------WYFTLNAF 309

Query: 170 RVLLIEYLKILLLSIQLSLS 189
              + E++  L ++ +L LS
Sbjct: 310 ---VREFIAYLTITWRLQLS 326


>gi|295397171|ref|ZP_06807275.1| conserved hypothetical protein [Aerococcus viridans ATCC 11563]
 gi|294974593|gb|EFG50316.1| conserved hypothetical protein [Aerococcus viridans ATCC 11563]
          Length = 193

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 50/180 (27%), Gaps = 9/180 (5%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIG 62
                 F   I   +G +  I     +   +      IVV  G   R   A +LLE    
Sbjct: 6   LVRLAGFFAGIMIAIGLLGVITLSNLIVDEEPRVSDIIVVPEGASERAGEAVDLLEAGYS 65

Query: 63  EKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
                SG               +        +     A +T  NA+      ++  +   
Sbjct: 66  R----SGKIIVSPLTQSNLDFYVGAGAPSDALINEGNATSTYTNARNTLKMMQELGYDSA 121

Query: 123 LIVTHDYHMPRTFLELQRINS--TVQFIPYPIISHDLEEN-SSIFKIKILRVLLIEYLKI 179
           +I + DYHM RT +  +R N                  E  +        R  L E  K 
Sbjct: 122 VITSSDYHMLRTKMIYERQNRHYGFDLTYVATYHDVAGEEVTWWQ--ANRRAGLSEIRKF 179


>gi|172063895|ref|YP_001811546.1| hypothetical protein BamMC406_4882 [Burkholderia ambifaria MC40-6]
 gi|171996412|gb|ACB67330.1| protein of unknown function DUF218 [Burkholderia ambifaria MC40-6]
          Length = 219

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/216 (13%), Positives = 66/216 (30%), Gaps = 28/216 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIR 49
           M      L      +I+  +  +    +M           V+                 R
Sbjct: 10  MARIGRVLAAFACLWIVAAVVLVGAGMRMPSE---PADVAVIFGNALDDHGAPKPVLAAR 66

Query: 50  IERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++               +SG      +++   ++   + + +    I +  +  NT   A
Sbjct: 67  LDVGVRCYREGQCPAFLVSGAIDGPGLNEATAMRDYLVARGVPAERIAVDDQGDNTLATA 126

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQFI-PYPIISHDLEENSSIFK 165
           Q   A+ + +    VLI++  YH+ R  L  +R+  +       YP      +  SS  +
Sbjct: 127 QHTRAYLQAHRLSRVLIISQYYHLARARLAFERVGIAGANISAAYPHHFQLRDIYSSWRE 186

Query: 166 IKILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
           +              +  ++L L+       F  ++
Sbjct: 187 VPA----------YAVYVLRLWLNPDARPVSFRPML 212


>gi|159027601|emb|CAO86973.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 206

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 49/152 (32%), Gaps = 8/152 (5%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFIS 68
            + +   + G       ++Q          AI VL G   R   A +L +      I++S
Sbjct: 22  LLAIPLILAGLGWLYLDLRQ----QWLKPEAIFVLGGHADRERFAAKLAKEYPDLPIWVS 77

Query: 69  GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
                     + +K      +    + + Y A +T  N    +   +      V +VT D
Sbjct: 78  SGSPRRYVQKIFKKA----GIPPERLHLDYNARDTVTNFTSLADQLKAQGIDSVYLVTSD 133

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            HM R  L  + I  +   +  P+        
Sbjct: 134 NHMRRARLVGEIIFGSRGIVIKPVTVPSQSPP 165


>gi|300855460|ref|YP_003780444.1| hypothetical protein CLJU_c22840 [Clostridium ljungdahlii DSM
           13528]
 gi|300435575|gb|ADK15342.1| conserved membrane spanning protein [Clostridium ljungdahlii DSM
           13528]
          Length = 260

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 53/145 (36%), Gaps = 16/145 (11%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEP----------IRIERAFELLENQIGEKIFISGVH---H 72
           +   +   +     I +L G             R + A + ++   G K+  SG      
Sbjct: 94  LVSANESHNKKPDYITILGGGISGRNMLLVQLQRTQEALKYIKQNPGIKVIASGGQGRGE 153

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL---IVTHDY 129
            +S+   ++   ++  +    I    K+ NT  N +      +K +    +   +VT ++
Sbjct: 154 DISEAEAMRIYLVQHGVKNEDIIKEEKSKNTLENMKYTREILKKIDGRENIQLAVVTSNF 213

Query: 130 HMPRTFLELQRINSTVQFIPYPIIS 154
           H+ R     +R    V+ +P P+  
Sbjct: 214 HVFRAKFLAKRYGFQVEGVPAPVNY 238


>gi|254804041|ref|YP_003082262.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           alpha14]
 gi|254667583|emb|CBA03327.1| conserved hypothetical periplasmic protein [Neisseria meningitidis
           alpha14]
          Length = 218

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 59/178 (33%), Gaps = 19/178 (10%)

Query: 1   MRYFWYGLFVC----LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------- 48
           +RY+  G F       +      +  +       +P +    A +VL             
Sbjct: 12  LRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQVLPPYVRADAALVLGAAAWDKHPSPVF 71

Query: 49  --RIERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNT 103
             RI  A  L +++   KI  +G       +++  + ++  ++Q +    I     + NT
Sbjct: 72  RERINHAIALYQSRRVGKIVFTGGRTKKGYMTEAEVGRRYALKQGVPARNILFENTSRNT 131

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N          N    V+IV+  YH+ R     + +   V+       +   +  +
Sbjct: 132 YENLNNIRPVLRANGIASVVIVSDPYHLARAAEMAEDL--GVRVYMSATPTTRFDAGN 187


>gi|15641722|ref|NP_231354.1| hypothetical protein VC1718 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121585785|ref|ZP_01675579.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|153212106|ref|ZP_01947923.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153817128|ref|ZP_01969795.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153823662|ref|ZP_01976329.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|153825454|ref|ZP_01978121.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153827934|ref|ZP_01980601.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|227081867|ref|YP_002810418.1| hypothetical protein VCM66_1658 [Vibrio cholerae M66-2]
 gi|229508174|ref|ZP_04397679.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae BX 330286]
 gi|229511588|ref|ZP_04401067.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae B33]
 gi|229515111|ref|ZP_04404571.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TMA 21]
 gi|229518727|ref|ZP_04408170.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae RC9]
 gi|229520681|ref|ZP_04410104.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TM 11079-80]
 gi|229607747|ref|YP_002878395.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae MJ-1236]
 gi|254224867|ref|ZP_04918482.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254285337|ref|ZP_04960302.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254848836|ref|ZP_05238186.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297579300|ref|ZP_06941228.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298498204|ref|ZP_07008011.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656238|gb|AAF94868.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549923|gb|EAX59941.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|124116902|gb|EAY35722.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|125622555|gb|EAZ50874.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|126512277|gb|EAZ74871.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126518811|gb|EAZ76034.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|148876515|gb|EDL74650.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149740866|gb|EDM54951.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150424609|gb|EDN16545.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227009755|gb|ACP05967.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|229342236|gb|EEO07231.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TM 11079-80]
 gi|229343416|gb|EEO08391.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae RC9]
 gi|229347816|gb|EEO12775.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TMA 21]
 gi|229351553|gb|EEO16494.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae B33]
 gi|229355679|gb|EEO20600.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae BX 330286]
 gi|229370402|gb|ACQ60825.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae MJ-1236]
 gi|254844541|gb|EET22955.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297536894|gb|EFH75727.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297542537|gb|EFH78587.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 282

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 79/234 (33%), Gaps = 42/234 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 49  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTLDYVMVLGNGHVIDDDIPPTS 108

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG      VS   ++ ++ +   + +  I +  
Sbjct: 109 ELTRAALMRLTEGIRISRMYPGSKLILSGYAGGSEVSHARMMARVALALGVPKSDIILLE 168

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 169 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 223

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIEEI 204
                    I   R L        E L ++  +++ +++  +       L   +
Sbjct: 224 NIIQPWDKYIPRSRYLEQTEQYWHETLGLMWQTLRDTVAGDSGE---PVLTPPV 274


>gi|228938827|ref|ZP_04101427.1| hypothetical protein bthur0008_14880 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228971708|ref|ZP_04132329.1| hypothetical protein bthur0003_14850 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978317|ref|ZP_04138694.1| hypothetical protein bthur0002_15210 [Bacillus thuringiensis Bt407]
 gi|228781334|gb|EEM29535.1| hypothetical protein bthur0002_15210 [Bacillus thuringiensis Bt407]
 gi|228787798|gb|EEM35756.1| hypothetical protein bthur0003_14850 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228820676|gb|EEM66701.1| hypothetical protein bthur0008_14880 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 194

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 75/196 (38%), Gaps = 26/196 (13%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
             + + +     GF+ +    K  H+        I+VL  +            RI++A E
Sbjct: 12  ILVVIMICAVYAGFLQY-HIYKHGHMNASEDAEYIIVLGSKVNGTKPSYSLQYRIDKAAE 70

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N   +  
Sbjct: 71  YLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENITFSKP 130

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
                +    +IVT+D+HM R      +    ++ +P       +  ++           
Sbjct: 131 LI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPRPIIIPSN----------- 178

Query: 173 LIEYLKILLLSIQLSL 188
           + EYL I        +
Sbjct: 179 VREYLAITQYWFMNRI 194


>gi|148980444|ref|ZP_01816066.1| hypothetical protein VSWAT3_04886 [Vibrionales bacterium SWAT-3]
 gi|145961247|gb|EDK26560.1| hypothetical protein VSWAT3_04886 [Vibrionales bacterium SWAT-3]
          Length = 215

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 36/120 (30%), Gaps = 10/120 (8%)

Query: 35  PSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIPIR 86
                I VL     R+ E A EL   +I   I  SG     +       +      I   
Sbjct: 27  EPSDCIFVLCSNDTRVAEYAAELYHQKIAPYIVFSGGVGRFTEGNFDRSEAETFAAIARD 86

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINST 144
             + E  I I  +A NT  N +       +       + +V   +   RT+    +    
Sbjct: 87  SGVPESDIIIEKQATNTGENVRFTYELLTECGLSPKKLTLVQKPFMEKRTYATFSKQWPE 146


>gi|163816062|ref|ZP_02207432.1| hypothetical protein COPEUT_02242 [Coprococcus eutactus ATCC 27759]
 gi|158448872|gb|EDP25867.1| hypothetical protein COPEUT_02242 [Coprococcus eutactus ATCC 27759]
          Length = 282

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 67/209 (32%), Gaps = 34/209 (16%)

Query: 1   MRYFW--------YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL------TGE 46
           +R  W          + + L+   +  +  I Y         P   A VV+       G 
Sbjct: 85  VRKLWDKKAGKICLSIVLALVTIALALVVVITYHMVYAAHVKPKQDATVVVLGCAVRGGG 144

Query: 47  P-----IRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGY 98
           P      R+  A + L+        +SG      S+S+   + +      ++   I +  
Sbjct: 145 PSLMLRERLIAAQDYLDENPEAVCVVSGGQGADESMSEAQCMYEYLTEHGISPERIYMED 204

Query: 99  KALNTEGNAQEASAWAEKNNF-HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
           K+ +T  N + ++   E+N+    + IVT+++H  R     ++       I         
Sbjct: 205 KSTSTRENIKFSAQIIEQNDLPDGMNIVTNEFHEYRAKRIAEKQGIDTGSIA-------- 256

Query: 158 EENSSIFKIKILRVLLIEYLKILLLSIQL 186
              +           + E   IL   I  
Sbjct: 257 GSTAWWLLPT---YYVREMAGILYEWISG 282


>gi|289522163|ref|ZP_06439017.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503999|gb|EFD25163.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 254

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 59/160 (36%), Gaps = 7/160 (4%)

Query: 37  VSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDI 96
                V     +R+    EL        +   G +     + +     +++   +  I  
Sbjct: 94  PDKAEVSPHTLMRLFGGIELALKFNWPILLCGGSYSQEVPEAMTMAKKVKELFPDLPIYE 153

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI---- 152
             ++  T  N + AS+        H ++VTH YHMPR  L  Q +   + + P+P+    
Sbjct: 154 ESQSRTTWENIKNASSILRSLELKHAVLVTHGYHMPRAHLIAQGLAPEINWHPFPVGKMA 213

Query: 153 ISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQLSLS 189
            +  L     +     L    + L E++ I+   I+L + 
Sbjct: 214 DNAPLSIIDFLPGASSLHINSLALKEHVGIIAYRIKLFIE 253


>gi|47526931|ref|YP_018280.1| hypothetical protein GBAA_1645 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|65318981|ref|ZP_00391940.1| COG1434: Uncharacterized conserved protein [Bacillus anthracis str.
           A2012]
 gi|47502079|gb|AAT30755.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
          Length = 172

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 71/184 (38%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 2   GFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIV 60

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +      +N    +I
Sbjct: 61  SGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMI 119

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 120 VTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IREYLAITQYWF 168

Query: 185 QLSL 188
              +
Sbjct: 169 MDRI 172


>gi|254506071|ref|ZP_05118215.1| integral membrane protein [Vibrio parahaemolyticus 16]
 gi|219550889|gb|EED27870.1| integral membrane protein [Vibrio parahaemolyticus 16]
          Length = 268

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 71/219 (32%), Gaps = 41/219 (18%)

Query: 3   YFWYGLFVCLIFFIMG-----FISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +     F+ +            +  +        P   S+  ++VL              
Sbjct: 40  FIVLFSFIGMFLIAFQPVSSRLLMPLERQYSAFFPVDESIDYVMVLGSGHVVDDKIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     ++    G K+ +SG      +S   ++ K+ +   +++  I +  
Sbjct: 100 ELSRTGLMRLAEGIRVMRIYPGSKLILSGYSGGSDISNARMMAKVALALGVSKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T   A++A+A+ +      +++VT   HM R   E           PYP  ++ L 
Sbjct: 160 TAKDTWEEARQAAAFVKH---KKMVVVTSASHMKRALNEFHSAG----LKPYPAPTNYLA 212

Query: 159 ENS----SIFKIKILRVL------LIEYLKILLLSIQLS 187
            ++              L        E L IL   ++  
Sbjct: 213 HDNVTEPWSKYTPKAVYLEQTERYWHETLGILWQKLRDW 251


>gi|326939331|gb|AEA15227.1| putative cytoplasmic protein [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 192

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 75/196 (38%), Gaps = 26/196 (13%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
             + + +     GF+ +    K  H+        I+VL  +            RI++A E
Sbjct: 10  ILVVIMICAVYAGFLQY-HIYKHGHMNASEDAEYIIVLGSKVNGTKPSYSLQYRIDKAAE 68

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L++       +SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N   +  
Sbjct: 69  YLKSHEKTIAIVSGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENITFSKP 128

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
                +    +IVT+D+HM R      +    ++ +P       +  ++           
Sbjct: 129 LI-PADMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAKTPRPIIIPSN----------- 176

Query: 173 LIEYLKILLLSIQLSL 188
           + EYL I        +
Sbjct: 177 VREYLAITQYWFMNRI 192


>gi|227815532|ref|YP_002815541.1| hypothetical protein BAMEG_2945 [Bacillus anthracis str. CDC 684]
 gi|229604535|ref|YP_002866117.1| hypothetical protein BAA_1717 [Bacillus anthracis str. A0248]
 gi|227002403|gb|ACP12146.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|229268943|gb|ACQ50580.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
          Length = 178

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 71/184 (38%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 8   GFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIV 66

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +      +N    +I
Sbjct: 67  SGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMI 125

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 126 VTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IREYLAITQYWF 174

Query: 185 QLSL 188
              +
Sbjct: 175 MDRI 178


>gi|83589867|ref|YP_429876.1| hypothetical protein Moth_1019 [Moorella thermoacetica ATCC 39073]
 gi|83572781|gb|ABC19333.1| Protein of unknown function DUF218 [Moorella thermoacetica ATCC
           39073]
          Length = 461

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 49/156 (31%), Gaps = 15/156 (9%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERA 53
                   +   +     +I +      P       I+VL               RI  A
Sbjct: 7   IAIIFAALITLILGSTYWYIEWFGWNTAP--KRADVIIVLGAAVWANGPSPALMERITLA 64

Query: 54  FELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
             L +      +  +G     +   +    +++ I   +    I     + NT  N   A
Sbjct: 65  ETLYQQVYAATLITTGGIGRSNPTPEGSAARQVLISHGIPANVIYEEVTSSNTRENLVGA 124

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
                K+ +   +IVTHD+H+ R   E +R+   V 
Sbjct: 125 LNIMRKHGWKSAVIVTHDFHLLRAMTEARRLGIEVS 160


>gi|227893937|ref|ZP_04011742.1| membrane protein [Lactobacillus ultunensis DSM 16047]
 gi|227864241|gb|EEJ71662.1| membrane protein [Lactobacillus ultunensis DSM 16047]
          Length = 350

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 26/189 (13%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
           +   V L    +  +  +     +       +  +VVL               RI R  E
Sbjct: 150 FLTLVILYLITIMMMFTLTSWINLVNWHVQHLDYVVVLGAGIMGKTVTPLLASRISRGIE 209

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           +     G K+ +SG       + +   + +  +   + +  I I  K+  T  N + + A
Sbjct: 210 IYHKNPGSKLIMSGGQGPGEDIPEAEAMAEYAMNAGVPKADIIIENKSRTTNENLRFSHA 269

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
             +        IVT  YH+ R  +  +R    ++ I Y   +         F +      
Sbjct: 270 LMKP--DSKFCIVTSSYHVYRALVLAKRQ--GLKCIGYGAKTK------WYFTLNAF--- 316

Query: 173 LIEYLKILL 181
           + E++  L+
Sbjct: 317 VREFIAYLV 325


>gi|90413116|ref|ZP_01221113.1| hypothetical protein P3TCK_00775 [Photobacterium profundum 3TCK]
 gi|90325959|gb|EAS42405.1| hypothetical protein P3TCK_00775 [Photobacterium profundum 3TCK]
          Length = 284

 Score = 69.4 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 66/211 (31%), Gaps = 32/211 (15%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------- 47
           F     V         +  +    Q  +P    V  I+VL                    
Sbjct: 46  FLGIFMVAFQPIATSLLRPLETENQPFVPSSTPVDYIMVLGSGHVIDKAMPITSELSRTA 105

Query: 48  -IRIERAFELLENQIGEKIFIS--GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
            +R+     +     G K+ +S  G    +S+  ++ K+ +   + +  I +   A +T 
Sbjct: 106 LMRLSEGMRIYRLFPGAKLILSGYGGGSDISQARMMAKVALALGVNKSDILLLETARDTW 165

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDLEENSS 162
             A +A++        ++++VT   HM R   E  +    +   P P    + +  +   
Sbjct: 166 EEAFQAASVV---GNKNLVLVTSASHMTRALYEFNQA--GLTPTPAPTNFLASNKIKQPW 220

Query: 163 IFKIKILRVL------LIEYLKILLLSIQLS 187
                  + L        E +  +   I+  
Sbjct: 221 DRYAPKAKYLEQTERYWHETMGQIWQRIRDK 251


>gi|310642426|ref|YP_003947184.1| protein [Paenibacillus polymyxa SC2]
 gi|309247376|gb|ADO56943.1| Putative uncharacterized protein [Paenibacillus polymyxa SC2]
          Length = 231

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 63/196 (32%), Gaps = 33/196 (16%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHI----PDHPSVSAIVVLTGEPI----------RIER 52
            +   +IF ++GF+     V  M+              +VL               R+E 
Sbjct: 34  FILGLMIFILVGFVWAGIRVWNMNTAASTNPLQHAQIGIVLGASMWGAEPSPGLKERLEE 93

Query: 53  AFELLENQIGEKIFISGVHHSVS----KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           A  L  N   +++ +SG          +   +Q+  + + +    I +  +A +T  N  
Sbjct: 94  ALWLYRNGTVQRLIVSGGLDQPDFPYTEAEGMQRYLVDRGVPVQHILLENQATSTYENLL 153

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQR--------INSTVQFIPYPI-------I 153
            +    ++ +++  +I+TH YH PR     Q           +  + +  PI        
Sbjct: 154 YSQRIMKEYDWNSTVIITHSYHGPRAMEIAQFLNFDHPQMALTESKVLNMPIHQSREVLA 213

Query: 154 SHDLEENSSIFKIKIL 169
                        +  
Sbjct: 214 YAKWTLQRWWISAQTW 229


>gi|322709982|gb|EFZ01557.1| hypothetical protein MAA_02786 [Metarhizium anisopliae ARSEF 23]
          Length = 225

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/148 (13%), Positives = 44/148 (29%), Gaps = 12/148 (8%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG-------VHHSV 74
           + Y             AI  L     R+  RA +L  + +   +  SG          + 
Sbjct: 13  LIYNYHQLRMPIRPADAIFCLCSLDTRVARRAAQLYLDGLAPMLIFSGASGQLTAGRFAK 72

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMP 132
           ++      +     +    + +  +A NT  N +   A  +        +++V   Y   
Sbjct: 73  TEAETFADVARAMGVPGDRVVVEPRATNTGENVRFTHALLQGMGLRPESLILVQKPYMER 132

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEEN 160
           RT+   ++         + + S      
Sbjct: 133 RTYATFRKQWPGE--TSFAVTSPQFTFE 158


>gi|256843931|ref|ZP_05549418.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256849507|ref|ZP_05554939.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|293381368|ref|ZP_06627369.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
 gi|312983993|ref|ZP_07791342.1| putative membrane protein [Lactobacillus crispatus CTV-05]
 gi|256613836|gb|EEU19038.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256713623|gb|EEU28612.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|290922058|gb|EFD99059.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
 gi|310894670|gb|EFQ43743.1| putative membrane protein [Lactobacillus crispatus CTV-05]
          Length = 343

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 74/195 (37%), Gaps = 27/195 (13%)

Query: 1   MRYFWYGLFVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIR 49
           ++Y +  L++ +I+ + +  +  +     +     P +  IVVL               R
Sbjct: 137 LKYPYIFLWLVIIYLVTIMMMYTLTSWINLINWHMPHLDYIVVLGAGIMGTKVTPLLAAR 196

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           I R  E+     G K+ +SG       + + + + +   +  + +  I I  K+  T+ N
Sbjct: 197 ISRGIEIYHKNPGSKLIMSGGQGPGEDIPEAVAMAEYAEKLGINKNDIIIENKSKTTQQN 256

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
            Q + A  + N      IVT  YH+ R  +  +R    ++   Y   +         F +
Sbjct: 257 LQFSHALMKPN--SRFCIVTSSYHVYRALVLAKRQ--GLKCTGYGAKTK------WYFTL 306

Query: 167 KILRVLLIEYLKILL 181
                 + E++  L+
Sbjct: 307 NAF---VREFIAYLV 318


>gi|33240920|ref|NP_875862.1| hypothetical protein Pro1471 [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33238449|gb|AAQ00515.1| Uncharacterized conserved protein with signal peptide
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 241

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 36/216 (16%), Positives = 71/216 (32%), Gaps = 38/216 (17%)

Query: 4   FWYGLFVCLIFFIMGFIS-FIRY-VKQMHIPDHPSVSAIVVLTGE--------------- 46
            +  L+   I  +   +  F+ +  +++     P+  AIVVL+                 
Sbjct: 26  IFIFLWTFSIGLVSQMLWKFVEHPWQRIDESHAPTADAIVVLSSGGRSLAPGISNIIEWN 85

Query: 47  -PIRIERAFELLENQIGEKIFISGVHHSVSKD-----ILLQKIPIRQDLAECCIDIGYKA 100
            P R     +L + +   K+F +G      K       L ++  I   + +  I    + 
Sbjct: 86  DPDRFLAGVKLFKEKKAPKLFFTGGASPYRKALKTEGDLYKEEAISLGIPKKAISTTGRV 145

Query: 101 LNTEGNAQEASAWAEKNNF-HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII------ 153
            NT   A +     +       +L+VT  +HM R   + +R        P+P+       
Sbjct: 146 FNTAEEAFQIRRNIKDKGSPSKILLVTSAFHMQRAKRQFERQ--GFIVQPFPVDFKTERK 203

Query: 154 ---SHDLEENSSIFKIKIL---RVLLIEYLKILLLS 183
              ++     + I   + L      L E L   +  
Sbjct: 204 FRKTYWKNPYNWIPNSESLFMSSKALRELLGRAVYR 239


>gi|257454427|ref|ZP_05619689.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257448193|gb|EEV23174.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 274

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/204 (16%), Positives = 72/204 (35%), Gaps = 31/204 (15%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQM--HIPDHPSVSAIVVLTGEPI---------- 48
           ++  W  +++    +++ F  F+ Y+KQ         +  AI+VL G             
Sbjct: 78  LKKLWQLVWLLFFVWLISFCIFVSYLKQHFNTDNHPKAAQAIIVLGGGTKDNKPTDAVKL 137

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQ-DLAECCIDIGYKALNTE 104
           R+++A E++       +  SG       VS+   +         ++   I +  ++ +TE
Sbjct: 138 RLDKASEVIRRFANALVITSGGFDAGEDVSEAKAMADYLHDTYGISLANISLEEQSTSTE 197

Query: 105 GNAQEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRI-NSTVQFIPYPIISHDLEEN 160
            N   +     +        ++ VT D+H  R  L  +R   + +Q +          + 
Sbjct: 198 LNFVHSKKILAQQGIALNQPIIAVTSDFHTLRASLIGKRQGYTNLQVV--------GSDT 249

Query: 161 SSIFKIKILRVLLIEYLKILLLSI 184
               +     V   EY   +   +
Sbjct: 250 PWYIRPN---VWFREYFAFISGWL 270


>gi|323142298|ref|ZP_08077130.1| hypothetical protein HMPREF9443_01929 [Phascolarctobacterium sp.
           YIT 12067]
 gi|322413182|gb|EFY04069.1| hypothetical protein HMPREF9443_01929 [Phascolarctobacterium sp.
           YIT 12067]
          Length = 258

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 67/213 (31%), Gaps = 31/213 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT------------------ 44
           +    L+          +      + +      +   IVVL                   
Sbjct: 46  FLTLLLYFSSTLLGAKLLGQPLENRYIQ-QQPDAAQVIVVLGGGSVGSAPDGTERGGLMS 104

Query: 45  GEPIRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALN 102
               R+  A  L +      +   G      VS+ ++ ++I ++  L +  I +  +A  
Sbjct: 105 AGAARLLTAARLAKQHSLPVLISGGQVFRDGVSEALVAERILLQLGLPQEQIIVETQART 164

Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPII----SHD 156
           T+ NA   +    +  +  VL++T   HMPR+    +R      V+   YP         
Sbjct: 165 TKENAAYTAMHCRERGYQSVLLLTSALHMPRSMQFFERYLGEQGVKVAAYPCDYTLNPQG 224

Query: 157 LEENSS----IFKIKILRVLLIEYLKILLLSIQ 185
                     +    +  + L EY+ +    +Q
Sbjct: 225 KFNPRWLVPQLQAFDVTCMALHEYVGMAGAFLQ 257


>gi|269102447|ref|ZP_06155144.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162345|gb|EEZ40841.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 278

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 70/212 (33%), Gaps = 32/212 (15%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP---------------- 47
               L +         +  +       IP    V+ ++VL                    
Sbjct: 46  LLGILLLSFQPISTSLLRPLEKQNAPFIPHSTPVNYVMVLGAGHVIDNAFPITSQLSRAA 105

Query: 48  -IRIERAFELLENQIGEKIFIS--GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
            +R+     +     G K+ +S  G    +S   ++ K+ +  D+ +  I +   A +T 
Sbjct: 106 LMRLVEGIRIYRMYPGSKLILSGYGGGSDISHARMMAKVALALDVNKADILLLETAKDTW 165

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDLEENSS 162
             A +A++        ++++VT   HM R   E  +    +  IP P    + +  E   
Sbjct: 166 EEAFQAASVV---GDKNLVLVTSASHMSRALYEFHQA--GLNPIPAPTNFLASNKIEQPW 220

Query: 163 IFKIKILRVL------LIEYLKILLLSIQLSL 188
           +      + L        E +  +   ++ +L
Sbjct: 221 VRYAPSSKYLEQSERYWHERMGQIWQRLRDAL 252


>gi|256005338|ref|ZP_05430303.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|281417642|ref|ZP_06248662.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|255990657|gb|EEU00774.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|281409044|gb|EFB39302.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|316940321|gb|ADU74355.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           1313]
          Length = 215

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 46/140 (32%), Gaps = 11/140 (7%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH------ 71
            +  +    +M+         IVVL     R+ +R  E+        I  SG +      
Sbjct: 6   LVQILWDYLRMN-HKLEKSDCIVVLGSHDTRVAKRGAEIFLEGFAPLIVFSGGYGKLTKH 64

Query: 72  -HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH--HVLIVTHD 128
             + ++     +I +   + E  I I  K+ NT  N                 ++ V   
Sbjct: 65  IWNTTEAEKFARIAMDMGVPETSILIEDKSSNTGENILFVKDLINNKKIKVQKIIAVNKP 124

Query: 129 YHMPRTFLELQRINSTVQFI 148
           Y   RT+   +++   +  I
Sbjct: 125 YMERRTYAAFKKLWEDIDVI 144


>gi|125973442|ref|YP_001037352.1| hypothetical protein Cthe_0925 [Clostridium thermocellum ATCC
           27405]
 gi|125713667|gb|ABN52159.1| protein of unknown function DUF218 [Clostridium thermocellum ATCC
           27405]
          Length = 215

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 46/140 (32%), Gaps = 11/140 (7%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH------ 71
            +  +    +M+         IVVL     R+ +R  E+        I  SG +      
Sbjct: 6   LVQILWDYLRMN-HKLEKSDCIVVLGSHDTRVAKRGAEIFLEGFAPLIVFSGGYGKLTKH 64

Query: 72  -HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH--HVLIVTHD 128
             + ++     +I +   + E  I I  K+ NT  N                 ++ V   
Sbjct: 65  IWNTTEAEKFARIAMDMGVPETSILIEDKSSNTGENILFVKDLINNKKIKVQKIIAVNKT 124

Query: 129 YHMPRTFLELQRINSTVQFI 148
           Y   RT+   +++   +  I
Sbjct: 125 YMERRTYAAFKKLWEDIDVI 144


>gi|295693788|ref|YP_003602398.1| hypothetical protein LCRIS_01926 [Lactobacillus crispatus ST1]
 gi|295031894|emb|CBL51373.1| Membrane protein [Lactobacillus crispatus ST1]
          Length = 343

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 74/195 (37%), Gaps = 27/195 (13%)

Query: 1   MRYFWYGLFVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIR 49
           ++Y +  L++ +I+ + +  +  +     +     P +  IVVL               R
Sbjct: 137 LKYPYIFLWLVIIYLVTIMMMYTLTSWINLINWHMPHLDYIVVLGAGIMGTKVTPLLAAR 196

Query: 50  IERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           I R  E+     G K+ +SG       + + + + +   +  + +  I I  K+  T+ N
Sbjct: 197 ISRGIEIYHKNPGSKLIMSGGQGHGDDIPEAVAMAEYAEKLGINKNDIIIENKSKTTQQN 256

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
            Q + A  + N      IVT  YH+ R  +  +R    ++   Y   +         F +
Sbjct: 257 LQFSHALMKPN--SRFCIVTSSYHVYRALVLAKRQ--GLKCTGYGAKTK------WYFTL 306

Query: 167 KILRVLLIEYLKILL 181
                 + E++  L+
Sbjct: 307 NAF---VREFIAYLV 318


>gi|126726963|ref|ZP_01742801.1| hypothetical protein RB2150_17787 [Rhodobacterales bacterium
           HTCC2150]
 gi|126727083|ref|ZP_01742921.1| hypothetical protein RB2150_18387 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703635|gb|EBA02730.1| hypothetical protein RB2150_17787 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703755|gb|EBA02850.1| hypothetical protein RB2150_18387 [Rhodobacterales bacterium
           HTCC2150]
          Length = 220

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 62/186 (33%), Gaps = 15/186 (8%)

Query: 32  PDHPSVSAIVVLTGEPIR-IERAFELLENQIGEKIFISGVHH--------SVSKDILLQK 82
               +V   VVL       I+ A  L    + + I I+G            V +   L  
Sbjct: 31  DLPQAVDLCVVLGAPSYTNIDPAISLYHANLVKNIVITGFGPKGMRAADDFVPEYAGLLD 90

Query: 83  IPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK----NNFHHVLIVTHDYHMPRTFLEL 138
             +R  + +  I +   A NT  N  E +   E     N  + + I     HM R  +  
Sbjct: 91  RALRAGVPQSAILLEKTATNTLENFVETAKIIEAEFSWNAINSIAIAGKPLHMRRAQMTA 150

Query: 139 QRINS-TVQFIPYP-IISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQF 196
           ++     V+ +  P I S DL+ ++        + +L E   I   S++  +     S  
Sbjct: 151 RKHWPQHVKLVMLPTINSTDLQADTWFRSELGRKRILTELGSIAQYSLKNDIGGSECSSI 210

Query: 197 FITLIE 202
                 
Sbjct: 211 HPKPCP 216


>gi|294499692|ref|YP_003563392.1| hypothetical protein BMQ_2936 [Bacillus megaterium QM B1551]
 gi|294349629|gb|ADE69958.1| conserved hypothetical protein [Bacillus megaterium QM B1551]
          Length = 187

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 68/197 (34%), Gaps = 26/197 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+      F+  +   +  ISF  Y +  H     +   ++VL  +            R+
Sbjct: 1   MKKKMIYTFIGSLVLYIVIISFCMY-QTAHKSVPHNADYVLVLGSKVDGDQMSPSLKERV 59

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A   L+     K+ ++G       +S+     +   ++ + +  I    ++ +T  N 
Sbjct: 60  KTALSYLQAHQQTKVIVTGGKGSDEEISEAEAAYRFLRKEGIKKNRIIKEDQSTSTFENF 119

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
                  +  +   V++V++D+H+ R  +  +R        P    +             
Sbjct: 120 TFTKQKVDIQH-KKVVLVSNDFHLFRASIIAKRQ--GFDVYPLGAKTP---------NSI 167

Query: 168 ILRVLLIEYLKILLLSI 184
            L+    EY  IL   +
Sbjct: 168 KLQAYFREYAAILKTWL 184


>gi|108763026|ref|YP_634765.1| hypothetical protein MXAN_6648 [Myxococcus xanthus DK 1622]
 gi|108466906|gb|ABF92091.1| hypothetical protein MXAN_6648 [Myxococcus xanthus DK 1622]
          Length = 292

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 58/193 (30%), Gaps = 19/193 (9%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-----------EPIRI 50
           R F   +    +     F       +            +VVL                R 
Sbjct: 91  RLFRLLMVGAGVLTCGVFGLAWVVDRFGQREQAAPADVLVVLGARVLPGGVPSGALRART 150

Query: 51  ERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           E A  L    +  ++  SG    +  S+   +  +  R  +      +   + +T+ NA+
Sbjct: 151 EHAVALYHRGVAPRLVFSGGVGVNPPSEARAMLALATRMGVPAEACVLEEGSHSTDDNAR 210

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             +          V++V+  YH+ R     +     V        S  LE   ++     
Sbjct: 211 LTAEVLRGLGARRVVVVSDPYHLLRARNYFRLYGWEV------ATSPALETERNLDTFDR 264

Query: 169 LRVLLIEYLKILL 181
           +   + E + +LL
Sbjct: 265 IYWTVREAVALLL 277


>gi|300312530|ref|YP_003776622.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
 gi|300075315|gb|ADJ64714.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
          Length = 269

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/218 (12%), Positives = 61/218 (27%), Gaps = 35/218 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPD--------HPSVSAIVVLTGE------- 46
           R F   L V  +  ++   + +  +  +   +             AIV+L          
Sbjct: 54  RRFGLLLIVLGVATLLVLSTRVGSLLLIAPLENSYPVLRSPGQAQAIVILGSGRIDRAPE 113

Query: 47  -----------PIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCID 95
                        R++    L        +   G      +          +      + 
Sbjct: 114 YGGLDDANAIGMKRLQYGAYLHRQSGLPILVTGGNPDGSPESEAAVMARTLERDFAVPVR 173

Query: 96  I-GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII- 153
               ++  T  NA  ++A  ++     +L+VT   HMPR         + +Q    P + 
Sbjct: 174 WQEGRSNTTYDNATLSAAMLKEAGISRILLVTDSLHMPRAMQVF--ATTGLQVQAAPTVF 231

Query: 154 --SHDLEENSSIFKIKILRV---LLIEYLKILLLSIQL 186
                      +     L++    L E++  L   ++ 
Sbjct: 232 AGQARTRVTDYLPNAASLQLASYALREWIGQLWYRVRQ 269


>gi|264678457|ref|YP_003278364.1| hypothetical protein CtCNB1_2322 [Comamonas testosteroni CNB-2]
 gi|262208970|gb|ACY33068.1| hypothetical conserved protein [Comamonas testosteroni CNB-2]
          Length = 270

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/201 (14%), Positives = 69/201 (34%), Gaps = 29/201 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYV--KQMHIPDHPSVSAIVVLTGE----------PIRI 50
             W   +V L  +++    F   +    +     P V +IVVL               R+
Sbjct: 76  RLWSLGWVVLALWLISLFWFWSRLSGLGLAPQQVPPVQSIVVLGSGTLDGHPRPVLAARL 135

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIR-QDLAECCIDIGYKALNTEGN 106
           ++A +L + Q    + + G        S+  ++ +   +   +A   + +   + +TE N
Sbjct: 136 DQAAQLAKLQPQALVAVCGGVDWGEKESEAEVMARYLQQHHGIAAQRLVLEKLSTSTELN 195

Query: 107 AQEASAWAEKNNFH---HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
            + +     +        + +V+ D+H+ R     +R +   Q  P    +      ++ 
Sbjct: 196 LKLSRPLLAERGVTADAPMAMVSSDFHLMRAMDIAKRQDL-PQVYPVAAPTPLATRFNAW 254

Query: 164 FKIKILRVLLIEYLKILLLSI 184
                    L EY  +    +
Sbjct: 255 ---------LREYFAMASSWL 266


>gi|148256823|ref|YP_001241408.1| hypothetical protein BBta_5542 [Bradyrhizobium sp. BTAi1]
 gi|146408996|gb|ABQ37502.1| hypothetical protein BBta_5542 [Bradyrhizobium sp. BTAi1]
          Length = 195

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/175 (16%), Positives = 58/175 (33%), Gaps = 10/175 (5%)

Query: 25  YVKQMHIPDHPSVSAIVVLTG---EPIRIERAFELLENQIGEKIFISGVHHSVSKDI--- 78
             +            + V      E +R   A  L E        +SG     ++     
Sbjct: 18  STRHFADTPLRPADLLFVFGTRVEEELRAATAARLWEQGYFRHAIVSGGVTPGAEASECA 77

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN----NFHHVLIVTHDYHMPRT 134
           L++   +R+ +    I   + A+NT  N   +    +      N   V+ + + +   R 
Sbjct: 78  LIKDAMVRRGVPADRILEEHHAMNTGENVLLSLPVIDTALGLANVRTVICLGNSWTARRY 137

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
            + LQR    V+ +   + S  +         +  R +L E+ KI     +  ++
Sbjct: 138 AMTLQRHWPEVEKMLLTVDSFGVPRQLWHTHPEFRRRVLSEWDKIAPYKAKGFIA 192


>gi|317968461|ref|ZP_07969851.1| hypothetical protein SCB02_02886 [Synechococcus sp. CB0205]
          Length = 266

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 69/230 (30%), Gaps = 45/230 (19%)

Query: 2   RYFWYGLFVCLIFFIMG-----FISFIR-YVKQMHIPDHPSVSAIVVLT----------- 44
           R         +  F M       I  +      +     P+  A+VVL            
Sbjct: 37  RALGASGIAMVWLFAMPITSRQLIWGLEERAAALTPKTIPNADAVVVLGGGLKPALPPRR 96

Query: 45  -----GEPIRIERAFELLENQIGEKIFISGVH-------HSVSKDILLQKIPIRQDLAEC 92
                    R+     L+  +    +  SG          + ++    + +     +   
Sbjct: 97  GVEVSEGGDRLLTGVRLMSQKKAGTLVTSGAQISFTAADPAPAEAFSAKALAEELGVPSQ 156

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP- 151
            I     +  T   A++    A++  +  VL+VT  +HMPR+    QR  S +Q IP   
Sbjct: 157 RIVPNPLSKTTAEEARDIGQLAKQRGWSQVLLVTSAFHMPRSLATFQRR-SGLQVIPVAC 215

Query: 152 -----------IISHDLEENSSIFKIKILRV---LLIEYLKILLLSIQLS 187
                        +        +   + L +    L E+L + L  ++  
Sbjct: 216 DFLLPERQRLGSPTPGSLVQDLLPSAEALYLSSVALKEHLGLALYRLKGW 265


>gi|320010937|gb|ADW05787.1| protein of unknown function DUF218 [Streptomyces flavogriseus ATCC
           33331]
          Length = 253

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/176 (12%), Positives = 50/176 (28%), Gaps = 21/176 (11%)

Query: 2   RYFWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIR 49
           R     L V     +    ++      +       P+    VV                R
Sbjct: 37  RRLVQALMVACAVALAPATWLHTTADARVRTTAGAPAQEVAVVFGAGLWEGRPSPYLARR 96

Query: 50  IERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++ A EL        + ++G +  V  D    ++     Q + +  I   +   +T  + 
Sbjct: 97  LDAAAELYRTGKVRVVLVTGDNSRVEYDEPDAMRTYLTAQGVPDGRIVSDHAGFDTWDSC 156

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             A            ++V+  +H+ R     +          Y +   D+ + +  
Sbjct: 157 VRARKVF---GVDRAVLVSQGFHIRRAIALCRSAG----IDAYGVGVDDVHDVTWY 205


>gi|228996828|ref|ZP_04156462.1| hypothetical protein bmyco0003_14130 [Bacillus mycoides Rock3-17]
 gi|229004505|ref|ZP_04162244.1| hypothetical protein bmyco0002_14590 [Bacillus mycoides Rock1-4]
 gi|228756696|gb|EEM06002.1| hypothetical protein bmyco0002_14590 [Bacillus mycoides Rock1-4]
 gi|228762889|gb|EEM11802.1| hypothetical protein bmyco0003_14130 [Bacillus mycoides Rock3-17]
          Length = 193

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 81/194 (41%), Gaps = 27/194 (13%)

Query: 10  VCLIFFIMGFISFIRY--VKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELL 57
           + +I  I+G+I F++Y   K  H+        +++L  +            RI++A E L
Sbjct: 12  LVVIMIIVGYIGFLQYNIYKHGHMEAPNDADYMILLGAKVKGTEPSYSLQYRIDKAAEYL 71

Query: 58  ENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           +      + +SG       +S+   ++K  ++Q +AE  I +  ++ NT+ N + + +  
Sbjct: 72  KTHEQTIVIVSGGKGKGEDISEARAMKKGLMKQSIAEQRIIMEDRSTNTDENIEFSKSLI 131

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             N     +IVT+D+HM R     ++    V  +P       + +++           + 
Sbjct: 132 PANK-KKGMIVTNDFHMFRAKKIAEKQGLKVNGLPAKTPKSIIIQSN-----------VR 179

Query: 175 EYLKILLLSIQLSL 188
           EY  I    +   +
Sbjct: 180 EYFAITQYWLTNRI 193


>gi|285017167|ref|YP_003374878.1| hypothetical protein XALc_0349 [Xanthomonas albilineans GPE PC73]
 gi|283472385|emb|CBA14890.1| hypothetical protein XALc_0349 [Xanthomonas albilineans]
          Length = 204

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/144 (14%), Positives = 43/144 (29%), Gaps = 13/144 (9%)

Query: 32  PDHPSVSAIVVLTGEPI----------RIERAFELLENQIGEKIFISGVHHS---VSKDI 78
                  AI+VL               RI  A +L        +  +G   +    ++  
Sbjct: 42  DQAAPADAIIVLGAAAYDAKPSPVFEERIRHALDLYRRGYAPTLIFTGGFGNGARFAEAQ 101

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
           + ++  +RQ +    + I   +  T  N  +A      +    V++V+   HM R     
Sbjct: 102 VARRYALRQGVPADAVLIETISRTTRQNLIQARQIMRAHGLRRVIVVSDPLHMARALRLC 161

Query: 139 QRINSTVQFIPYPIISHDLEENSS 162
           + +         P       +   
Sbjct: 162 RELQIDALASSTPSSRFRSFQTRW 185


>gi|293400746|ref|ZP_06644891.1| putative periplasmic protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305772|gb|EFE47016.1| putative periplasmic protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 189

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 57/158 (36%), Gaps = 13/158 (8%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-----------EPIRIERAF 54
             +F+ L   +     +  + K  H     S    +VL             +  R+E A 
Sbjct: 3   LLIFIILFVLLANLYLYHHFPKPKHPLQDISYDVAIVLGYPCNADGSLSTVQKKRMETAI 62

Query: 55  ELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
            L        + ISG  V ++  +   +    + Q + +  I +  KA NT  N + A  
Sbjct: 63  NLYHKHCVHHLLISGSCVQNTYIEAEKMAAYALTQKIPKQAIVLETKARNTYENLKYAKC 122

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
             ++N + +++++T   HM R    + +         Y
Sbjct: 123 ICDENQWENIIVITSPSHMRRAAFFVHKFFRNYVMDTY 160


>gi|310643123|ref|YP_003947881.1| protein of hypothetical function duf218 [Paenibacillus polymyxa
           SC2]
 gi|309248073|gb|ADO57640.1| Protein of hypothetical function DUF218 [Paenibacillus polymyxa
           SC2]
          Length = 249

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 39/154 (25%), Positives = 63/154 (40%), Gaps = 12/154 (7%)

Query: 42  VLTGEPIRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYK 99
           +L     R+  A  L E      +F  G     S ++  + Q+  +   +    I I  +
Sbjct: 98  LLGSAANRLLTAARLHEATGLPILFSGGQVFGDSGNEANIAQRQLLGLGIPAKDIFIENR 157

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS----- 154
           +LNT+ NA   S   +++     ++VT  +HMPR  LE QR    +Q   YP        
Sbjct: 158 SLNTQQNAVYTSKILKQHQLTKPILVTSAFHMPRAALEFQRA--GMQTTAYPTDYLASEK 215

Query: 155 ---HDLEENSSIFKIKILRVLLIEYLKILLLSIQ 185
              +  + + S   I      L EYL IL L ++
Sbjct: 216 LSLYAAKLSPSAGAISTTGTALKEYLGILALKLK 249


>gi|3056882|gb|AAC14002.1| unknown [Actinosynnema pretiosum subsp. auranticum]
          Length = 336

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 73/222 (32%), Gaps = 36/222 (16%)

Query: 5   WYGLFVCLIFFIMGFISF------IRYVKQMHIPDHPSVSAIVVLTGE----------PI 48
           W       +F + G++ F      +  V    +      +AIVVL               
Sbjct: 123 WVLAAAGSLFLLAGYLGFAFTLFLLYSVLYGRVRKRTGHTAIVVLGAGVPGGRVTPLLAG 182

Query: 49  RIERAFELLE----NQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           R++RA +L            +  SG        S+  ++      + + +  +    ++ 
Sbjct: 183 RLDRALKLYRRAAAKGASPLVVASGGQGPDEPASEAEVMANYLRERGIPDEALLEEREST 242

Query: 102 NTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
           +T  N + +SA   +      +L+VT  YH+PR  +  +R                    
Sbjct: 243 STWENLRLSSALLAERGVTGRLLVVTSSYHVPRAAILSRRAGLKADV--------RGGRT 294

Query: 161 SSIFKIKILRVLLIEYLKILL-LSIQLSLSTQTASQFFITLI 201
           +  F        L E+  +L+      +L+  TA   F  L 
Sbjct: 295 AWYFVPNAF---LREFAALLVQYRALNALAACTALSVFPLLA 333


>gi|78045951|ref|YP_362126.1| hypothetical protein XCV0395 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325929410|ref|ZP_08190538.1| hypothetical protein XPE_4644 [Xanthomonas perforans 91-118]
 gi|78034381|emb|CAJ22026.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325540185|gb|EGD11799.1| hypothetical protein XPE_4644 [Xanthomonas perforans 91-118]
          Length = 183

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 54/168 (32%), Gaps = 18/168 (10%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELL 57
           L +  +  + G+I +I                I+VL               RI  A +L 
Sbjct: 2   LALIWLVAVAGWIVWIGDR-----DQAAPADVIIVLGAAAYDARPSPVFEERIRHALDLY 56

Query: 58  ENQIGEKIFISGVHHS---VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
                 ++  +G   +    ++  + ++  +R  +    I I   +  T  N ++A    
Sbjct: 57  AQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRTTRQNLEQARTLM 116

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           E++  H  +IV+   HM R     Q +         P         S 
Sbjct: 117 ERHGLHRAIIVSDPLHMARALRLSQELGIDALASSTPSTRFRSFHTSW 164


>gi|168234855|ref|ZP_02659913.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194734850|ref|YP_002113116.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194710352|gb|ACF89573.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197291873|gb|EDY31223.1| putative secreted protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 206

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 65/207 (31%), Gaps = 21/207 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGE----------PIRI 50
           RY        ++     FI+    + Q             +V                R+
Sbjct: 4   RYITRIAAGIILIMATVFINNAIAIYQFSQQDQTCVADCAIVAGAGVSGKTPSPVFQARL 63

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A  L +  I   + ++G +    +VS   + ++  + + +    I I  ++  T  N 
Sbjct: 64  DHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A     +  +   L+V+   HM R        ++ +     P  S   +  S   K  
Sbjct: 124 RYAKQIQRQQQWRTALLVSDPLHMLRLKTI--AQDNGIDSRSSPTRSTRYK--SWWAK-- 177

Query: 168 ILRVLLIEYLKILLLSIQLSLSTQTAS 194
             R LL E        +   +  Q  S
Sbjct: 178 -TRFLLRETFYYSGYRLLRYMPVQNNS 203


>gi|161524938|ref|YP_001579950.1| hypothetical protein Bmul_1765 [Burkholderia multivorans ATCC
           17616]
 gi|160342367|gb|ABX15453.1| protein of unknown function DUF218 [Burkholderia multivorans ATCC
           17616]
          Length = 281

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 64/221 (28%), Gaps = 38/221 (17%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLT----------- 44
           R               G++           V+ +  PD    + ++VL            
Sbjct: 65  RRIALAAVALFWLIASGWLAAPFIAWAEAGVEPVEHPDMHGQTVLIVLGAGTQRADDGLR 124

Query: 45  ---GEPIRIERAFELLENQIG----EKIFISGVHHSVS---KDILLQKIPIRQDLAECCI 94
                  RI +A EL  +         + +SG         +  +  +  +   +    +
Sbjct: 125 PPRDGAARIRKAAELYRSCRRQAERCTVVMSGGDPQHHGDTEAAVYGRGLVAAGVDPGDL 184

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  K+  T  NAQ  ++          +++T  Y M R  L+ +R        P P+ +
Sbjct: 185 VLEPKSRTTYENAQFTTSILRSRRDDARILITSSYQMRRALLDFRRFG----IDPQPVFA 240

Query: 155 HDLEEN-SS---IFKIKILRVLLIEYLKIL---LLSIQLSL 188
           +  E           +      L E + I    +  +    
Sbjct: 241 NRREAQTGWLPRWSNVVATEFALHELIGIAQFHVYRLIGRF 281


>gi|42780808|ref|NP_978055.1| hypothetical protein BCE_1734 [Bacillus cereus ATCC 10987]
 gi|42736728|gb|AAS40663.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 192

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 78/201 (38%), Gaps = 28/201 (13%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           M+Y    + VC ++  +GF+ +    K   +        I+VL  +            RI
Sbjct: 7   MKYMIGMIMVCAVY--VGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRI 63

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++A E L+        +SG       +S+ + ++   I+  +AE  I +  K+ +T+ N 
Sbjct: 64  DKAAEYLKAHEKAIAIVSGGKGKGEDISEALAMKNELIKLKIAEDRIIMEDKSTSTDENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + +      +N    LIVT+D+HM R      +    ++ +P       +  ++      
Sbjct: 124 KFSKPLI-PDNMKKGLIVTNDFHMFRAKKIAAKQGLQLEGLPAETPKRIVIPSN------ 176

Query: 168 ILRVLLIEYLKILLLSIQLSL 188
                + EYL I        +
Sbjct: 177 -----IREYLAITQYWFMNRI 192


>gi|196039056|ref|ZP_03106363.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|196030201|gb|EDX68801.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
          Length = 192

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 72/184 (39%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 22  GFLQY-NIYKHGKMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIV 80

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++ ++AE  I +  K+++T+ N + +      +N    +I
Sbjct: 81  SGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSMSTDENIKFSKPLI-PDNMKKGMI 139

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 140 VTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IREYLAITQYWF 188

Query: 185 QLSL 188
              +
Sbjct: 189 MDRI 192


>gi|327484303|gb|AEA78710.1| hypothetical protein VCLMA_A1486 [Vibrio cholerae LMA3894-4]
          Length = 205

 Score = 69.1 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 43/151 (28%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +   ++  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQVRPAKRILLVQKPYMERRAYATFKQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|217963458|ref|YP_002349136.1| hypothetical protein LMHCC_0160 [Listeria monocytogenes HCC23]
 gi|217332728|gb|ACK38522.1| conserved hypothetical protein [Listeria monocytogenes HCC23]
 gi|307571968|emb|CAR85147.1| conserved domain protein [Listeria monocytogenes L99]
          Length = 189

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 69/203 (33%), Gaps = 30/203 (14%)

Query: 1   MRYF-WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------------P 47
           MR      + +  I FI   I               +   +++L  +             
Sbjct: 1   MRRLKRISIILIAIGFIYLLIVAAIMFSGTRAKPSDNADTVLILGAKVNGDPAEPAEVLK 60

Query: 48  IRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
            R++ A   L      ++ +SG      S S+  ++++  + + +    I I  K+  TE
Sbjct: 61  ERLDAAVTYLNENPTMQVVVSGGQGEDESASEASVMEEYLVNKGITRSRIKIEDKSRRTE 120

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            N + +     K N    +IVT DYHM R  +  +R    +     P  S          
Sbjct: 121 ENIKYSKE---KFNLGKTVIVTSDYHMYRALMLAKRQ--ELDASGLPAKS---------Q 166

Query: 165 KIKILRVLLIEYLKILLLSIQLS 187
            +  ++ ++ E L I    +   
Sbjct: 167 SVIKIKNMMRETLSITYAWVFDR 189


>gi|218902828|ref|YP_002450662.1| hypothetical protein BCAH820_1711 [Bacillus cereus AH820]
 gi|218538682|gb|ACK91080.1| conserved hypothetical protein [Bacillus cereus AH820]
          Length = 192

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 70/184 (38%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 22  GFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIV 80

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++  +AE  I +  K+ +T+ N + +      +N    +I
Sbjct: 81  SGGKGKGEDISEALAMKNELMKLKIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMI 139

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 140 VTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IREYLAITQYWF 188

Query: 185 QLSL 188
              +
Sbjct: 189 MDRI 192


>gi|110834807|ref|YP_693666.1| hypothetical protein ABO_1946 [Alcanivorax borkumensis SK2]
 gi|110647918|emb|CAL17394.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 203

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 61/204 (29%), Gaps = 29/204 (14%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPS--VSAIVVLTGEPI--------------R 49
                 L+       + +R                A+VVL                   R
Sbjct: 3   LTYLALLVLVGASLPAVVRSFLPPLPRRITGITPQAVVVLGAGRRQRKGRSSLNTRGLRR 62

Query: 50  IERAFELLENQIGEKIFISGVHHS-----VSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
           ++ A EL        +   G          ++  L+ +  +R+      +   +++ NT 
Sbjct: 63  LKLAAELAHEHGLPLLVSGGGQPPKHDDEPTEADLMAEQALRR-WPRLDVIKEFRSRNTW 121

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            NA  +S          VL+V+   H+PR  L  Q        +     S  L +   + 
Sbjct: 122 ENACYSSELLADRGIDEVLLVSDRAHLPRALLCFQSQG----VLAQAAWSKRLPKQEWLP 177

Query: 165 KIKILRV---LLIEYLKILLLSIQ 185
               + +   +  E+L ++    +
Sbjct: 178 SAGAISMVPEIWYEWLALVWYHAR 201


>gi|303242994|ref|ZP_07329449.1| protein of unknown function DUF218 [Acetivibrio cellulolyticus CD2]
 gi|302589462|gb|EFL59255.1| protein of unknown function DUF218 [Acetivibrio cellulolyticus CD2]
          Length = 263

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/206 (18%), Positives = 79/206 (38%), Gaps = 31/206 (15%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVK-QMHIPDHPSVSAIVVLTGE----------PIRIE 51
           +    + + +  FI+ FI     +   +   ++  V  +++L G             R++
Sbjct: 69  FLRRSIKIGISAFIISFILIEGLIFATVRADNYTDVDYVIILGGGVKGGELSKTLQFRLD 128

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           +  E L+     K+ ++G      ++S+   +    ++ ++ E  I +  +A +T  N +
Sbjct: 129 KGIEFLKEHPDLKVVVTGGKGFGETISEGEAMCNYLLQNNIPEDKIIVESEATSTMENFK 188

Query: 109 EASAWAEKNNFHHV---LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
                 EK         +++T D+HM R+ +          F PY I S        I  
Sbjct: 189 YTKQILEKQTGKSNYKVMVITSDFHMLRSKILASFNG----FTPYGIPSKT-----WIGV 239

Query: 166 IKILRVLLIEY---LKILLLSIQLSL 188
                 ++ EY    K L++ I L L
Sbjct: 240 FPN--CVIREYFAVFKSLIVDIMLRL 263


>gi|196228088|ref|ZP_03126955.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
 gi|196227491|gb|EDY21994.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
          Length = 265

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 72/206 (34%), Gaps = 32/206 (15%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------IRIERAFELLENQIG 62
             S  R    + I + P   AIV+L G                   R+  A E+      
Sbjct: 62  LGSLERPYAGVKIDELPKADAIVMLGGGSAPSRYEALGVHLTQAGDRLVMAHEVYRLGKA 121

Query: 63  EKIFISGVHHSV-----SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
             + + G  + +      +  +++ +     + E  +    +  +T   A + +A A+++
Sbjct: 122 PVLLLGGNVNKLDGVRKFESEIVRDLFKTWGIPEDAMIPLGENQDTHDEALKTAALAKEH 181

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYP------IISHDLEENSSIFKIKILRV 171
            +H VL+VT   HM R    L+     ++ IP P      + +       S+ +      
Sbjct: 182 GWHRVLLVTSASHMRRASGVLRAQ--GLEVIPVPCNFLTTVATAPPPPGLSVPRYDGFVK 239

Query: 172 L---LIEYLKILLLSIQLSLSTQTAS 194
           +   L E +       +  ++ + A 
Sbjct: 240 IAIWLHEEIGWYTYRHRGWINGENAK 265


>gi|37679548|ref|NP_934157.1| hypothetical protein VV1364 [Vibrio vulnificus YJ016]
 gi|37198292|dbj|BAC94128.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 212

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/132 (12%), Positives = 40/132 (30%), Gaps = 10/132 (7%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS------ 75
           + +           V  ++V+    +R+ E A  L +      I  SG     +      
Sbjct: 9   LLWQYMQLQHRLTPVDCLLVMCSNDLRVAEHAANLYKQGYAPYILFSGGEGRFTEGLFEK 68

Query: 76  -KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMP 132
            +     ++     +    I +  K+ NT  N + +     +    F   ++V   +   
Sbjct: 69  SEAETFAELAKASGVPAEAILLETKSSNTGENVRFSEQLLLEKGLAFESFILVQKPFMER 128

Query: 133 RTFLELQRINST 144
           R     ++    
Sbjct: 129 RALATFEKQWQG 140


>gi|148927862|ref|ZP_01811280.1| protein of unknown function DUF218 [candidate division TM7
           genomosp. GTL1]
 gi|147886790|gb|EDK72342.1| protein of unknown function DUF218 [candidate division TM7
           genomosp. GTL1]
          Length = 218

 Score = 69.1 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 41/150 (27%), Gaps = 11/150 (7%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHH-------SVSKDI 78
                        +  L     R+   + EL     G  + ISG            ++  
Sbjct: 16  YHHLHQTPVKCDVVFTLGSSDRRVAVYSAELFLKGYGNYLVISGGFGRISKDRFHKTEAE 75

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
           L   I I   +    + +  KA NT  N +       +       +L+V   Y   RT  
Sbjct: 76  LFADIAIGMGVPPEKVILETKASNTGENIRFTYNLLMQRGLRPKSLLLVHKPYMERRTLA 135

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKI 166
             ++         + + S D+         
Sbjct: 136 TFKKQWQDSNVEIF-VTSPDIAYEDYFTDE 164


>gi|229529254|ref|ZP_04418644.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio cholerae 12129(1)]
 gi|229333028|gb|EEN98514.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio cholerae 12129(1)]
          Length = 282

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 79/234 (33%), Gaps = 42/234 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 49  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTLDYVMVLGNGHVIDDDIPPTS 108

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG      VS   ++ ++ +   + +  I +  
Sbjct: 109 ELTRAALMRLTEGIRISRMYPGSKLILSGYAGGSEVSHARMMARVALALGVPKSDIILLE 168

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +T   A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 169 TAKDTWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 223

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIEEI 204
                    I   R L        E L ++  +++ +++  +       L   +
Sbjct: 224 NIIQPWDKYIPRSRYLEQTEQYWHETLGLMWQTLRDTVAGDSGE---PVLTPPM 274


>gi|291278482|ref|YP_003495317.1| hypothetical protein DEFDS_0049 [Deferribacter desulfuricans SSM1]
 gi|290753184|dbj|BAI79561.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 237

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 69/207 (33%), Gaps = 25/207 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEPI--------- 48
           ++ F     + + F  +     I     + +          A+V+L G            
Sbjct: 34  IKRFLIFSALIIYFLSISPTKDILLYPLIVKFEDKKCSDFDAVVILGGGVYADGELKEDS 93

Query: 49  --RIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTE 104
             R+   + + +      I   G      +    +++   +        I I   + +T 
Sbjct: 94  LKRLVEGYLIAKKANKPIILSGGKVFKNLEPESLIMRNKLLNLGFDGE-IFIDDTSKDTN 152

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI- 163
            NA         NNF+ VL++T  YH  R+ +  ++       +   +     ++ + + 
Sbjct: 153 ENATFVKKIIAANNFNKVLLITSGYHAMRSKMLFEKHGINSCVVL--VDKKIDKKYNFVD 210

Query: 164 -----FKIKILRVLLIEYLKILLLSIQ 185
                  +  +  ++ EYL IL  S++
Sbjct: 211 FLPVASNLHTISKVIKEYLGILYYSMK 237


>gi|114321439|ref|YP_743122.1| hypothetical protein Mlg_2290 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227833|gb|ABI57632.1| protein of unknown function DUF218 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 252

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 54/195 (27%), Gaps = 33/195 (16%)

Query: 19  FISFIRYVKQMHIP--DHPSVSAIVVLTGEPI-----------------RIERAFELLEN 59
            ++ +           DHP   AIVVL                      R+     L   
Sbjct: 60  LLAPLEQRHPPVHDARDHPEAQAIVVLGSGYSPHLALPVTAQLNDSGLVRLNEGIRLHRQ 119

Query: 60  QIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
           +    + +SG             ++  I   +A+  +    +  +T   A        + 
Sbjct: 120 RPALPLIVSGGARPDQAPIAEGFRRAAIALGVADDRLLPLTEPRDTAQEAYATREVLGE- 178

Query: 118 NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH-----DLEENSSIFKIKILR-- 170
               VL+VT   H+ R      R    +  IP P                I     LR  
Sbjct: 179 -GATVLLVTSASHIHRAQAHFHRA--GLNPIPAPTRHKAGHVRPATPGYWIPSATHLRKS 235

Query: 171 -VLLIEYLKILLLSI 184
              L EY+ +L   +
Sbjct: 236 ERALYEYMGLLAAGL 250


>gi|228990732|ref|ZP_04150697.1| hypothetical protein bpmyx0001_14940 [Bacillus pseudomycoides DSM
           12442]
 gi|228769258|gb|EEM17856.1| hypothetical protein bpmyx0001_14940 [Bacillus pseudomycoides DSM
           12442]
          Length = 193

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 80/194 (41%), Gaps = 27/194 (13%)

Query: 10  VCLIFFIMGFISFIRY--VKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELL 57
           + +I  I+G+I F++Y   K  H+        +++L  +            RI++A E L
Sbjct: 12  LVVIMIIVGYIGFLQYNIYKHGHMEAPNDADYMILLGAKVKGTEPSYSLQYRIDKAAEYL 71

Query: 58  ENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           +      + +SG       +S+   ++K  + Q +AE  I +  ++ NT+ N + + +  
Sbjct: 72  KTHEQTIVIVSGGKGKGEDISEARAMKKGLMTQSIAEQRIIMEDRSTNTDENIEFSKSLI 131

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             N     +IVT+D+HM R     ++    V  +P       + +++           + 
Sbjct: 132 PANK-KKGMIVTNDFHMFRAKKIAEKQGLKVNGLPAKTPKSIIIQSN-----------VR 179

Query: 175 EYLKILLLSIQLSL 188
           EY  I    +   +
Sbjct: 180 EYFAITQYWLTNRI 193


>gi|229090673|ref|ZP_04221906.1| hypothetical protein bcere0021_14970 [Bacillus cereus Rock3-42]
 gi|228692615|gb|EEL46341.1| hypothetical protein bcere0021_14970 [Bacillus cereus Rock3-42]
          Length = 172

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 71/184 (38%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 2   GFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIV 60

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +      +N    +I
Sbjct: 61  SGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMI 119

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 120 VTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IREYLAITQYWF 168

Query: 185 QLSL 188
              +
Sbjct: 169 MNRI 172


>gi|75911018|ref|YP_325314.1| hypothetical protein Ava_4822 [Anabaena variabilis ATCC 29413]
 gi|75704743|gb|ABA24419.1| Protein of unknown function DUF218 [Anabaena variabilis ATCC 29413]
          Length = 215

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 64/198 (32%), Gaps = 22/198 (11%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGEPI----------RI 50
           ++ ++ L   +   +    S    +    +   +    A +VL               RI
Sbjct: 22  KWLFWILITIISALLFAISSTAISIYSYGNSSYNNKADAAIVLGAAVWGEEPSPVFRERI 81

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N    KI  +G     +  ++ I+ +     + +    I    ++  T  N 
Sbjct: 82  NHAINLYKNGAISKIIFTGGVGEINEPAEAIVGKHYATARGVKTADIITETQSRTTYQNL 141

Query: 108 QEASAWAEKN-NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           + A    + N  F   LI++   H+ R  L  + +   +   P P  +      +     
Sbjct: 142 KNAIEVVDTNEKFTKFLIISDPLHLKRAVLMARNL--GIDAYPSPTPTTRYRSFN----- 194

Query: 167 KILRVLLIEYLKILLLSI 184
             +  L+ E     +  +
Sbjct: 195 SQMEFLIRETYFYFIYLV 212


>gi|50121475|ref|YP_050642.1| hypothetical protein ECA2551 [Pectobacterium atrosepticum SCRI1043]
 gi|49612001|emb|CAG75450.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 282

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 57/224 (25%), Gaps = 37/224 (16%)

Query: 5   WYGLFVCLIFFIMG-FISFIRYVKQM--HIPDHPSVSAIVVLTGEP-------------- 47
           W  L +  +  +    +  +                  IVVL G                
Sbjct: 47  WLMLILLSLQPVADRLLLPLESQYPTWQQTSQASKADYIVVLGGGYTYNAEWAPSSNLIS 106

Query: 48  ---IRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
               R+     L     G K+  +G     + VS       +     +    I I     
Sbjct: 107 NSLPRVTEGIRLYHANPGAKLIFTGGAAQGNPVSSAKTAALVAESLGIPRQDIVILDTPR 166

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE-- 159
           +TE  A   +           L+VT   H+PR     Q     +  IP P     +    
Sbjct: 167 DTEEEAAATAKIV---GDRPFLLVTSANHLPRAIRFFQAQ--GLAPIPAPANQMAITSAL 221

Query: 160 NSSIFKIKILRVL------LIEYLKILLLSIQL-SLSTQTASQF 196
           N           L        E L  L   ++  S +   A Q 
Sbjct: 222 NPWEKVFPSAYYLSHSERAWYETLGRLWQLLKGTSAAPHDAEQP 265


>gi|225548067|ref|ZP_03769352.1| hypothetical protein RUMHYD_00046 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040743|gb|EEG50989.1| hypothetical protein RUMHYD_00046 [Blautia hydrogenotrophica DSM
           10507]
          Length = 196

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 57/167 (34%), Gaps = 22/167 (13%)

Query: 37  VSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------------------K 76
              I V      ++ ERA +L +      +  SG + +                     +
Sbjct: 22  ADIIFVPGNGYPQMAERAAKLWKAGFAPYVLPSGKYSTAFGEFSGVLDKKEEYQGTFSTE 81

Query: 77  DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRT 134
              L+++ ++  + +  I    +A  TE NA+ +    E         ++   +YH  R 
Sbjct: 82  WEFLREVLVKNGVPDYAILREDQATYTEQNARYSRRVTEHAGITVKRAMLCCKNYHARRA 141

Query: 135 FLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           +L  Q+      F   P     ++ N+     + +  +  E  +I+ 
Sbjct: 142 YLYYQQYFPNTVFHVLPSCVDGIDRNNWNKTKEGVLAVTGEVTRIIY 188


>gi|146279502|ref|YP_001169660.1| H+/gluconate symporter and related permease-like protein
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145557743|gb|ABP72355.1| H+/gluconate symporter and related permease-like protein
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 187

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 60/175 (34%), Gaps = 10/175 (5%)

Query: 25  YVKQMHIPDHPSVS-AIVVLTGEPIRIERAFELLENQIGEKIFISGV---HHSVSKDILL 80
                       V  A V+ +     +  A  L ++ +  K+ ISG        ++    
Sbjct: 11  SAFLFRKCRPEPVDLAFVLCSPTISSLHPAIALYKSGLTPKLLISGAGVAVDGSTEWSFY 70

Query: 81  QKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN----NFHHVLIVTHDYHMPRTFL 136
           +   +   +AE  + +   A NT  NA   +A  EK         + +    +HM R  +
Sbjct: 71  RDHALDAGVAESALLLEKAARNTAENAAFGAAVIEKELGWAKVRSLAVCAKPFHMRRAIM 130

Query: 137 ELQRINS-TVQFIPYPII-SHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
            L+R     V+ +  P     DL   +        + +  E  KI   +++  L 
Sbjct: 131 TLRRHVPADVRLVAQPPDDPGDLSAETWWQTAPGRQRIFAELGKISEYALKGDLG 185


>gi|310780398|ref|YP_003968730.1| protein of unknown function DUF218 [Ilyobacter polytropus DSM 2926]
 gi|309749721|gb|ADO84382.1| protein of unknown function DUF218 [Ilyobacter polytropus DSM 2926]
          Length = 252

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 67/189 (35%), Gaps = 26/189 (13%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGE---------------PIRIERAFELLENQIGEKIFIS 68
             V+     +     A VVL G                 +R+     L  +         
Sbjct: 66  NRVQPAAAEEIEKGEAYVVLGGGIIEKTPVGNIPSETASVRLMNTAILYNSHPKTIYITG 125

Query: 69  GV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           G   +  VS+  + +KI I  ++ +  I    ++  T  NA+  S   +K+N  ++++VT
Sbjct: 126 GKVTNQQVSESSVYKKILIGLNIPDSDILTEERSRTTMENARYTSELLKKSNIKNIVLVT 185

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPI-------ISHDLEENSSIFKIKILRVLLIEYLKI 179
              HM R+ +  ++       +P P          + L+       +     L+ E+  I
Sbjct: 186 SASHMTRSKMTFEKQ--GFNVVPAPCGYIQNYKNYNMLDFIPRSDNLSYFMRLIWEFAGI 243

Query: 180 LLLSIQLSL 188
           +   I+  L
Sbjct: 244 VYYGIRGYL 252


>gi|221197747|ref|ZP_03570793.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221204695|ref|ZP_03577712.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221214890|ref|ZP_03587858.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221165117|gb|EED97595.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221175552|gb|EEE07982.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221181679|gb|EEE14080.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 238

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 65/221 (29%), Gaps = 38/221 (17%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLT----------- 44
           R               G++           V+ +  PD    + ++VL            
Sbjct: 22  RRIALAAVALFWLIASGWLAAPFVAWAEAGVEPVEHPDMHGQTVLIVLGAGTQRADDGLR 81

Query: 45  ---GEPIRIERAFELLENQIG----EKIFISGVHHSVS---KDILLQKIPIRQDLAECCI 94
                  RI +A EL            + +SG         +  +  +  +   +    +
Sbjct: 82  PPRDGAARIRKAAELYRTCRRQAERCTVVMSGGDPQHHGDTEAAVYGRGLVAAGIDPGDL 141

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  K+  T  NAQ  ++          +++T  Y M R  L+ +R        P P+ +
Sbjct: 142 VLEPKSRTTYENAQFTTSILRSRRDDARILITSSYQMRRALLDFRRFG----IDPQPVFA 197

Query: 155 HDLEEN-SS---IFKIKILRVLLIEYLKIL---LLSIQLSL 188
           +  E +         +    + L E + I    +  +    
Sbjct: 198 NRREAHTGWLPRWSNVVAAELALHELIGIAQFHVYRLIGRF 238


>gi|309778681|ref|ZP_07673455.1| periplasmic protein [Ralstonia sp. 5_7_47FAA]
 gi|308922531|gb|EFP68154.1| periplasmic protein [Ralstonia sp. 5_7_47FAA]
          Length = 207

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 62/194 (31%), Gaps = 18/194 (9%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQM-HIPDHPSVSAIVVLTGEPI----------RI 50
           R    G  +  + F +G       +        +  V A +VL               RI
Sbjct: 13  RAIVIGPLMLALLFAIGLFIVAWQIVSYGEQSFNAPVDAAIVLGAAVWGNKPSPVYRERI 72

Query: 51  ERAFELLENQIGEKIFISGVHH---SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A    +N+    +  +G        S+  + ++  I+  +    I     +  T  N 
Sbjct: 73  NEAITRYQNKQVRYLVFTGGTPGADYPSEGKVGREYAIKHGVPPDAILAETTSRTTWQNL 132

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
             A    +    H VL+V+   H+ R       I   +Q +P P  S   E  S+     
Sbjct: 133 VNAKKLLDPLGIHTVLLVSDPLHLRRATAMANDI--GLQALPGPTSSSRFESLSTRANFL 190

Query: 168 ILRVLLIEYLKILL 181
              + L  YL  L+
Sbjct: 191 WREIWL--YLDYLI 202


>gi|226307188|ref|YP_002767148.1| hypothetical protein RER_37010 [Rhodococcus erythropolis PR4]
 gi|226186305|dbj|BAH34409.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 229

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 60/196 (30%), Gaps = 21/196 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R    G  +  +  + G    +  V +  I D     AIVVL               R+E
Sbjct: 29  RRLIAGAVLMAVVLVGGTAFRVWQVAR--IDDTRPADAIVVLGAAQYSGTPSSVFEARLE 86

Query: 52  RAFELLENQIGEKIFISGVHHSVSKDILL---QKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           +A++L +  +  +I   G      +       +     + +    I       +T  +  
Sbjct: 87  QAYKLYKRGVAPQIITVGGKQEGDEYTEAASGKMYLTDRGIPSSAITAVETGSDTLLSID 146

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             SA       +  ++V+  +H  RT    +          +   +   +  +   +   
Sbjct: 147 AVSAEMSSQGINSAVLVSDPWHSLRTRTMAR----DTGLQAW--TAPTRQGPAVFTRESQ 200

Query: 169 LRVLLIEYLKILLLSI 184
           L  +  E   +L   +
Sbjct: 201 LHGIARETGALLWYQL 216


>gi|83720198|ref|YP_443090.1| hypothetical protein BTH_I2573 [Burkholderia thailandensis E264]
 gi|83654023|gb|ABC38086.1| Uncharacterized ACR, COG1434 family [Burkholderia thailandensis
           E264]
          Length = 301

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 64/206 (31%), Gaps = 35/206 (16%)

Query: 4   FWYGLFVCLIFFIMGFISFIRY------VKQMHIPDHPSVSAIVVLTGEPIR-------- 49
                   L     G+++          V+ +  P     +AIV+L     R        
Sbjct: 87  ILAAGIALLWLIASGWLAAPLVALAQAGVQPVTHPMMTGNTAIVMLGAGIKRRDGVAAPP 146

Query: 50  ------IERAFELL----ENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDI 96
                 I++  EL            + +SG    V    +        + + +A   +  
Sbjct: 147 HDALARIDKTAELYSACQRTAKRCTVVVSGGDPQVRGITEADTYAPYLLARGVANADLIR 206

Query: 97  GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHD 156
              +  T  NA+  +      ++  +++VT  Y M R  L+ +R       +P P+ ++ 
Sbjct: 207 ESSSHTTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFRRFG----IVPQPVYANR 262

Query: 157 LEENSSIF----KIKILRVLLIEYLK 178
            +           +    + L E + 
Sbjct: 263 RDARLGWLPRAVNLVNAELALHEIIG 288


>gi|30019764|ref|NP_831395.1| putative cytoplasmic protein [Bacillus cereus ATCC 14579]
 gi|229127043|ref|ZP_04256042.1| hypothetical protein bcere0015_14980 [Bacillus cereus BDRD-Cer4]
 gi|29895309|gb|AAP08596.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579]
 gi|228656396|gb|EEL12235.1| hypothetical protein bcere0015_14980 [Bacillus cereus BDRD-Cer4]
          Length = 194

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 71/185 (38%), Gaps = 26/185 (14%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIF 66
           +GF+ +    K   +        I+VL  +            RI++A E L++       
Sbjct: 23  VGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHDKAIAI 81

Query: 67  ISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           +SG       +S+ + ++   ++  +AE  I +  K+ +T+ N + +      +N    +
Sbjct: 82  VSGGKGKGEDISEALAMKNELMKLKIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGM 140

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           IVT+D+HM R      +    ++ +P       +  ++           + EYL I    
Sbjct: 141 IVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN-----------VREYLAITQYW 189

Query: 184 IQLSL 188
               +
Sbjct: 190 FMNRI 194


>gi|37680486|ref|NP_935095.1| hypothetical protein VV2302 [Vibrio vulnificus YJ016]
 gi|320155855|ref|YP_004188234.1| membrane protein [Vibrio vulnificus MO6-24/O]
 gi|326423949|ref|NP_760999.2| membrane protein [Vibrio vulnificus CMCP6]
 gi|37199234|dbj|BAC95066.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319931167|gb|ADV86031.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio vulnificus MO6-24/O]
 gi|319999327|gb|AAO10526.2| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio vulnificus CMCP6]
          Length = 266

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 77/223 (34%), Gaps = 43/223 (19%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +  LF  L  F++ F       +  +     + +P+  +V  ++VL              
Sbjct: 40  FIILFSFLGIFLVSFQPVASKLLMPLERQYSVFLPEVQTVDYVMVLGNGHVVDDQIPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +L+   G K+ +SG       S   ++  + +   +A+  I +  
Sbjct: 100 ELSRASLMRLTEGIRILKMYPGSKLILSGYAGGSETSHARMMANVALALGVAKSDIILLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158
            A +T   A++A+A+  +     +++VT   HM R   E           P P  ++ L 
Sbjct: 160 DAKDTWEEARQAAAFVRQ---KQLVLVTSASHMARAMKEFHDAG----ITPLPAPTNYLA 212

Query: 159 ENS----SIFKIKILRVL------LIEYLKILLLSIQLSLSTQ 191
           + +              L        E L  L   ++  L T 
Sbjct: 213 QKNISQAWDRYAPKAIYLEQTERYWYETLGQLWQGMRDLLLTD 255


>gi|52143746|ref|YP_083083.1| hypothetical protein BCZK1488 [Bacillus cereus E33L]
 gi|51977215|gb|AAU18765.1| conserved hypothetical protein [Bacillus cereus E33L]
          Length = 192

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 71/184 (38%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 22  GFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIV 80

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +      +N    +I
Sbjct: 81  SGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMI 139

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 140 VTNDFHMFRAKKIAAKQGLQLEGLPAATPKRIVIPSN-----------IREYLAITQYWF 188

Query: 185 QLSL 188
              +
Sbjct: 189 MNRI 192


>gi|86140156|ref|ZP_01058718.1| hypothetical protein MED193_11777 [Roseobacter sp. MED193]
 gi|85823093|gb|EAQ43306.1| hypothetical protein MED193_11777 [Roseobacter sp. MED193]
          Length = 164

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 51/142 (35%), Gaps = 10/142 (7%)

Query: 48  IRIERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
            R  +A +L        +   G    H  S+  ++++I     + +  I +  ++  T  
Sbjct: 23  RRCLQAAKLFRRGRVSHVICCGGLGQHPPSEAEVMRQICREAGVPDSAILLEDQSRTTLE 82

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N     A   + +  ++++VT  YH  R  +  +      Q    P  S          +
Sbjct: 83  NLANIRALLARLDQPNIVLVTDRYHKWRALMVARHFGFQAQA-SCPPPSDT-------SR 134

Query: 166 IKILRVLLIEYLKILLLSIQLS 187
            ++L+  L E   ++    +L 
Sbjct: 135 FRVLKSWLREAPALIYYWWRLR 156


>gi|262275607|ref|ZP_06053416.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Grimontia hollisae CIP 101886]
 gi|262219415|gb|EEY70731.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Grimontia hollisae CIP 101886]
          Length = 271

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 74/223 (33%), Gaps = 39/223 (17%)

Query: 5   WYGLFVCLIFFIMGFISF-------IRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
           +      L+ F+  F  F       +    Q  +P    V  ++VL              
Sbjct: 40  FLVFVSLLLIFLTSFQPFTSSLLIKLERQYQPFLPTKEPVDYVMVLGHGHVVDDELPPTS 99

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +       K+ +SG    + VS   +L ++ +   + +  I +  
Sbjct: 100 ELSRVALMRLMEGIRIHFMYPTSKLILSGYDGGYEVSHARMLARVALAMGVNKNNILLLE 159

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHD 156
            A +T   A +A++        ++++VT   HMPR   E Q     +  IP P    +  
Sbjct: 160 TAKDTWEEAFQAASVV---GDSNLVLVTSANHMPRAVYEFQNA--GLNPIPAPTNFMAQK 214

Query: 157 LEENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTA 193
                 I      + L        E L  +   ++  +S Q A
Sbjct: 215 EIRQPWIKYGPRAQYLEQFERYWQENLGQIWQRLRDKVSQQEA 257


>gi|253688162|ref|YP_003017352.1| hypothetical protein PC1_1775 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754740|gb|ACT12816.1| protein of unknown function DUF218 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 282

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 62/224 (27%), Gaps = 37/224 (16%)

Query: 5   WYGLFVCLIFFIMG-FISFIRYVKQM--HIPDHPSVSAIVVLTGEP-------------- 47
           W  L +  +  +    +  +          P    V  IVVL G                
Sbjct: 47  WLALILLSLQPVADRLLLPLESHYPTWRQAPQANKVDYIVVLGGGYTYNAEWAPSSNLIS 106

Query: 48  ---IRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
               R+     L     G K+  +G     + VS       +     + +  I I     
Sbjct: 107 NSLPRVTEGIRLYHANPGAKLIFTGGAAQGNPVSSAKTAALVAESLGIPQQDIVILDTPR 166

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE-- 159
           +TE  A   +           L+VT   H+PR     Q     +  IP P     +    
Sbjct: 167 DTEEEAAATAKIV---GDRPFLLVTSANHLPRAIRFFQAQ--GLAPIPAPANQMAITSAL 221

Query: 160 NSSIFKIKILRVL------LIEYLKILLLSIQL-SLSTQTASQF 196
           N           L        E L  L  +++  S +  +A Q 
Sbjct: 222 NPWEKVFPSAYYLSHSERAWYETLGRLWQALKGTSATPHSAEQP 265


>gi|308125795|ref|ZP_07663526.1| conserved inner membrane protein [Vibrio parahaemolyticus K5030]
 gi|308113292|gb|EFO50832.1| conserved inner membrane protein [Vibrio parahaemolyticus K5030]
          Length = 187

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 60/152 (39%), Gaps = 15/152 (9%)

Query: 48  IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           +R+     +L    G K+ +SG      +S   ++  + +   +A+  I +   A +T  
Sbjct: 33  MRLTEGIRILRMYPGAKLILSGYDGGSEISHARMMANVALALGVAKSDIILLEDAKDTWE 92

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDLEENSSI 163
            A++A+A+ ++     +++VT   HM R   E       ++ IP P    + D       
Sbjct: 93  EARQAAAFVQQ---KEIVLVTSASHMSRALYEFNAA--GIKPIPAPTNFLAIDEVSQPWD 147

Query: 164 FKIKILRVL------LIEYLKILLLSIQLSLS 189
                 R L        EYL  +   ++ ++ 
Sbjct: 148 KYSPKARYLEQTELFWHEYLGSVWQRLRDTVG 179


>gi|322433354|ref|YP_004210571.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX9]
 gi|321165743|gb|ADW71444.1| protein of unknown function DUF218 [Acidobacterium sp. MP5ACTX9]
          Length = 199

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 56/168 (33%), Gaps = 15/168 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG-----------EPIR 49
           MR FW    V +       IS++            S  AI+V+             +  R
Sbjct: 1   MRKFWLVFAVVVCIMTGMAISYL--TVPKENGQLESFDAIIVIGCPTADDGTLSPMQKAR 58

Query: 50  IERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +    +       + +  SG   ++   +  ++ +      +    + +  +A NT GN 
Sbjct: 59  VLEGVKEFSAGKAKHLIFSGGASNNHSIESQVMAQAAAEMGVPNEAVFLDQEANNTLGNI 118

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155
             +        ++   +++   H+PR  + L   N + Q    P   +
Sbjct: 119 FFSHLIMTGKGWNSAEVISSQNHLPRLGVILALYNFSWQTHAAPWPPN 166


>gi|15893732|ref|NP_347081.1| hypothetical protein CA_C0441 [Clostridium acetobutylicum ATCC 824]
 gi|15023296|gb|AAK78421.1|AE007558_11 Uncharacterized conserved membrane protein of SANA family
           [Clostridium acetobutylicum ATCC 824]
 gi|325507855|gb|ADZ19491.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 259

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 60/160 (37%), Gaps = 16/160 (10%)

Query: 10  VCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLEN 59
           +     ++   +    V          +  I+VL               R+++A E ++ 
Sbjct: 76  IVCAICVVFIFTEAVLVYNGQSEYKGKLDYIIVLGAGLRGKHMLGTQYERVKKAAEYVKE 135

Query: 60  QIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
               KI +SG       +S+   +++  + +      I +  K+ NT  N + +    EK
Sbjct: 136 NPDVKIVVSGGKGNGEDISEAEAMKQYFLNKGFKNDSIIMEDKSKNTFENLRNSKKILEK 195

Query: 117 NNFHHVL---IVTHDYHMPRTFLELQRINSTVQFIPYPII 153
            +    +   +VT  YH+ R  L  +R+   +  IP PI 
Sbjct: 196 ISNKKEIRVGVVTSSYHITRAKLLGKRVGLKLYAIPAPIN 235


>gi|110597106|ref|ZP_01385395.1| Protein of unknown function DUF218 [Chlorobium ferrooxidans DSM
           13031]
 gi|110341297|gb|EAT59762.1| Protein of unknown function DUF218 [Chlorobium ferrooxidans DSM
           13031]
          Length = 249

 Score = 68.3 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 70/222 (31%), Gaps = 39/222 (17%)

Query: 2   RYFWYGLFVCLI------FFIMGFISFIRYVK-QMHIPDHPSVSAIVVLT---------- 44
           R    GL + ++            I  +     ++ +    +  A+VVL+          
Sbjct: 30  RRLLIGLAIMVLGMFSLPVVSTSLIRAVEGWSTRVPVSSLHNADAVVVLSGIVVQLEGAP 89

Query: 45  -----GEPIRIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCI 94
                    R E   +L +      I  +         +V +  LL K      + E  I
Sbjct: 90  LGEWNDGVDRFEGGIDLFKAGKAPVIVFTRGQVPWQPDAVPEGELLAKRATLLGVPENAI 149

Query: 95  DIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            +   A NT   A  A       +     +++VT  +HM R  ++ ++     Q   YP+
Sbjct: 150 LLTAVAGNTADEAVAAGKLLGVRSGVRKKIILVTSAFHMRRAAMQFEKA--GFQVDRYPV 207

Query: 153 -----ISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQL 186
                 + ++     +     L    + L E +  L   ++ 
Sbjct: 208 DFQAGDNSEMTILDFLPDAGALEMSSIALREMIGWLYYWVKG 249


>gi|254254401|ref|ZP_04947718.1| hypothetical protein BDAG_03699 [Burkholderia dolosa AUO158]
 gi|124899046|gb|EAY70889.1| hypothetical protein BDAG_03699 [Burkholderia dolosa AUO158]
          Length = 204

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 28/206 (13%), Positives = 66/206 (32%), Gaps = 20/206 (9%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI------RIERAFELLEN 59
                C+       ++      +    D   +    +            R++       +
Sbjct: 2   LAAVACIWIVAAVALAAYGMRMRSEPADVAVIFGSALDDDGAPKPVLTARLDVGVHCYRS 61

Query: 60  QIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN 117
                I +SG      +++   ++   + + +    I +  +  NT   AQ   A+   +
Sbjct: 62  GRCPVILVSGGIDGPGLNEATAMRDYLVARGVPADRIAVDDQGDNTLATAQHTLAYMRAH 121

Query: 118 NFHHVLIVTHDYHMPRTFLELQRIN--STVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
               VLIV+  YH+ R  L  +R+    +  ++ YP      +  SS  ++         
Sbjct: 122 RMSRVLIVSQYYHLARARLAFERVGIEPSNIYVAYPRAFQLRDVYSSWREVPA------- 174

Query: 176 YLKILLLSIQLSLSTQTASQFFITLI 201
                + +++L L        F  ++
Sbjct: 175 ---YAVYAVRLWLDPDARPMSFRPML 197


>gi|254506207|ref|ZP_05118351.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
 gi|219551025|gb|EED28006.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
          Length = 198

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 39/119 (32%), Gaps = 10/119 (8%)

Query: 37  VSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIPIRQD 88
              I VL    +R+ E A  L      + +  SG    ++       +      I     
Sbjct: 10  SDCIFVLGSNDLRVAEYAATLYLEGWAKTLIFSGGVGRLTDGVFDKSEAETFADIAKDMG 69

Query: 89  LAECCIDIGYKALNTEGNAQEASAWAEK--NNFHHVLIVTHDYHMPRTFLELQRINSTV 145
           +    I +  KA NT  N    ++   +  + F   ++V   Y   RT+    +    V
Sbjct: 70  VPSNAIIVENKATNTGENVLYTASLLNQLGHRFSSFILVQKPYMERRTYATFIKQWPGV 128


>gi|115359113|ref|YP_776251.1| hypothetical protein Bamb_4365 [Burkholderia ambifaria AMMD]
 gi|115284401|gb|ABI89917.1| protein of unknown function DUF218 [Burkholderia ambifaria AMMD]
          Length = 210

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/215 (12%), Positives = 62/215 (28%), Gaps = 26/215 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIR 49
           M      L      +I+  +  +    +M           V+                 R
Sbjct: 1   MARIGRVLAAFACLWIVAAVVLVGAGMRMPSE---PADVAVIFGNALDDRGAPKPVLAAR 57

Query: 50  IERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++               +SG      +++   ++   + + +    I +  +  NT   A
Sbjct: 58  LDVGVRCYREGQCPAFLVSGAIDGPGLNEATAMRDYLVARGVPAERIAVDDQGDNTLATA 117

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI-NSTVQFIPYPIISHDLEENSSIFKI 166
           Q   A+ + +    VLI++  YH+ R  L  +R+  +           H  +        
Sbjct: 118 QHTRAYLQAHRLSRVLIISQYYHLARARLAFERVGIAGANI--SAAYPHHFQLRDIYSSW 175

Query: 167 KILRVLLIEYLKILLLSIQLSLSTQTASQFFITLI 201
                   E     +  ++L L+       F  ++
Sbjct: 176 -------REVPAYAIYVLRLWLNPDARPVSFRPML 203


>gi|239979284|ref|ZP_04701808.1| integral membrane protein [Streptomyces albus J1074]
          Length = 254

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 49/173 (28%), Gaps = 19/173 (10%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
                +   L      ++ F          D       VV                R++ 
Sbjct: 48  LLAVMVLCVLALLPAAWMRFSADGHLRSTADVERTEVAVVFGAGLWGEEPSPYLARRLDA 107

Query: 53  AFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
           A EL E    E + ++G +      +   +++  + + + +  I   Y   +T  +   A
Sbjct: 108 AAELYEAGRTEVVLVTGDNSREEYDEPEAMRRYLVARGVPDHRIVSDYAGFDTWDSCVRA 167

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
                       ++++  +H+ R     +          Y I   D  + S  
Sbjct: 168 RKIF---GVDKAVLISQGFHIHRAVTLCRSAG----LQAYGIGVDDRHDVSWY 213


>gi|160899211|ref|YP_001564793.1| hypothetical protein Daci_3776 [Delftia acidovorans SPH-1]
 gi|160364795|gb|ABX36408.1| protein of unknown function DUF218 [Delftia acidovorans SPH-1]
          Length = 280

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 68/203 (33%), Gaps = 29/203 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHI--PDHPSVSAIVVLTGE----------PI 48
           +R  W+  +  L  +++  + F  ++       P    V AIVVL               
Sbjct: 84  LRRAWWLGWAALAMWLVSLLVFWAHLLSASSGLPPDQPVQAIVVLGSATRDGQPSLTLAQ 143

Query: 49  RIERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIRQ-DLAECCIDIGYKALNTE 104
           R++RA EL   Q    +  SG        S+  ++ +   ++  L    + +  ++ +T 
Sbjct: 144 RLDRAAELAARQPKALVLTSGGVDFGESESEGAIMARYLQQRHGLPPERLLMEERSTSTA 203

Query: 105 GNAQEASAWAEKNNFHH---VLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
            N   +    +         + IVT D+H  R     +R      F         +  N+
Sbjct: 204 LNLAWSLPLLQARGVEPQAAIAIVTSDFHTLRAGWIAERSGYGQAFTVGAPTPVTIRANA 263

Query: 162 SIFKIKILRVLLIEYLKILLLSI 184
                      L EY  ++   +
Sbjct: 264 W----------LREYFAVISGWV 276


>gi|255065363|ref|ZP_05317218.1| putative SanA protein [Neisseria sicca ATCC 29256]
 gi|255050188|gb|EET45652.1| putative SanA protein [Neisseria sicca ATCC 29256]
          Length = 224

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 55/163 (33%), Gaps = 15/163 (9%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------GEPIRIER 52
           F   LF       +  +     V ++         A VVL+               R+E 
Sbjct: 35  FILVLFFTAALLPLWIMWRDFQVSRLDADTVRPADAAVVLSTRSYEGGRLNPCLVARVEA 94

Query: 53  AFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
           A EL      +K+ +SG      +     +Q I  +  +++  I    +A NT  N   +
Sbjct: 95  AVELYRAGKVKKLVMSGGLSRDFQSASGNMQAIAEKMGVSKEDIIQERRAENTFENIVFS 154

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             + E +    V+IV+  +H+ R  +   R         Y   
Sbjct: 155 RDFIENSP--RVVIVSAGFHLARAQMMADRQWQGHDIQVYAAP 195


>gi|152975134|ref|YP_001374651.1| hypothetical protein Bcer98_1335 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152023886|gb|ABS21656.1| protein of unknown function DUF218 [Bacillus cytotoxicus NVH
           391-98]
          Length = 193

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 76/194 (39%), Gaps = 27/194 (13%)

Query: 10  VCLIFFIMGFISFI--RYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELL 57
           +  +F I+G+ISF+     +  H+        ++VL               RI+ A   L
Sbjct: 12  LITMFIIIGYISFLQYEIYRHGHMEVKNDADYMIVLGTSVKGSKPSYALQYRIDAAANYL 71

Query: 58  ENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           +        +SG       +S+ + +++  ++Q ++E  + +  ++ NT+ N   +    
Sbjct: 72  KQNERTIAILSGGQGKKEHISEALAMKRGLMKQGISEERMILEDRSTNTDENITFSKELI 131

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             +     L+VT+D+HM R     ++    ++             ++   K  +++  + 
Sbjct: 132 PPDR-KKGLLVTNDFHMFRAKKIAEKQGLHLE-----------GLSARTPKPIVIKSNIR 179

Query: 175 EYLKILLLSIQLSL 188
           EY  I    +   +
Sbjct: 180 EYFAITKYWMLNRI 193


>gi|295106209|emb|CBL03752.1| Uncharacterized membrane protein [Gordonibacter pamelaeae 7-10-1-b]
          Length = 214

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 51/177 (28%), Gaps = 39/177 (22%)

Query: 37  VSAIVVLTGE-----------PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKI 83
             AIVVL                R++    L       K+ +SG + +VS + +  ++  
Sbjct: 42  ADAIVVLGASVFADGTPSGILQDRLDDGIALYRAGAAPKMIMSGDNSTVSYNEVKAMKDY 101

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
            I Q +    I   +   +T  +   A           +++ T  YH+ R     Q    
Sbjct: 102 AIAQGVPSEDIFCDHAGFSTYESMYRAKHVF---GAERIVVATQTYHLYRALYSAQ---- 154

Query: 144 TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQFFITL 200
            +      + S                     Y K     ++          FF TL
Sbjct: 155 GLGVEALGVPSDYHA-----------------YSKQTQYDLREI--PARTKDFFKTL 192


>gi|260802380|ref|XP_002596070.1| hypothetical protein BRAFLDRAFT_118064 [Branchiostoma floridae]
 gi|229281324|gb|EEN52082.1| hypothetical protein BRAFLDRAFT_118064 [Branchiostoma floridae]
          Length = 321

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 21/141 (14%), Positives = 43/141 (30%), Gaps = 10/141 (7%)

Query: 37  VSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG-------VHHSVSKDILLQKIPIRQD 88
              I+VL     R+ E A  L  +   E +  SG             +  +   I +   
Sbjct: 123 SDVILVLGCHDTRVAEYAARLWLDGWAEYLLFSGNLGHFTKGVWDRPEAEIFHDIAVSMG 182

Query: 89  LAECCIDIGYKALNTEGNAQEASAWAEKNNFH--HVLIVTHDYHMPRTFLELQRINSTVQ 146
           + +  I     A NT  N + +     ++      V++V   Y   RT+    +     +
Sbjct: 183 VPDDKILREPMATNTGENIKFSHRVLRQHKVKANSVILVQMPYMERRTYATFVKQWPGDK 242

Query: 147 FIPYPIISHDLEENSSIFKIK 167
              + +++             
Sbjct: 243 ENTHVVVTSPRIAFQDYPSDD 263


>gi|229144329|ref|ZP_04272735.1| hypothetical protein bcere0012_14900 [Bacillus cereus BDRD-ST24]
 gi|228639116|gb|EEK95540.1| hypothetical protein bcere0012_14900 [Bacillus cereus BDRD-ST24]
          Length = 194

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 71/185 (38%), Gaps = 26/185 (14%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIF 66
           +GF+ +    K   +        I+VL  +            RI++A E L++       
Sbjct: 23  VGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAI 81

Query: 67  ISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           +SG       +S+ + ++   ++  +AE  I +  K+ +T+ N + +      +N    +
Sbjct: 82  VSGGKGKGEDISEALAMKNELMKLKIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGM 140

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           IVT+D+HM R      +    ++ +P       +  ++           + EYL I    
Sbjct: 141 IVTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN-----------VREYLAITQYW 189

Query: 184 IQLSL 188
               +
Sbjct: 190 FMNRI 194


>gi|291451163|ref|ZP_06590553.1| integral membrane protein [Streptomyces albus J1074]
 gi|291354112|gb|EFE81014.1| integral membrane protein [Streptomyces albus J1074]
          Length = 228

 Score = 68.3 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 22/173 (12%), Positives = 49/173 (28%), Gaps = 19/173 (10%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
                +   L      ++ F          D       VV                R++ 
Sbjct: 22  LLAVMVLCVLALLPAAWMRFSADGHLRSTADVERTEVAVVFGAGLWGEEPSPYLARRLDA 81

Query: 53  AFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
           A EL E    E + ++G +      +   +++  + + + +  I   Y   +T  +   A
Sbjct: 82  AAELYEAGRTEVVLVTGDNSREEYDEPEAMRRYLVARGVPDHRIVSDYAGFDTWDSCVRA 141

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
                       ++++  +H+ R     +          Y I   D  + S  
Sbjct: 142 RKIF---GVDKAVLISQGFHIHRAVTLCRSAG----LQAYGIGVDDRHDVSWY 187


>gi|188586776|ref|YP_001918321.1| protein of unknown function DUF218 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351463|gb|ACB85733.1| protein of unknown function DUF218 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 194

 Score = 68.3 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 68/195 (34%), Gaps = 20/195 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           + F   L V ++  I    + IR        +     A +VL               R+ 
Sbjct: 4   KKFLIPLAVIIMLII---FAAIRIWTFGAQNELVDADAAIVLGAAVWDGQPSPVFEERLN 60

Query: 52  RAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A  + EN+  +K+ ++G        ++  + +   I+  + +  I I  K+  TE N +
Sbjct: 61  HAIWIYENEYVDKLILTGGKAEDTDRAESQVAKDYAIKNQVQKDDILIETKSSITEENFK 120

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            A   A ++     ++V+   HM R     +     +   P P      E   S     I
Sbjct: 121 YAQEIAAEHELESFIVVSDPLHMRRAITIAE--TKGMDVYPSPTPGSAYETLRSQVPFLI 178

Query: 169 LRVLLIEYLKILLLS 183
             V+   Y+  ++  
Sbjct: 179 REVIF--YIGYIISL 191


>gi|148975915|ref|ZP_01812704.1| hypothetical protein VSWAT3_06376 [Vibrionales bacterium SWAT-3]
 gi|145964660|gb|EDK29913.1| hypothetical protein VSWAT3_06376 [Vibrionales bacterium SWAT-3]
          Length = 253

 Score = 68.3 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 71/215 (33%), Gaps = 37/215 (17%)

Query: 3   YFWYGLFVCLIFFIMGFISFIR------YVKQMHIPDHPSVSAIVVLTGE---------- 46
           +    L    +    GFI            +          +AIV+L             
Sbjct: 27  FLSLVLISSFVLIGSGFIPRYLLDDLQANYESKSENQWSDNNAIVLLGAGTQLIKSTQEF 86

Query: 47  ------PIRIERAFELLENQ----IGEKIFISGVH---HSVSKDILLQKIPIRQDLAECC 93
                   RI       ++        K+ ISG     + V++  + ++  +R  + +  
Sbjct: 87  EPAFFSYGRISETASQYKDCAKSDTKCKVIISGGDAQGNGVTEAEIYEQQLLRLGVPKAD 146

Query: 94  IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
           I     ++NT  NAQ  S   + + F ++++V+   H+ R+ L        ++ I  P+ 
Sbjct: 147 IIQEPNSVNTWKNAQLTSDLMKHHQFDNIILVSSGLHIRRSELYFNHF--GLEVI--PVR 202

Query: 154 SHDLEEN-SS---IFKIKILRVLLIEYLKILLLSI 184
           S  +    S     +   +    L E +     +I
Sbjct: 203 SDYMAAQISWLPLWYNFAVTDFALHEQIGFARYNI 237


>gi|315304604|ref|ZP_07874845.1| putative cytoplasmic protein [Listeria ivanovii FSL F6-596]
 gi|313627033|gb|EFR95925.1| putative cytoplasmic protein [Listeria ivanovii FSL F6-596]
          Length = 189

 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 30/170 (17%), Positives = 61/170 (35%), Gaps = 18/170 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIV---VLTGEPI-------RI 50
           +R  +    V  + ++      +    Q    D+     I+   V+            R+
Sbjct: 4   LRKIFIVFIVISLLYLFIVAICMFSGTQTKPSDNAKTVLILGAKVIGEPAQPSHVLQERL 63

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A + L      ++ +SG      S ++  ++++  + + +    ID   K+  TE N 
Sbjct: 64  DAAVDYLNEHPKARVIVSGGQGTDESETEASVMEEYLVNEGIRRARIDTETKSKRTEENI 123

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
             +     K      +IVT DYHM R  +  +R    +     P  S  +
Sbjct: 124 SNSKE---KFQLEKTVIVTSDYHMYRALMLAKRQ--NIDATGLPAKSKTI 168


>gi|311894949|dbj|BAJ27357.1| hypothetical protein KSE_15300 [Kitasatospora setae KM-6054]
          Length = 240

 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 19/173 (10%), Positives = 51/173 (29%), Gaps = 21/173 (12%)

Query: 4   FWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIE 51
           ++  + +C +  +    ++   +  K   +   P     VV                R++
Sbjct: 30  WFQAVLLCSVLGLAPNAWLYLTQSAKVGTVASAPEAPVAVVFGAGLVDGEPSPYLAHRLD 89

Query: 52  RAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
            A EL        I ++G        +   ++   I + +    +   Y   +T  +   
Sbjct: 90  AALELYRAHKVRAILVTGDNGTVQYDETDAMRGYLIGRGVPAVRVVGDYAGFDTWDSCTR 149

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
           A            ++V+  +H+ R     +          Y +   +  + + 
Sbjct: 150 AHRIF---GVDRAVLVSQTFHVRRALALCEAAG----IDAYAVGVEEWHDTTW 195


>gi|150389466|ref|YP_001319515.1| hypothetical protein Amet_1679 [Alkaliphilus metalliredigens QYMF]
 gi|149949328|gb|ABR47856.1| protein of unknown function DUF218 [Alkaliphilus metalliredigens
           QYMF]
          Length = 196

 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/197 (14%), Positives = 68/197 (34%), Gaps = 32/197 (16%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIR 49
           +RY    LF+ +       +  +               A VVL  +             R
Sbjct: 13  IRYILGVLFIWVA------VHVLITTFDGLNDKTEIADAAVVLGNKVELDGTPSPRLQGR 66

Query: 50  IERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +++A EL E      + +SG        + ++++   ++ ++ +  + +  +  N+   A
Sbjct: 67  LDKAVELYEKGYFNYVIVSGGTGKEGFDEALVMKDYLVKNEIPDDKVILDQEGYNSMMTA 126

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           +      +  +   V +++  YH+ RT L  +++                  ++  F  +
Sbjct: 127 KNTKIIMDHMDLESVTVISQFYHITRTKLAFRKVGFE----------QVYSAHAEYFDFR 176

Query: 168 ILRVLLIE---YLKILL 181
            +  +  E   Y K L 
Sbjct: 177 DIYSIAREFAGYYKYLF 193


>gi|209809049|ref|YP_002264587.1| hypothetical protein VSAL_II0237 [Aliivibrio salmonicida LFI1238]
 gi|208010611|emb|CAQ80991.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 210

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 58/180 (32%), Gaps = 11/180 (6%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISG-------VHHSVSKDI 78
             +         AI VL    +R+ E A +L  +     +  SG          ++S+  
Sbjct: 15  YHLLNQPIKKSDAIFVLCSYDLRVAEHAAQLYLDGFAPLVIFSGAQGRATEGLFTLSEAE 74

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
               +     +    I +  KA NT  N        ++ N   + +L+V   Y   R   
Sbjct: 75  TFANVAKDMGVPSSAILLETKATNTGENIFFTQDLLKEKNITLNSLLLVQKPYMERRLLA 134

Query: 137 ELQRINSTVQF-IPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTASQ 195
              +  + ++F I  P I         +    +  ++L E  ++ +         QT   
Sbjct: 135 TFLKNWNDIEFCISSPNIRFVDYPTDEVTFDHVASIILGELHRLKIYPTLGYQEQQTIPD 194


>gi|308069364|ref|YP_003870969.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
 gi|305858643|gb|ADM70431.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
          Length = 228

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 59/196 (30%), Gaps = 33/196 (16%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIP----DHPSVSAIVVLTGEPI----------RIER 52
            +   +IF ++G +     V  M+          V   +VL               R+E 
Sbjct: 31  LVLCLMIFILVGLVWAGIRVWDMNTAASTTPLQQVQIGIVLGASMWGAEPSPGLKERLEE 90

Query: 53  AFELLENQIGEKIFISGVHHSVS----KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           A  L  N   +++ +SG          +   +Q+  + + +    I +   A +T  N  
Sbjct: 91  ALRLYRNGTVQRLIVSGGLDKPDFPYTEAEGMQRYLVDRGVPVQHIVLENHATSTYENLL 150

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQR--------INSTVQFIPYPI-------I 153
            +     +  +   +I+TH YH PR     Q           +  + +  PI        
Sbjct: 151 YSQRIMSEYGWISTVIITHSYHGPRAMEIAQFLKFDHPQMALTESKVLNMPIHQSREVLA 210

Query: 154 SHDLEENSSIFKIKIL 169
                        +  
Sbjct: 211 YAKWTLQRWWISAQTW 226


>gi|296446397|ref|ZP_06888341.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
 gi|296256032|gb|EFH03115.1| protein of unknown function DUF218 [Methylosinus trichosporium
           OB3b]
          Length = 265

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 52/204 (25%), Gaps = 32/204 (15%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------------RIE 51
            +         ++ +         D P    IVVL G                    R+ 
Sbjct: 51  IMAATPLGGALMAALENRFPAPPQDAPPPDGIVVLGGAMDEHITAARGRAAFNEAGERLL 110

Query: 52  RAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
              EL       ++  SG          ++            LA   +    ++ NT  N
Sbjct: 111 AFVELARRYPQARLVFSGGSASLTEARFTEADAAAVFFREAGLAPERVLYENRSRNTWEN 170

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           A      A   +    L+VT   HMPR     +++        +P+            + 
Sbjct: 171 AVYTRDLARPASSERWLLVTSAAHMPRAMGIFRQV--GFPATAFPVDYRTTGHIGWSLRP 228

Query: 167 KI--------LRVLLIEYLKILLL 182
                           E++ + + 
Sbjct: 229 DKHIADGLAFFDTAAHEWIGLAVY 252


>gi|319652939|ref|ZP_08007044.1| hypothetical protein HMPREF1013_03659 [Bacillus sp. 2_A_57_CT2]
 gi|317395288|gb|EFV76021.1| hypothetical protein HMPREF1013_03659 [Bacillus sp. 2_A_57_CT2]
          Length = 199

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 55/170 (32%), Gaps = 14/170 (8%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEP---IRIERAFELLENQIGEKIFISGVHHS----VSKDI 78
           +      +      I V         R+  A  L +     K+  SG        +++  
Sbjct: 20  LYYGIEDNLQKGDLIFVPGSSKAAEYRLPEAIRLYQKGRANKLLFSGGVRWSGHELTEAE 79

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN----NFHHVLIVTHDYHMPRT 134
           +L K  I   +    + I   +L+T+ N   +    ++     N  +++IVT  +HM R 
Sbjct: 80  MLMKKAIGFGIPPKDLFIENISLHTKENVLASMLVMDRMCGLENISNIIIVTAPFHMRRL 139

Query: 135 FLELQRINSTVQFIPYPIISHD--LEENSSIFKIKILRVLLIEYLKILLL 182
            + L             + S D    +   +      +    E  KI+  
Sbjct: 140 HMTLLTYMPKW-IHYSLVCSDDGATGKEQWMQDPYGRKRAFDEARKIIDY 188


>gi|116622945|ref|YP_825101.1| hypothetical protein Acid_3847 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226107|gb|ABJ84816.1| protein of unknown function DUF218 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 204

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 56/158 (35%), Gaps = 13/158 (8%)

Query: 34  HPSVSAIVVLTGEPI--RIERAFELLENQIGEKIFISGVHHSVSKDI---LLQKIPIRQD 88
                  VVL G+    R++ A EL++     +I +SG       +     +     +  
Sbjct: 43  PGKADVAVVLAGDYWGYRLQHAAELVKQGYVPRILVSGPPGFYGTNESDAAIHWALQQGY 102

Query: 89  LAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL------QRIN 142
             E  + + ++A +T   A+    +  ++N H  L+VT +YH  R               
Sbjct: 103 PPEWFVAVPHQATSTLAEAKVMLTYMRQHNIHSFLLVTSNYHTARARRIFLGAERDSGGG 162

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180
             ++ +  P         +     +  +   +E+ K +
Sbjct: 163 PEMRVVAAP--DKYFTPEAWWQSREGRKTAFMEWTKTV 198


>gi|256377332|ref|YP_003100992.1| hypothetical protein Amir_3239 [Actinosynnema mirum DSM 43827]
 gi|255921635|gb|ACU37146.1| protein of unknown function DUF218 [Actinosynnema mirum DSM 43827]
          Length = 336

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 72/222 (32%), Gaps = 36/222 (16%)

Query: 5   WYGLFVCLIFFIMGFISF------IRYVKQMHIPDHPSVSAIVVLTGE----------PI 48
           W       +  + G++ F      +  V    +      +AI+VL               
Sbjct: 123 WVLAAAGSLVLLAGYLGFAFTLFLLYSVLYGRVRKRTGHTAIIVLGAGVPGGRVTPLLAG 182

Query: 49  RIERAFELLE----NQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKAL 101
           R++RA +L            +  SG        S+  ++      + + +  +    ++ 
Sbjct: 183 RLDRALKLYRRAAAKGASPVVVASGGQGPDEPASEAEVMANYLRERGIPDEALLEEREST 242

Query: 102 NTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
           +T  N + +SA   +      +L+VT  YH+PR  +  +R                    
Sbjct: 243 STWENLRLSSALLAERGVTGRLLVVTSSYHVPRAAILSRRAGLKADV--------RGGRT 294

Query: 161 SSIFKIKILRVLLIEYLKILL-LSIQLSLSTQTASQFFITLI 201
           +  F        L E+  +L+      +L+  TA   F  L 
Sbjct: 295 AWYFVPNAF---LREFAALLVQYRTLNALAACTALSVFPLLA 333


>gi|229490318|ref|ZP_04384160.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
 gi|229322850|gb|EEN88629.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
          Length = 206

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/196 (14%), Positives = 60/196 (30%), Gaps = 21/196 (10%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R    G  +  +  + G    +  V +  I D     AIVVL               R+E
Sbjct: 6   RRLIAGAVLMAVVLVGGTAFRVWQVAR--IDDTRPADAIVVLGAAQYSGTPSSVFEARLE 63

Query: 52  RAFELLENQIGEKIFISGVHHSVSKDILL---QKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           +A++L +  +  +I   G      +       +     + +    I       +T  +  
Sbjct: 64  QAYKLYKRGVAPQIITVGGKQEGDEYTEAASGKMYLTDRGIPSSAITAVETGSDTLLSID 123

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
             SA       +  ++V+  +H  RT    +          +   +   +  +   +   
Sbjct: 124 AVSAEMSSQGINSAVLVSDPWHSLRTRTMAR----DTGLQAW--TAPTRQGPAVFTRESQ 177

Query: 169 LRVLLIEYLKILLLSI 184
           L  +  E   +L   +
Sbjct: 178 LHGIARETGALLWYQL 193


>gi|307687370|ref|ZP_07629816.1| hypothetical protein Ccel74_04393 [Clostridium cellulovorans 743B]
          Length = 254

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 56/165 (33%), Gaps = 22/165 (13%)

Query: 7   GLFVCLIFFIMGFISFIRY----VKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
            L +   F I+GF  F+       K     D+     +VVL              +R++ 
Sbjct: 68  FLIIFTSFLIIGFSFFLVTEAFIYKTGSEKDNTPTDYVVVLGAGLIGDRISTSLQLRLDA 127

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A E         I +SG       +S+   ++   I + +    I +  K+ +T  N   
Sbjct: 128 ALEFHSIHPEIPIIVSGGQGPDELLSEARAMKDYLIEKGIDPNLITMEDKSTSTYENFMF 187

Query: 110 ASAWAEKNNFHHVL---IVTHDYHMPRTFLELQRINSTVQFIPYP 151
           +            +   ++T+++H  R  +  +      +   YP
Sbjct: 188 SKELISNKCSKTPIKVTVITNNFHQFRANMIAKAQ--GFEVHGYP 230


>gi|295695151|ref|YP_003588389.1| protein of unknown function DUF218 [Bacillus tusciae DSM 2912]
 gi|295410753|gb|ADG05245.1| protein of unknown function DUF218 [Bacillus tusciae DSM 2912]
          Length = 188

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/191 (13%), Positives = 66/191 (34%), Gaps = 17/191 (8%)

Query: 10  VCLIFFIMGFISF-IRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLE 58
           +        FI F +    +  +        +++L  + +          R+E   +L  
Sbjct: 1   MWAALAAAVFIGFPLGLNMRGVLYPPRPADVLLILGAKIMGREPGAALRARLEAGLDLYR 60

Query: 59  NQIGEKIFISGVHHSV---SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAE 115
                +I +SG        S+  ++      + +    + +   + +T  N   +S   +
Sbjct: 61  RGYAPRILVSGGQRRPGAPSEADVMADYLRVRGVPPRALIVEDLSSDTVENLLFSSRLMK 120

Query: 116 KNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIE 175
            + +   ++VT  YH+PR     +   + +    Y   S D+   + ++ ++ +      
Sbjct: 121 IHGWRRAVVVTSAYHLPRALWLAR--LAGLDASGYAPASADV-LGTWMYALREIPAFWRS 177

Query: 176 YLKILLLSIQL 186
           Y K   L  + 
Sbjct: 178 YQKWKWLQGRE 188


>gi|229529274|ref|ZP_04418664.1| hypothetical protein VCG_002367 [Vibrio cholerae 12129(1)]
 gi|229333048|gb|EEN98534.1| hypothetical protein VCG_002367 [Vibrio cholerae 12129(1)]
          Length = 215

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 43/151 (28%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +   ++  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQVRPAKRILLVQKPYMERRAYATFKQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|148927289|ref|ZP_01810857.1| protein of unknown function DUF218 [candidate division TM7
           genomosp. GTL1]
 gi|147887295|gb|EDK72751.1| protein of unknown function DUF218 [candidate division TM7
           genomosp. GTL1]
          Length = 223

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 41/150 (27%), Gaps = 11/150 (7%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHH-------SVSKDI 78
                        +  L     R+   + EL     G  + ISG            ++  
Sbjct: 21  YHHLHQTPVKCDVVFTLGSSDRRVAVYSAELFLKGYGNYLVISGGFGRISKDRFHKTEAE 80

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFL 136
           L   I I   +    + +  KA NT  N +       +       +L+V   Y   RT  
Sbjct: 81  LFADIAIGMGVPPEKVVLETKASNTGENIRFTYNLLMQRGLRPKSLLLVHKPYMERRTLA 140

Query: 137 ELQRINSTVQFIPYPIISHDLEENSSIFKI 166
             ++         + + S D+         
Sbjct: 141 TFKKQWQDSNVEIF-VTSPDIAYEDYFTDE 169


>gi|302876695|ref|YP_003845328.1| hypothetical protein Clocel_3898 [Clostridium cellulovorans 743B]
 gi|302579552|gb|ADL53564.1| protein of unknown function DUF218 [Clostridium cellulovorans 743B]
          Length = 257

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 56/165 (33%), Gaps = 22/165 (13%)

Query: 7   GLFVCLIFFIMGFISFIRY----VKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
            L +   F I+GF  F+       K     D+     +VVL              +R++ 
Sbjct: 68  FLIIFTSFLIIGFSFFLVTEAFIYKTGSEKDNTPTDYVVVLGAGLIGDRISTSLQLRLDA 127

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A E         I +SG       +S+   ++   I + +    I +  K+ +T  N   
Sbjct: 128 ALEFHSIHPEIPIIVSGGQGPDELLSEARAMKDYLIEKGIDPNLITMEDKSTSTYENFMF 187

Query: 110 ASAWAEKNNFHHVL---IVTHDYHMPRTFLELQRINSTVQFIPYP 151
           +            +   ++T+++H  R  +  +      +   YP
Sbjct: 188 SKELISNKCSKTPIKVTVITNNFHQFRANMIAKAQ--GFEVHGYP 230


>gi|228914293|ref|ZP_04077908.1| hypothetical protein bthur0012_15250 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228926749|ref|ZP_04089817.1| hypothetical protein bthur0010_14650 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|229121266|ref|ZP_04250497.1| hypothetical protein bcere0016_15720 [Bacillus cereus 95/8201]
 gi|228662111|gb|EEL17720.1| hypothetical protein bcere0016_15720 [Bacillus cereus 95/8201]
 gi|228832862|gb|EEM78431.1| hypothetical protein bthur0010_14650 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228845287|gb|EEM90323.1| hypothetical protein bthur0012_15250 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 159

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 65/165 (39%), Gaps = 25/165 (15%)

Query: 37  VSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKI 83
              I+VL  +            RI++A E L++       +SG       +S+ + ++  
Sbjct: 7   ADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIVSGGKGKGEDISEALAMKNE 66

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
            ++ ++AE  I +  K+ +T+ N + +      +N    +IVT+D+HM R      +   
Sbjct: 67  LMKLNIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMIVTNDFHMFRAKKIAAKQGL 125

Query: 144 TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
            ++ +P       +  ++           + EYL I        +
Sbjct: 126 QLEGLPAATPKRIVIPSN-----------IREYLAITQYWFMDRI 159


>gi|313622511|gb|EFR92931.1| conserved hypothetical protein [Listeria innocua FSL J1-023]
          Length = 189

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 71/199 (35%), Gaps = 27/199 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV----------SAIVVLTGEPIRIE 51
           + F+  L V    +++   +F+    +    ++ +                      R++
Sbjct: 5   KKFFVILIVIGFIYVLIVAAFMFSGTRAKPDENVNTVLILGAKINGDPASPSLVLQERLD 64

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A   L      K+ +SG      + ++  ++++  + + +A+  I+   K+  TE N +
Sbjct: 65  AAVAYLNEYPKTKVIVSGGQGADETTTEAAVMEEYLVNEGIAKNRIEKETKSKRTEENIK 124

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            ++    K +    +IVT DYHM R  +  +R    +     P  S              
Sbjct: 125 YSNE---KFDLGKTVIVTSDYHMYRALMLAKRQ--GIDATGLPAKS---------RTPAK 170

Query: 169 LRVLLIEYLKILLLSIQLS 187
            + ++ E L I    +   
Sbjct: 171 YKGMMREVLSITYAWVFDR 189


>gi|290893680|ref|ZP_06556661.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|290556753|gb|EFD90286.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
          Length = 189

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 33/202 (16%), Positives = 72/202 (35%), Gaps = 31/202 (15%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------------PI 48
           ++     L      +++   +F+    +    D  +   +++L  +              
Sbjct: 4   LKRISIILIAIGFIYLLIVAAFMFSGTRAKPSD--NADTVLILGAKVNGDPAEPAEVLKE 61

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++ A   L      ++ +SG      S S+  ++++  + + +    I I  K+  TE 
Sbjct: 62  RLDAAVTYLNENPTMQVVVSGGQGEDESASEASVMEEYLVNKGITRSRIKIENKSRRTEE 121

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + +     K N    +IVT DYHM R  +  +R    +     P  S           
Sbjct: 122 NIKYSKE---KFNLGKTVIVTSDYHMYRALMLAKRQ--GLDASGLPAKS---------RS 167

Query: 166 IKILRVLLIEYLKILLLSIQLS 187
           +  ++ ++ E L I    +   
Sbjct: 168 VIKIKNMMRETLSITYAWVFDR 189


>gi|83593886|ref|YP_427638.1| hypothetical protein Rru_A2551 [Rhodospirillum rubrum ATCC 11170]
 gi|83576800|gb|ABC23351.1| Protein of unknown function DUF218 [Rhodospirillum rubrum ATCC
           11170]
          Length = 206

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 63/194 (32%), Gaps = 20/194 (10%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------------RIERAFELLENQIGEKI 65
                    +   P   +     V+                  R+     L       ++
Sbjct: 8   LCHVAEETDRAFPPAGRAGEGCAVVVLGARVLGDGRPSPALERRVLHGVALARRHPAARL 67

Query: 66  FISGVHH--SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
            +SG      + +  ++  + +   +A   + +  +AL+T GNA+ +           VL
Sbjct: 68  LLSGGATGGPLDEAWVMATLALGAGIAAERLILEDRALDTLGNARHSLPLLRAARIGRVL 127

Query: 124 IVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLL 182
           +VT   HMPR  L  + +    ++    P               + +  +L E   + L+
Sbjct: 128 LVTDPSHMPRALLSFRAVAGDHLRLRAAPTPC----PAGGWRNRRAIFGVLREMAALGLV 183

Query: 183 SIQLSLSTQTASQF 196
             +L ++ + A+  
Sbjct: 184 LPRLLIARRRAASP 197


>gi|189350313|ref|YP_001945941.1| hypothetical protein BMULJ_01475 [Burkholderia multivorans ATCC
           17616]
 gi|189334335|dbj|BAG43405.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 238

 Score = 67.5 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 63/203 (31%), Gaps = 32/203 (15%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLT----------- 44
           R               G++           V+ +  PD    + ++VL            
Sbjct: 22  RRIALAAVALFWLIASGWLAAPFIAWAEAGVEPVEHPDMHGQTVLIVLGAGTQRADDGLR 81

Query: 45  ---GEPIRIERAFELLENQIG----EKIFISGVHHSVS---KDILLQKIPIRQDLAECCI 94
                  RI +A EL  +         + +SG         +  +  +  +   +    +
Sbjct: 82  PPRDGAARIRKAAELYRSCRRQAERCTVVMSGGDPQHHGDTEAAVYGRGLVAAGVDPGDL 141

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +  K+  T  NAQ  ++          +++T  Y M R  L+ +R        P P+ +
Sbjct: 142 VLEPKSRTTYENAQFTTSILRSRRDDARILITSSYQMRRALLDFRRFG----IDPQPVFA 197

Query: 155 HDLEENSSIFKIKILRVLLIEYL 177
           +  E  +     +   V+  E+ 
Sbjct: 198 NRREAQTGWL-PRWSNVVATEFA 219


>gi|297194511|ref|ZP_06911909.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297152286|gb|EFH31635.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 219

 Score = 67.5 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/176 (11%), Positives = 54/176 (30%), Gaps = 21/176 (11%)

Query: 2   RYFWYGLFVCLIFFIMG--FISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIR 49
           R     + +  +  +    ++  +   +   + + P+    VV                R
Sbjct: 10  RLVAQAVMLGCVLGLAPTTWMHAVADSRVRTVAEAPARDVAVVFGAGLWKGRPSPYLAHR 69

Query: 50  IERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           ++ A EL      + + ++G +  V  D    ++     + + +  I   Y   +T  + 
Sbjct: 70  LDTAAELYRTGKVKVVLVTGDNSRVEYDEPDAMRTYLTGRGVPDDRIVSDYAGFDTWDSC 129

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
             A            L+V+  +H+ R     +          Y +   +  + +  
Sbjct: 130 VRAKEIF---GVERALLVSQGFHIRRAVALCRSAG----VEAYGVGVAEPHDATWY 178


>gi|167746537|ref|ZP_02418664.1| hypothetical protein ANACAC_01247 [Anaerostipes caccae DSM 14662]
 gi|317471356|ref|ZP_07930711.1| DUF218 domain-containing protein [Anaerostipes sp. 3_2_56FAA]
 gi|167653497|gb|EDR97626.1| hypothetical protein ANACAC_01247 [Anaerostipes caccae DSM 14662]
 gi|316901162|gb|EFV23121.1| DUF218 domain-containing protein [Anaerostipes sp. 3_2_56FAA]
          Length = 228

 Score = 67.5 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 60/169 (35%), Gaps = 27/169 (15%)

Query: 2   RYFWYGLFVCL--IFFIMGFISF--------IRYVKQMHIPDH-PSVSAIVVLTGE---- 46
           R+    L +    I    G   F        I   +Q+ +        A+VVL  +    
Sbjct: 10  RWLKLLLILIFAGILTAGGINWFMIHQSKKDIETARQLALEQKGKKADAVVVLGAKVRKD 69

Query: 47  -------PIRIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIG 97
                    R++   +  +  + ++I +SG H +   D +  ++   I+Q +    I   
Sbjct: 70  GSMCLMLKERVDLGIQAYKQGLADRIIMSGDHGAEGYDEVSTMKAYAIKQGIPSEHIFKD 129

Query: 98  YKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
           +   +T      A    +      +++VT  YH+ R   + + +   V+
Sbjct: 130 HAGFSTYETMYRARDVFKA---KSIVVVTQKYHLYRAVYDAKALGLEVK 175


>gi|218437925|ref|YP_002376254.1| hypothetical protein PCC7424_0930 [Cyanothece sp. PCC 7424]
 gi|218170653|gb|ACK69386.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7424]
          Length = 230

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 50/138 (36%), Gaps = 6/138 (4%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61
           R     L   +  F++  I       ++ +       AI+VL G   R   A  L +   
Sbjct: 19  RAVKLALLAGVGLFVLNLIF--NIGIKLPLNTSKPADAILVLGGSIQREIDAARLGKYYP 76

Query: 62  GEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121
              I IS         ++ QK  ++ D     I +   A +T GN   +    +    H 
Sbjct: 77  DIPIIISSGSEEPCMLLIFQKFQLKLD----RIWLEKCADSTFGNFFYSVPILQGWGVHK 132

Query: 122 VLIVTHDYHMPRTFLELQ 139
           V+++T   H+PR     Q
Sbjct: 133 VIVITSPSHLPRAKWLAQ 150


>gi|238027594|ref|YP_002911825.1| hypothetical protein bglu_1g20120 [Burkholderia glumae BGR1]
 gi|237876788|gb|ACR29121.1| Hypothetical protein bglu_1g20120 [Burkholderia glumae BGR1]
          Length = 238

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 60/212 (28%), Gaps = 30/212 (14%)

Query: 4   FWYGLFVCLIFFIMGFISFIRY-VKQMHIPDHPSVSAIVVLTGEPIR------------- 49
                 +   +     ++     V     P     +AI+VL     R             
Sbjct: 29  LALLAGIATGWLTAPLVALAESGVAPAEPPVFAGRTAIIVLGAGIKRHDGLLVPPENGLA 88

Query: 50  -IERAFELL----ENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCIDIGYKAL 101
            I RA EL      +     + ++G         +  L   + + + +    + +  ++ 
Sbjct: 89  RIARAAELHSACQRSGARCTVIVTGGDPHRHGTTEADLYAPLLLERGVPPRDLTLERRSR 148

Query: 102 NTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI-ISHDLEEN 160
            T  NAQ  +      ++   ++VT  Y M R  L+  R        P P+  + D    
Sbjct: 149 TTYENAQYTAPILLAKHYDETILVTSSYQMRRALLDFARFG----VTPQPVFANRDRAIC 204

Query: 161 SS---IFKIKILRVLLIEYLKILLLSIQLSLS 189
                          L E   I+       L 
Sbjct: 205 GWRPRWTNFVTASRALHEIAGIIQFYAYRRLG 236


>gi|325676983|ref|ZP_08156654.1| hypothetical protein HMPREF0724_14437 [Rhodococcus equi ATCC 33707]
 gi|325552145|gb|EGD21836.1| hypothetical protein HMPREF0724_14437 [Rhodococcus equi ATCC 33707]
          Length = 231

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 60/195 (30%), Gaps = 21/195 (10%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
               G  +  +  + G    +  V ++   D     AIVVL               R+++
Sbjct: 32  RIVLGALLIGVVLVGGTALRVWQVARVT--DTTPADAIVVLGAAQYDGTPSSVFEARLDQ 89

Query: 53  AFELLENQIGEKIFISGVHHSVSKDILL---QKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L E  +   I   G      +       +   + Q +    I    +  +T  + + 
Sbjct: 90  AHKLYEQGVAATIVTVGGKQEGDEYTEAASGRNYLMDQGVPGGAIVAVEEGSDTLLSVEA 149

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
            S        H  ++V+  +H  RT    +              +   +  + + +   L
Sbjct: 150 VSREMGARGLHSAVLVSDPWHSLRTRTMARDAGLD------AWTAPTRQGPAVMTRESQL 203

Query: 170 RVLLIEYLKILLLSI 184
             ++ E   +L   +
Sbjct: 204 HGIVRETGALLWYQL 218


>gi|311747747|ref|ZP_07721532.1| membrane protein [Algoriphagus sp. PR1]
 gi|126575735|gb|EAZ80045.1| membrane protein [Algoriphagus sp. PR1]
          Length = 256

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 71/214 (33%), Gaps = 34/214 (15%)

Query: 5   WYGLFVCLIFFIMGFIS----FIRYVKQMHIPDHPSVSAIVVLTG--------------- 45
            +   + L FF   FIS               +  +    +VLTG               
Sbjct: 39  LWAGIILLWFFSNQFISNQAMLAWEPDFKEFSEIKNHEIGIVLTGVTNLSKTAYDRTFFN 98

Query: 46  -EPIRIERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYK 99
               RI  A +L      +KI I+G       +  S+  LLQ+  I   +    + I  K
Sbjct: 99  KGADRITHALQLYRMGKIKKILITGGQGLNPVNPQSEAELLQRFLIMTGVPPEDVMIEDK 158

Query: 100 ALNTEGNAQEASAWAEKNNF---HHVLIVTHDYHMPRTFLELQRINSTVQFIP---YPII 153
           A NT  NAQ    + E+         L++T  +HM R+     ++    +  P   Y   
Sbjct: 159 AKNTAQNAQFTKTFLEEKGINIDQEFLLITSAFHMYRSKGCFDKVGLKTETFPTDYYSYD 218

Query: 154 SHDLEENSSIFKIKILR---VLLIEYLKILLLSI 184
           +              +     L+ E++ I +  +
Sbjct: 219 TKYDFPTFMYPSPSSIENWHKLVKEWIGITVYKL 252


>gi|152994702|ref|YP_001339537.1| hypothetical protein Mmwyl1_0668 [Marinomonas sp. MWYL1]
 gi|150835626|gb|ABR69602.1| protein of unknown function DUF218 [Marinomonas sp. MWYL1]
          Length = 255

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 58/181 (32%), Gaps = 27/181 (14%)

Query: 28  QMHIPDHPSVSAIVVLTGEP-----------------IRIERAFELLENQIGEKIFISG- 69
                    V A++VL                      R+E    +L+     ++F+SG 
Sbjct: 80  YPVFDVQQPVDAVIVLGSGHKDLSNTPTVMALGNSALFRLEEGLRILKANPNAQLFVSGY 139

Query: 70  -VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHD 128
               +     ++++  I   +    I     A +TE  A     + E     +  +VT  
Sbjct: 140 SGQMTEPHAEVMRRAAIELGVQPDRIKAFPLAKDTEEEANSMKPYLE---GKNAALVTEA 196

Query: 129 YHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL---RVLLIEYLKILLLSIQ 185
            H+ R  +  ++    ++ IP P +    E++            +    E+L      I+
Sbjct: 197 SHLKRASIFFEQA--GIKIIPAPAMYLGSEKSDWQIDATAAYKSQRAFYEWLGRTWQWIK 254

Query: 186 L 186
            
Sbjct: 255 G 255


>gi|229096200|ref|ZP_04227173.1| hypothetical protein bcere0020_14480 [Bacillus cereus Rock3-29]
 gi|229102312|ref|ZP_04233021.1| hypothetical protein bcere0019_14730 [Bacillus cereus Rock3-28]
 gi|229115155|ref|ZP_04244565.1| hypothetical protein bcere0017_14500 [Bacillus cereus Rock1-3]
 gi|228668295|gb|EEL23727.1| hypothetical protein bcere0017_14500 [Bacillus cereus Rock1-3]
 gi|228681213|gb|EEL35381.1| hypothetical protein bcere0019_14730 [Bacillus cereus Rock3-28]
 gi|228687160|gb|EEL41065.1| hypothetical protein bcere0020_14480 [Bacillus cereus Rock3-29]
          Length = 159

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 65/170 (38%), Gaps = 25/170 (14%)

Query: 32  PDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDI 78
                   I+VL  +            RI++A E L++       +SG       +S+ +
Sbjct: 2   KATDDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKTIAIVSGGQGKGEDISEAL 61

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
            +++  ++Q++AE  I +  K+ +T+ N   +       N    +IVT+D+HM R     
Sbjct: 62  AMKQGLMKQNIAEDRIIMEDKSTSTDENITFSKPLI-PANMKKGMIVTNDFHMFRAKKIA 120

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
            +    ++ +P       +  ++           + EYL I        +
Sbjct: 121 AKQGLQLEGLPAKTPKPIIIPSN-----------VREYLAITQYWFMNRI 159


>gi|269213925|ref|ZP_05983151.2| putative periplasmic protein [Neisseria cinerea ATCC 14685]
 gi|269145137|gb|EEZ71555.1| putative periplasmic protein [Neisseria cinerea ATCC 14685]
          Length = 181

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 56/174 (32%), Gaps = 20/174 (11%)

Query: 24  RYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLENQIGEKIFISGVHH- 72
             + +  +P      A +VL               RI  A  L +     KI  +G    
Sbjct: 2   YRLNEGVLPAGTRADAALVLGAAAWDKRPSPVFRERINHAIALYQGHRVGKIIFTGGRSK 61

Query: 73  --SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYH 130
              +++  + ++  ++Q +    I     + NT  N        + N    V+IV+  YH
Sbjct: 62  KGYMTEAEVGRRYALKQGVPAHNILFENTSRNTYENLNNIRPILQANGISSVVIVSDPYH 121

Query: 131 MPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           + R     + +   V+       +   +  S          +L E   + L  +
Sbjct: 122 LARAAEMAEDL--GVRVYVSATPTTRFDTASGKKNF-----ILHEGYALTLYRL 168


>gi|123966515|ref|YP_001011596.1| hypothetical protein P9515_12821 [Prochlorococcus marinus str. MIT
           9515]
 gi|123200881|gb|ABM72489.1| Hypothetical protein P9515_12821 [Prochlorococcus marinus str. MIT
           9515]
          Length = 236

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/221 (15%), Positives = 73/221 (33%), Gaps = 41/221 (18%)

Query: 1   MRYFWYGLFVCLIFFIMGF---ISFIRYVK--QMHIPDHPSVSAIVVLTGEPI------- 48
           +R+ +  L + L+F    F   +  +      ++      S   IVVL+G          
Sbjct: 14  LRFIYSALIILLVFSNGVFSECLWRLLEYPWKRLEFSSINSADGIVVLSGGRHLPLGNTK 73

Query: 49  --------RIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCID 95
                   R     EL +     K+  +G       +   +  +  K  I   + +  + 
Sbjct: 74  IIEWHDPDRFLAGIELYKANKSNKLIFTGGVSLLTSNLPPEGTIYIKEAISMGIPKKDVL 133

Query: 96  IGYKALNTEGNAQEASAWA---EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
             Y   NT   A+   A     +  +   +++VT  +HM R     +R    +  +PYP+
Sbjct: 134 TTYPVYNTLEEAEAVKALLYREKPLSKKKIILVTSAFHMKRAKKVFER--EGMNVLPYPV 191

Query: 153 I-----------SHDLEENSSIFKIKILRVLLIEYLKILLL 182
                       ++  +   S   +    + + E +  ++ 
Sbjct: 192 DFKSSRNFISSLTNIFKWIPSSSNLYKSSMAVREIIGRMIY 232


>gi|111022413|ref|YP_705385.1| hypothetical protein RHA1_ro05447 [Rhodococcus jostii RHA1]
 gi|110821943|gb|ABG97227.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 187

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 53/163 (32%), Gaps = 6/163 (3%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH-PSVSAIVVLT-GEPIRIERAFELLENQ 60
            F     + ++      +   R +      D    V AIVVL      R+  A  L E  
Sbjct: 7   RFLLAAALAVMTTATALLWGGRIIYSNAPEDPLRPVDAIVVLGGENDGRVPYAVSLAEQG 66

Query: 61  IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           +  ++ IS  H +                   C+        T G AQ     A +N + 
Sbjct: 67  LARQVVISNPHDARDPSTNEGCATTDPRFTVTCVA--PHPATTRGEAQFTRTLAVQNGWT 124

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-SHDLEENSS 162
            VL+V+  YH+PR     QR         + +  S+D      
Sbjct: 125 SVLVVSWRYHLPRARYIFQRCFDG-DLTMHAVPRSYDFSLAKW 166


>gi|325923915|ref|ZP_08185510.1| hypothetical protein XGA_4563 [Xanthomonas gardneri ATCC 19865]
 gi|325545597|gb|EGD16856.1| hypothetical protein XGA_4563 [Xanthomonas gardneri ATCC 19865]
          Length = 253

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 54/154 (35%), Gaps = 15/154 (9%)

Query: 47  PIRIERAFELLENQIGEKIFI----SGVHHS---VSKDILLQKIPIRQDLAECCIDIGYK 99
             RI  +  L               SG       +S+ ++ +K+ I   + +  + +   
Sbjct: 93  YGRIVESARLYRQCRAHGGDCKIEISGGDARGLGLSEAVVYRKVLIGIGIDQADLIMEPS 152

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
           ++NT  NAQ +     K     V++V+   H+ R  L  +           P+ S  L  
Sbjct: 153 SMNTWQNAQFSQPLLRKYRADRVVLVSSATHLRRAELYFRHFG----IEATPVRSDWLTA 208

Query: 160 NSSI----FKIKILRVLLIEYLKILLLSIQLSLS 189
           + +     +   +  V L EYL I    +   L 
Sbjct: 209 SWAWLPQSYNFTVADVALHEYLGIARYRVYEWLG 242


>gi|299531045|ref|ZP_07044458.1| hypothetical protein CTS44_09677 [Comamonas testosteroni S44]
 gi|298721002|gb|EFI61946.1| hypothetical protein CTS44_09677 [Comamonas testosteroni S44]
          Length = 268

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 69/201 (34%), Gaps = 29/201 (14%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYV--KQMHIPDHPSVSAIVVLTGE----------PIRI 50
             W   +V L  +++    F   +    +     P V +IVVL               R+
Sbjct: 74  RLWSLGWVVLALWLISLFWFWSRLSGLGLAPQQVPPVQSIVVLGSGTLDGHPRPVLAARL 133

Query: 51  ERAFELLENQIGEKIFISGVHHS---VSKDILLQKIPIR-QDLAECCIDIGYKALNTEGN 106
           E+A +L + Q    + + G        S+  ++ +   +   +A   + +   + +TE N
Sbjct: 134 EQAAQLAKLQPQAFVAVCGGVDWGEKESEAEVMARYLQQHHGIAAQRLVLEKLSTSTELN 193

Query: 107 AQEASAWAEKNN---FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
            + +     +        + +V+ D+H+ R     +R +   Q  P    +      ++ 
Sbjct: 194 LKLSRPLLAERGVAADAPMAMVSSDFHLMRAMDIAKRQDL-PQVYPVAAPTPLATRFNAW 252

Query: 164 FKIKILRVLLIEYLKILLLSI 184
                    L EY  +    +
Sbjct: 253 ---------LREYFAMASSWL 264


>gi|315652448|ref|ZP_07905435.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315485286|gb|EFU75681.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 365

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 73/193 (37%), Gaps = 25/193 (12%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
                  + F+M        +  +HI  +  +  I+VL               RI++  E
Sbjct: 149 LSFIFIYLLFLMAMYCISAILNLIHIGRNKKLDYIIVLGAGIKGKRVTPLLAGRIDKGIE 208

Query: 56  LLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASA 112
           LL+     K+ +SG       + + + +     ++ +++  I I  K+ NT+ N   +  
Sbjct: 209 LLKYNPNAKLILSGGMGPGEDIPEGVAMADYAKQKGVSDEKIIIEDKSKNTKENLLFSYK 268

Query: 113 WAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
             +  N    ++ T  YH+ R  +  +++   +  I Y   +         F +     L
Sbjct: 269 LIDNKNSKIAIVTTS-YHVFRALVFAKKL--NIPCIGYGSKTK------WYFTLNA---L 316

Query: 173 LIEYLKILLLSIQ 185
           + EY+  L +S +
Sbjct: 317 IREYIGYLSISYR 329


>gi|300117365|ref|ZP_07055155.1| hypothetical protein BCSJ1_00510 [Bacillus cereus SJ1]
 gi|298725200|gb|EFI65852.1| hypothetical protein BCSJ1_00510 [Bacillus cereus SJ1]
          Length = 192

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 70/184 (38%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K   +        I+VL  +            RI++A E L++       +
Sbjct: 22  GFLQY-NIYKHGKMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKAIAIV 80

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +      +N    +I
Sbjct: 81  SGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMI 139

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +        +  ++           + EYL I     
Sbjct: 140 VTNDFHMFRAKKIAAKQGLQLEGLSAATPKRIVIPSN-----------IREYLAITQYWF 188

Query: 185 QLSL 188
              +
Sbjct: 189 MDRI 192


>gi|282861775|ref|ZP_06270839.1| protein of unknown function DUF218 [Streptomyces sp. ACTE]
 gi|282563591|gb|EFB69129.1| protein of unknown function DUF218 [Streptomyces sp. ACTE]
          Length = 245

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 49/174 (28%), Gaps = 21/174 (12%)

Query: 12  LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQI 61
                  ++      +     D P+    VV                R++ A EL  +  
Sbjct: 42  AALLPATWLHTTADARVRGTADAPARQVAVVFGAGLWQGRPSPYLAHRLDAAAELYRSGK 101

Query: 62  GEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF 119
            + + ++G +  V  D    ++       + +  I   Y   +T  +   A         
Sbjct: 102 VKVLLVTGDNSRVEYDEPDAMRTYLTAHGVPDGRIVSDYAGFDTWDSCVRAKKIF---GV 158

Query: 120 HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
              ++V+  +H+ R     +          Y +    + + +        R + 
Sbjct: 159 DRAVLVSQGFHIRRAVALCRSAG----IDAYGVGVDAVHDATWY--YGGAREVF 206


>gi|237711018|ref|ZP_04541499.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|265750614|ref|ZP_06086677.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229454862|gb|EEO60583.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263237510|gb|EEZ22960.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 252

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/155 (12%), Positives = 41/155 (26%), Gaps = 14/155 (9%)

Query: 47  PIRIERAFELLENQIGEKIFIS---------GVHHSVSKDILLQKIPIRQDLAECCIDIG 97
             R+     L ++    K+ ++                    +++      +    + + 
Sbjct: 95  ADRLLEGIRLYKHGRIRKLVLASDGSIIESKDGKGLQGNAADMKQYLADLGMPLEDVILE 154

Query: 98  YKALNTEGNAQEASAWAEK-NNFHHVLIVTHDYHMPRTFLELQRIN--STVQFI-PYP-I 152
            +A NT  NA                L++T   HM R+                  +P I
Sbjct: 155 TRANNTWENATFTLELIGNSMKTESTLLITSATHMRRSLWTFHAAGLNPDTYITDTFPEI 214

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
                    S   +     L  E++  L   ++  
Sbjct: 215 KGEKTNFLPSWHVLASWPELTHEWVGYLYYRLRHK 249


>gi|37525579|ref|NP_928923.1| hypothetical protein plu1635 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785007|emb|CAE13928.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 279

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/202 (16%), Positives = 56/202 (27%), Gaps = 32/202 (15%)

Query: 22  FIRYVKQMHIPDHPSVSAIVVLTGEP-----------------IRIERAFELLENQIGEK 64
           +    +      +P V  IVVL G                    R+     L     G K
Sbjct: 70  YANSDQSDTSHINPPVDYIVVLGGGFTYNPNWAPSSNLLNNSLPRVTEGIRLYRLNPGSK 129

Query: 65  IFISGVHHSVSK--DILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           +  +G   +  K    +   +     +         K ++TE  A E         F   
Sbjct: 130 MVFTGGKGANVKSSAEVAAIVAQSLGVPAEDTIALTKPMDTEQEANEVEKLIGNQPF--- 186

Query: 123 LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE--NSSIFKIKILRVL------LI 174
           ++VT   HM R     Q+    +  IP P     +    +     +     L        
Sbjct: 187 ILVTSANHMQRAITFFQQH--GLNPIPGPANQLAITSPLHPWEKYLPSAYYLSHSDRVWY 244

Query: 175 EYLKILLLSIQLSLSTQTASQF 196
           E L  L   I+ S   +   + 
Sbjct: 245 ETLGTLWQRIKPSKDPEQPQKS 266


>gi|319936939|ref|ZP_08011349.1| exported protein [Coprobacillus sp. 29_1]
 gi|319807875|gb|EFW04454.1| exported protein [Coprobacillus sp. 29_1]
          Length = 219

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 51/153 (33%), Gaps = 17/153 (11%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLENQIGEKIFISG 69
           +      K+           I+VL               R+E A +L ++    KI +SG
Sbjct: 27  VYVYATTKKQVNASLEDADCILVLGAGVRNNKPTPMLNDRLEVAIQLYKDGKASKIIMSG 86

Query: 70  --VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTH 127
                  ++  +++   I   +    I + +   +T  +   A    +      V+IVT 
Sbjct: 87  DHGQEDYNEVGIMKTFAIENGVPSSAIFMDHAGFSTYESLYRAKEIFKA---KKVIIVTQ 143

Query: 128 DYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
           DYH+ R      ++   ++ +  P         
Sbjct: 144 DYHLYRALYIGNQL--GIEAVGVPANPRSYSGQ 174


>gi|304436974|ref|ZP_07396937.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369925|gb|EFM23587.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 252

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/166 (15%), Positives = 59/166 (35%), Gaps = 29/166 (17%)

Query: 27  KQMHIPDHPSVSAIVVLTGEP------------------IRIERAFELLENQIGEKIFIS 68
           +   +P+ P    I++L G                     R+   + L        +   
Sbjct: 67  RTYPVPEAPQGDVIIMLGGGAIADVQDVDGTGMLAQSPSSRLLAVYRLHLRTHLPILLSG 126

Query: 69  GV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
           G     + S+  + +++     + +  I +  ++L T  NA+  +    +  F H ++VT
Sbjct: 127 GQVFSDTGSEAEIARRVLRSLGVPDDMIYVETRSLTTGQNARYTAEILRREGFVHPILVT 186

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVL 172
             +H+PR  L  ++    +   PYP        +  +     L ++
Sbjct: 187 SAFHLPRAVLNFEKQ--GITVTPYPT-------DFWVSGDPQLYLI 223


>gi|289207946|ref|YP_003460012.1| hypothetical protein TK90_0761 [Thioalkalivibrio sp. K90mix]
 gi|288943577|gb|ADC71276.1| protein of unknown function DUF218 [Thioalkalivibrio sp. K90mix]
          Length = 262

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/202 (16%), Positives = 57/202 (28%), Gaps = 33/202 (16%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPI------------------RIERAFELLENQIGEK 64
           +    +  +       AIV+L G                     R+     L        
Sbjct: 64  LEREVRDSVLATGRADAIVILGGGRWVGRAEDAGHDALNPRTHERVRAGARLHRATDLPI 123

Query: 65  IFISGVHHSVS----KDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120
           +   G   ++     +  L+     +QDL      +   + NT  NA       +     
Sbjct: 124 VVSGGTPRALPGRRSEAELMAATL-QQDLGVSARWLENTSRNTCENATHTRQRLQGQGVE 182

Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYP-----IISHDLEENSSIFKIKIL---RVL 172
            VL+VT   H+PR     +R        P P                +   + +   R  
Sbjct: 183 AVLVVTQAMHLPRALECFERA--GFDAYPAPAGFRGTTGEPRGLQDFLPTAEAIETSRFA 240

Query: 173 LIEYLKILLLSIQLSLSTQTAS 194
           L E+L  + L ++  L   T  
Sbjct: 241 LREWLARVALPLRERLRGSTGD 262


>gi|16801598|ref|NP_471866.1| hypothetical protein lin2536 [Listeria innocua Clip11262]
 gi|16415058|emb|CAC97763.1| lin2536 [Listeria innocua Clip11262]
          Length = 189

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 73/202 (36%), Gaps = 29/202 (14%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE------------PI 48
           +R+  + + + +I FI   I               +V+ +++L  +              
Sbjct: 2   LRFKKFFVILIVIGFIYVLIVAAFMFSGTRAKPDENVNTVLILGAKINGDPATPSLVLEE 61

Query: 49  RIERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R++ A   L      K+ +SG      S ++  ++++  + + +A   I    K+  TE 
Sbjct: 62  RLDTAVAYLNEYPKAKVIVSGGQGADESTTEAAVMEEYLVNEGIARNRIKKETKSKRTEE 121

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           N + ++    K +    +IVT DYHM R  +  +R    +     P  S           
Sbjct: 122 NIKYSNE---KFDLGKTVIVTSDYHMYRALMLAKRQ--GINATGLPAKS---------RT 167

Query: 166 IKILRVLLIEYLKILLLSIQLS 187
               + ++ E L I    +   
Sbjct: 168 PAKYKGMMREVLSITYAWVFDR 189


>gi|17229308|ref|NP_485856.1| hypothetical protein all1816 [Nostoc sp. PCC 7120]
 gi|17130906|dbj|BAB73515.1| all1816 [Nostoc sp. PCC 7120]
          Length = 215

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 62/198 (31%), Gaps = 22/198 (11%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPD-HPSVSAIVVLTGEPI----------RI 50
           ++ +  L   +   +    S    +        +    A +VL               RI
Sbjct: 22  KWLFRILITIISALLFAISSTAISIYSYGSNSYNNKADAAIVLGAAVWGEEPSPVFRERI 81

Query: 51  ERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
             A  L +N    KI  +G     + +++ I+ +   I + +    +    ++  T  N 
Sbjct: 82  NHAINLYKNGAISKIIFTGGVGEINELAEAIVGRNYAIARGVKAADVLTETQSRTTYQNL 141

Query: 108 QEASAWAEKN-NFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
           + A      N      LI++   H+ R  L  + +   +   P P  +      +     
Sbjct: 142 KNAIEVVGTNEKPTKFLIISDPLHLKRAVLMARNL--GIDAYPSPTPTTRYRSFN----- 194

Query: 167 KILRVLLIEYLKILLLSI 184
             +  L+ E     +  +
Sbjct: 195 SQMEFLIRETYFYFIYLV 212


>gi|317496202|ref|ZP_07954562.1| hypothetical protein HMPREF0432_01166 [Gemella moribillum M424]
 gi|316913777|gb|EFV35263.1| hypothetical protein HMPREF0432_01166 [Gemella moribillum M424]
          Length = 355

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 66/192 (34%), Gaps = 25/192 (13%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIER 52
            + Y   V L F  +G          +       +  +VVL               RI  
Sbjct: 136 IYIYITLVVLYFICIGVSYLAASTLNIINLLPRKLDYVVVLGAGLIGERVTPLLASRIRT 195

Query: 53  AFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQE 109
             ++     G K+ +SG       VS+   ++   + Q ++E  I +  K+ NTE N + 
Sbjct: 196 GIKIYSKHPGSKLIMSGGQGADEVVSEAFAMKNYALEQGVSEEDIIMEDKSTNTEENIKF 255

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
           +    +  N     +VT+ YH+ R  +  + +    + I Y   +              L
Sbjct: 256 SKRLMKDVN-SRFALVTNYYHVYRALVLAKTL--GFRCIGYGAPTKFYF---------TL 303

Query: 170 RVLLIEYLKILL 181
              + E++  L 
Sbjct: 304 NAFIREFIGYLY 315


>gi|329925094|ref|ZP_08280038.1| hypothetical protein HMPREF9412_6526 [Paenibacillus sp. HGF5]
 gi|328940213|gb|EGG36545.1| hypothetical protein HMPREF9412_6526 [Paenibacillus sp. HGF5]
          Length = 194

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 53/146 (36%), Gaps = 12/146 (8%)

Query: 9   FVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------EPIRIERAFELLE 58
              +I      +          +       A++VL               R++ A++L  
Sbjct: 4   IGWIIAIAAMTVLTYICWLHAVMLQPGKADALIVLGYVSKDGRIHPLLKERLDEAYKLFR 63

Query: 59  NQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEK 116
               + I +SG       S+  L++K  + + +    +    K+ NT  N   +    E+
Sbjct: 64  QYGHKYIIVSGGAVGSRRSEAELMEKYLVEKGIPAKRVLKEDKSNNTVQNLIFSKQLMEQ 123

Query: 117 NNFHHVLIVTHDYHMPRTFLELQRIN 142
            +    +I+T+ +H+ RT   + R+ 
Sbjct: 124 YHLKSFVIITNLFHVRRTKYIMHRLG 149


>gi|111221457|ref|YP_712251.1| hypothetical protein FRAAL2020 [Frankia alni ACN14a]
 gi|111148989|emb|CAJ60669.1| hypothetical protein FRAAL2020 [Frankia alni ACN14a]
          Length = 228

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/190 (11%), Positives = 58/190 (30%), Gaps = 19/190 (10%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLENQIGEKIFISG 69
           ++F++          P+   +VVL               R++ A EL    +   +   G
Sbjct: 43  VTFVQVWWVGREDHRPTSDTLVVLGASQYDGRPSAVFAARLDHALELYRQGVAPNVITIG 102

Query: 70  VH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVT 126
                   ++         R+ +    + +  +  +T G+    +      ++   ++VT
Sbjct: 103 GKQPGDRYTEAEAGAAYLRRRGVPADRVIVVPEGSDTLGSLTAVAGVMNTRHWRSTVLVT 162

Query: 127 HDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
              H  R+    + +   +     P+                +R ++ E +      +  
Sbjct: 163 DPPHSLRSRTMARDL--GLDATTSPVTRGPAVHGFDTK----VRYIIREGIGYRWYQLFH 216

Query: 187 SLSTQTASQF 196
             S  +A+  
Sbjct: 217 RASPPSATTR 226


>gi|261364338|ref|ZP_05977221.1| putative periplasmic protein [Neisseria mucosa ATCC 25996]
 gi|288567599|gb|EFC89159.1| putative periplasmic protein [Neisseria mucosa ATCC 25996]
          Length = 197

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 57/163 (34%), Gaps = 15/163 (9%)

Query: 4   FWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLT-----------GEPIRIER 52
           F   LF       +  +    +V ++         A VVL+               R+E 
Sbjct: 8   FILVLFFTAALLPLWIMWRDFWVSRLDADTVRPADAAVVLSTRAYEGGRLNPCLVARVEA 67

Query: 53  AFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNAQEA 110
           A EL   +  +K+ ++G      +     +Q I  +  +++  I    +A NT  N   +
Sbjct: 68  AVELYRARKVKKLVMTGGVSRDLQSSAGNMQMIAEKMGVSKADIIQEREAGNTFENIVFS 127

Query: 111 SAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
             + E +    V+IV+  +H+ R  +   R         Y   
Sbjct: 128 RKFIENSP--RVVIVSAGFHLARARMMADRQWQGHDIQVYAAP 168


>gi|312140270|ref|YP_004007606.1| membrane protein [Rhodococcus equi 103S]
 gi|311889609|emb|CBH48926.1| putative membrane protein [Rhodococcus equi 103S]
          Length = 231

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/195 (13%), Positives = 59/195 (30%), Gaps = 21/195 (10%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIER 52
               G  +  +  + G    +  V ++   D     AIVVL               R+++
Sbjct: 32  RIVLGALLIGVVLVGGTALRVWQVARVT--DTTPADAIVVLGAAQYDGTPSSVFEARLDQ 89

Query: 53  AFELLENQIGEKIFISGVHHSVSKDILL---QKIPIRQDLAECCIDIGYKALNTEGNAQE 109
           A +L E  +   I   G      +       +   + Q +    I    +  +T  + + 
Sbjct: 90  AHKLYEQGVAATIVTVGGKQEGDEYTEAASGRNYLMDQGVPGGAIVAVEEGSDTLLSVEA 149

Query: 110 ASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKIL 169
            S           ++V+  +H  RT    +              +   +  + + +   L
Sbjct: 150 VSREMGARGLRSAVLVSDPWHSLRTRTMARDAGLD------AWTAPTRQGPAVMTRESQL 203

Query: 170 RVLLIEYLKILLLSI 184
             ++ E   +L   +
Sbjct: 204 HGIVRETGALLWYQL 218


>gi|158321219|ref|YP_001513726.1| hypothetical protein Clos_2195 [Alkaliphilus oremlandii OhILAs]
 gi|158141418|gb|ABW19730.1| protein of unknown function DUF218 [Alkaliphilus oremlandii OhILAs]
          Length = 191

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 55/154 (35%), Gaps = 13/154 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTG----------EPIRI 50
           M+       +CL    +  I     +             I+VL               R+
Sbjct: 1   MKLKKLIPILCLFGISIFTIIQFFIIIIPFRLAPVQSDVIIVLGARLYGDKPSPMLQYRL 60

Query: 51  ERAFELLENQIGEKIFIS---GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           E+   L      + I +S   G    +++ + ++   +   + E  I     + +T  N 
Sbjct: 61  EKTLTLYNEGFADTIIVSGARGDDELITEALAMKIYLMNNGVPESAILEEDHSYSTYENL 120

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRI 141
             ++A  ++ +    +IV++ +HM R  +  +R+
Sbjct: 121 SYSNAIMKEKDLKSAIIVSNSFHMSRALMIAKRL 154


>gi|171318455|ref|ZP_02907610.1| protein of unknown function DUF218 [Burkholderia ambifaria MEX-5]
 gi|171096369|gb|EDT41271.1| protein of unknown function DUF218 [Burkholderia ambifaria MEX-5]
          Length = 224

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/209 (12%), Positives = 59/209 (28%), Gaps = 35/209 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFE 55
           R       V       G++           V  +  PD    + +++L     R +    
Sbjct: 8   RQIAIAGVVLFWLLATGWLAAPLIAWTEAGVTPVERPDMHGRTTLIILGIGTRRGDTGLR 67

Query: 56  ------------------LLENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCI 94
                              L+      + +SG         +  +  +  + + +A   +
Sbjct: 68  APPDGEARIRKTAALYRTCLQQATRCTVVMSGGDPQHHGETEAAVYGRRLVEEGVAPGDL 127

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +   +  T  NA+  ++     +    ++V   Y M R  L+ +         P P+ S
Sbjct: 128 VLEPNSRTTYENAKFTASILRSQHDDTRILVASSYQMRRALLDFRHFG----IDPQPVYS 183

Query: 155 HDLEENSSIF----KIKILRVLLIEYLKI 179
           +              ++     L E + I
Sbjct: 184 NRRRARMGWLPRRDNLENANRALHELVGI 212


>gi|167628013|ref|YP_001678513.1| hypothetical protein Fphi_1785 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167598014|gb|ABZ88012.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 231

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/204 (16%), Positives = 68/204 (33%), Gaps = 21/204 (10%)

Query: 1   MRYFWYGLFVCLIFFIMG----FISFIRYVKQMHIPDHPSVSAIVVLTGE---------- 46
           +RYF   + +       G     ++    ++   I    +  AI++L             
Sbjct: 26  LRYFVIIVTIIYYLVGNGVIGNILAKPIRLESTDIKQCANTKAIILLGAGINQAFDKLEP 85

Query: 47  ----PIRIERAFELLENQIGEKIFISGVHHSVS--KDILLQKIPIRQDLAECCIDIGYKA 100
                 RI +  E+      + I   G        +  +   I  +  + +  I +  ++
Sbjct: 86  SLSAYDRILKTAEVYNQYPQDIIISGGSPSGYKLSEAEVYADILYKLGIPKSKIRLEKQS 145

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEEN 160
            NT  NAQ        +N  + LI    ++  R  L     N     I    ++ ++   
Sbjct: 146 KNTYENAQFTKNILSDHNNTYCLITGGIHYQ-RAKLIFDSFNINTINIASSKLAPEISFL 204

Query: 161 SSIFKIKILRVLLIEYLKILLLSI 184
            S +   I + ++ EYL I+   +
Sbjct: 205 PSAYNFYITQAIIHEYLGIVKFYL 228


>gi|257095396|ref|YP_003169037.1| hypothetical protein CAP2UW1_3858 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047920|gb|ACV37108.1| protein of unknown function DUF218 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 233

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 39/207 (18%), Positives = 73/207 (35%), Gaps = 25/207 (12%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQM----HIPDHPSVSAIVVLTGEP--IRIERAFELLENQ 60
            L + ++ F+ G    +R   Q+      P   S  AIV++ GE    R+E A E     
Sbjct: 8   ALVLTMVAFLGGLPPILRLPAQLLCVCEAPADASYEAIVIMMGEVEGRRVEAAAEYFRRG 67

Query: 61  IGEKIFISGVHHSVSK--------DILLQKIPIRQDLAECCIDIGY-----KALNTEGNA 107
           + ++I I     S+ +          L + + +R  + E  I I Y     +A ++   A
Sbjct: 68  VAKRINIVQPESSLYEEYGVLRGQAFLARDLAVRLGVPEDRIHIIYGKDMARATSSFEEA 127

Query: 108 QEASAWAEK------NNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
           +   A+ +            +L+VT  +H  R     +R+ +          +       
Sbjct: 128 RYHLAYLQAGAPESGTEPRKILLVTDWFHTSRARWIFRRVFAGSGIDVDAAAARPEWVAK 187

Query: 162 SIFKIKILRVLLIEYLKILLLSIQLSL 188
                     +  EYLK     ++  L
Sbjct: 188 WWTDEYAFIGVFNEYLKWTYYLLKYGL 214


>gi|78066102|ref|YP_368871.1| hypothetical protein Bcep18194_A4631 [Burkholderia sp. 383]
 gi|77966847|gb|ABB08227.1| protein of unknown function DUF218 [Burkholderia sp. 383]
          Length = 224

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/209 (11%), Positives = 58/209 (27%), Gaps = 35/209 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFE 55
           R               G++           V  +  P+    + ++++     R +   +
Sbjct: 8   RIISIAAIALFWLLATGWLAAPLIAWTESGVAPVEHPEMHGRTTLILIGAGTKRTDFGLQ 67

Query: 56  --------------LLENQIG----EKIFISGVHHSVS---KDILLQKIPIRQDLAECCI 94
                         L            + +SG         +  +  +  + + +A   +
Sbjct: 68  PPPDGTARIHKVAALYRTCRQLAERCTVVMSGGDPQHHGETEAAVYGRQLVAEGIAPTDL 127

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +   +  T  NA+  ++          ++VT  Y M R  L+ +R        P P+ +
Sbjct: 128 VLEPDSRTTYENAKFTASILRSQYDDARILVTSSYQMRRALLDFRRFG----IDPQPVYA 183

Query: 155 HDLEEN-SS---IFKIKILRVLLIEYLKI 179
           +              +      L E + I
Sbjct: 184 NRRRAQTGWLPRWRNLTNAEQALHELVGI 212


>gi|51893168|ref|YP_075859.1| hypothetical protein STH2030 [Symbiobacterium thermophilum IAM
           14863]
 gi|51856857|dbj|BAD41015.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 225

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 53/158 (33%), Gaps = 18/158 (11%)

Query: 2   RYFWYGLFVCLIFFIM--GFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------- 48
           R+    L V     +     + F    + +           +VL                
Sbjct: 13  RWLVRLLAVGTAAVLAINALVYFPGRSRIITADAARPAQVALVLGAGVYADGRPTPMLRD 72

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGN 106
           R+E A  L E     K+ +SG H     D +  +++    + +    + + +   +T  +
Sbjct: 73  RLETALALYEAGKARKLLLSGDHSRPDYDEVNAMRRYLQERGVPPEDLFLDHAGFDTYDS 132

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST 144
              A+A  +      V++VT  +H+PR      R+   
Sbjct: 133 MYRAAAIFQ---VDDVIVVTQGFHLPRALWIAARLGLD 167


>gi|229132528|ref|ZP_04261378.1| hypothetical protein bcere0014_14610 [Bacillus cereus BDRD-ST196]
 gi|228650965|gb|EEL06950.1| hypothetical protein bcere0014_14610 [Bacillus cereus BDRD-ST196]
          Length = 159

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/170 (17%), Positives = 65/170 (38%), Gaps = 25/170 (14%)

Query: 32  PDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDI 78
                   I+VL  +            RI++A E L+        +SG       +++ +
Sbjct: 2   NAIDDADYIIVLGSKVNGTQPSYSLQYRIDKAAEYLKLHDKTIAIVSGGQGKGEDITEAL 61

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
            +++  ++Q++AE  I +  K+ +T+ N + +       N    +IVT+D+HM R     
Sbjct: 62  AMKQGLMKQNIAEDRIIMEDKSTSTDENIKFSKPLI-PANMKKGMIVTNDFHMFRAKKIA 120

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
            +    ++ +P       +  ++           + EYL I        +
Sbjct: 121 AKQGLQLEGLPAKTPKPIIIPSN-----------VREYLAITQYWFMNRI 159


>gi|332653075|ref|ZP_08418820.1| hypothetical protein HMPREF0866_00773 [Ruminococcaceae bacterium
           D16]
 gi|332518221|gb|EGJ47824.1| hypothetical protein HMPREF0866_00773 [Ruminococcaceae bacterium
           D16]
          Length = 205

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 65/187 (34%), Gaps = 19/187 (10%)

Query: 2   RYFWYGLFVCL--IFFIMGFISFIRYVKQMHIPDHPSVSAIV---VLTGE------PIRI 50
           R+    L + L  I    G    + Y    H+   P V  I+   V+ G         R+
Sbjct: 11  RWLKILLALVLAGILCFAGLFGAVMYGAYDHVSGDPQVMIILGCRVMPGGEPSILLQDRL 70

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           + A + L++     + +SG        S+   +        +    I +  K+ NT+ N 
Sbjct: 71  DTALDYLDDHPDITVVVSGGQGSNEPTSEAACMADYLEEHGVDPDQILLEDKSSNTKENL 130

Query: 108 QEASAWAEKNNFH----HVLIVTHDYHMPRTFLELQRINST-VQFIPYPIISHDLEENSS 162
             +    E+         VL+V++ +H+ R+ +  +R     V  +  P           
Sbjct: 131 IYSRELLEEQGVDVGEGGVLVVSNGFHLTRSRMLAERFGYGHVSTLAAPTTHIPSRIQMY 190

Query: 163 IFKIKIL 169
           I +   L
Sbjct: 191 IREPLAL 197


>gi|118477152|ref|YP_894303.1| hypothetical protein BALH_1456 [Bacillus thuringiensis str. Al
           Hakam]
 gi|118416377|gb|ABK84796.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
          Length = 192

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 73/194 (37%), Gaps = 26/194 (13%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELL 57
             + +    +GF+ +    K   +        I+VL  +            RI++A E L
Sbjct: 12  GIIMVCAVYVGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRIDKAAEYL 70

Query: 58  ENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           ++       +SG       +S+ + ++   ++ ++AE  I +  K+ +T+ N + +    
Sbjct: 71  KSHEKAIAIVSGGKGKGEDISEALAMKNELMKLNIAEDRIIMEDKSTSTDENIKFSKPLI 130

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             +N    +IVT+D+HM R      +    ++ +P       +  ++           + 
Sbjct: 131 -PDNMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAETPKRIVIPSN-----------IR 178

Query: 175 EYLKILLLSIQLSL 188
           EY  I        +
Sbjct: 179 EYFAITQYWFMNRI 192


>gi|229011030|ref|ZP_04168224.1| hypothetical protein bmyco0001_14820 [Bacillus mycoides DSM 2048]
 gi|229166553|ref|ZP_04294306.1| hypothetical protein bcere0007_15250 [Bacillus cereus AH621]
 gi|228616957|gb|EEK74029.1| hypothetical protein bcere0007_15250 [Bacillus cereus AH621]
 gi|228750202|gb|EEM00034.1| hypothetical protein bmyco0001_14820 [Bacillus mycoides DSM 2048]
          Length = 159

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/170 (17%), Positives = 65/170 (38%), Gaps = 25/170 (14%)

Query: 32  PDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDI 78
                   I+VL  +            RI++A E L+        +SG       +++ +
Sbjct: 2   NAIDDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKLHDKTIAIVSGGQGKGEDITEAL 61

Query: 79  LLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLEL 138
            +++  ++Q++AE  I +  K+ +T+ N + +       N    +IVT+D+HM R     
Sbjct: 62  AMKQGLMKQNIAEDRIIMEDKSTSTDENIKFSKPLI-PANMKKGMIVTNDFHMFRAKKIA 120

Query: 139 QRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
            +    ++ +P       +  ++           + EYL I        +
Sbjct: 121 AKQGLQLEGLPAKTPKPIIIPSN-----------VREYLAITQYWFMNRI 159


>gi|303242098|ref|ZP_07328589.1| protein of unknown function DUF218 [Acetivibrio cellulolyticus CD2]
 gi|302590392|gb|EFL60149.1| protein of unknown function DUF218 [Acetivibrio cellulolyticus CD2]
          Length = 218

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 44/131 (33%), Gaps = 10/131 (7%)

Query: 23  IRYVKQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH-------HSV 74
           + +          S   I+VL     R+ +R  EL        I ISG          ++
Sbjct: 11  VLWDYHHMNHALTSADLIIVLGSHDTRVAQRGAELYLKGFAPFIVISGGLGKITKHLWNM 70

Query: 75  SKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMP 132
           ++     +I     + E  I +  ++ NT  N             N + ++ V   Y   
Sbjct: 71  TEAEKFAEIACSMGVPEEKIILETRSTNTGENILFTRELILDRNLNINSIITVNKPYMER 130

Query: 133 RTFLELQRINS 143
           RT+   ++  +
Sbjct: 131 RTYAAFKKFWN 141


>gi|86739984|ref|YP_480384.1| hypothetical protein Francci3_1277 [Frankia sp. CcI3]
 gi|86566846|gb|ABD10655.1| protein of unknown function DUF218 [Frankia sp. CcI3]
          Length = 245

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 63/203 (31%), Gaps = 19/203 (9%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFEL 56
              V L   ++  ++F++          P    +VVL               R++   EL
Sbjct: 47  VAAVLLGIMVLAVVTFLQVWWVGREDHRPRSDVLVVLGASQYDGRPSAVLAARLDHVLEL 106

Query: 57  LENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
               I  ++   G        ++         ++ +    + +  +  NT G+    +  
Sbjct: 107 YREGIAPQVITVGGKQPGDRYTEGEASATYLRQRGIPPDRVLVLPEGSNTLGSLTAVAGL 166

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLL 173
               ++H  ++VT  +H  R+    + +          + S      +       +R ++
Sbjct: 167 MNSRHWHTAVLVTDPWHSLRSRTMARDLGVD------AVTSPADRGPAVHGFGTQVRYII 220

Query: 174 IEYLKILLLSIQLSLSTQTASQF 196
            E +      +    S  +A+  
Sbjct: 221 REGIGYRWYQLFRQASPPSATTR 243


>gi|229523809|ref|ZP_04413214.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae bv. albensis
           VL426]
 gi|229337390|gb|EEO02407.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae bv. albensis
           VL426]
          Length = 282

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 78/234 (33%), Gaps = 42/234 (17%)

Query: 5   WYGLFVCLIFFIMGF-------ISFIRYVKQMHIPDHPSVSAIVVLTGEP---------- 47
              LF     F++ F       +  +       +P   ++  ++VL              
Sbjct: 49  LVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFLPVEGTLDYVMVLGNGHVIDDDIPPTS 108

Query: 48  -------IRIERAFELLENQIGEKIFISG--VHHSVSKDILLQKIPIRQDLAECCIDIGY 98
                  +R+     +     G K+ +SG      VS   ++ ++ +   + +  I +  
Sbjct: 109 ELTRAALMRLTEGIRISRMYPGSKLILSGYAGGSEVSHARMMARVALALGVPKSDIILLE 168

Query: 99  KALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL- 157
            A +    A++A+A+ ++     +++VT   HM R   E +     +  IP P       
Sbjct: 169 TAKDAWEEARQAAAFVQQ---KRMVLVTSASHMKRAMREFESA--GLTPIPAPTNYLGHL 223

Query: 158 -EENSSIFKIKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIEEI 204
                    I   R L        E L ++  +++ +++  +       L   +
Sbjct: 224 NIIQPWDKYIPRSRYLEQTEQYWHETLGLMWQTLRDTVAGDSGE---PVLTPPV 274


>gi|152981868|ref|YP_001355267.1| hypothetical protein mma_3577 [Janthinobacterium sp. Marseille]
 gi|151281945|gb|ABR90355.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 258

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 63/219 (28%), Gaps = 36/219 (16%)

Query: 2   RYFWYGLFVCLIFFI-----MGFISFIRYVKQMHIP----DHPSVSAIVVLTGEP----- 47
           R       + L+         G   FI  +++ + P    D     AIVVL G       
Sbjct: 37  RLGLGLSVLALVVLALCSTRFGATLFISPLEKFNPPLQLGDASGAQAIVVLGGGRISNAL 96

Query: 48  -------------IRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAECCI 94
                         R+  A  L        +   G     +         + ++     +
Sbjct: 97  EYAGQDIPSSPTLHRLRYAATLYRTTHLPVLVSGGQPDGAAVSEAAVMARVLREDFSVPV 156

Query: 95  DI-GYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI- 152
                 + NT  NAQ ++    +    H+L+VT   HM R      +    ++ +  P  
Sbjct: 157 RWLEQASNNTAENAQLSARMLREAGVKHILLVTDAMHMQRAKQVFTQA--GLKVVAAPTI 214

Query: 153 -----ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQL 186
                     +   S   ++     L E+L +     + 
Sbjct: 215 FISNARHTPADFLPSSQWLQQTSYALHEWLGLAWYRWRY 253


>gi|187736260|ref|YP_001878372.1| protein of unknown function DUF218 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187426312|gb|ACD05591.1| protein of unknown function DUF218 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 220

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 50/141 (35%), Gaps = 13/141 (9%)

Query: 27  KQMHIPDHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVH------HSVSKDIL 79
                 +      I +L    IR+ E A EL   ++   +  SG         +V +  L
Sbjct: 13  YHHVKQELRPAELIFILGSNDIRVAEYAAELYARKLAPLLLFSGGMGRFTGEWAVPEAEL 72

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF---HHVLIVTHDYHMPRTFL 136
             +  +++ +   CI I  K+ NT  N + + A  EK        ++ +   Y   RT  
Sbjct: 73  FAEAAMKKGVPGDCILIENKSTNTGENVRFSRAVLEKAGIPEPSSIIALQKPYMERRTLA 132

Query: 137 ELQRINSTVQFIPYPIISHDL 157
            LQ     V+     + S   
Sbjct: 133 TLQAQWPEVRV---AVSSPPF 150


>gi|134295565|ref|YP_001119300.1| hypothetical protein Bcep1808_1457 [Burkholderia vietnamiensis G4]
 gi|134138722|gb|ABO54465.1| protein of unknown function DUF218 [Burkholderia vietnamiensis G4]
          Length = 224

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/158 (12%), Positives = 49/158 (31%), Gaps = 15/158 (9%)

Query: 38  SAIVVLTGEPIRIERAFELLENQIG----EKIFISGVHHSVS---KDILLQKIPIRQDLA 90
           + +        RI +   L            + +SG         +  +  ++ + Q +A
Sbjct: 64  NGLRPPPDGEARIRKTAALYRVCREQTIRCTVVMSGGDPQRHGDTEAAVYGRLLLAQGVA 123

Query: 91  ECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150
              + +   +  T  NA+  ++     +    ++VT  Y M R  L+ +         P 
Sbjct: 124 PADLILEPDSRTTYENAKFTASILRSQHDDSRILVTSSYQMRRALLDFRHFG----IDPQ 179

Query: 151 PIISHDLEEN----SSIFKIKILRVLLIEYLKILLLSI 184
           P+ ++              +      + E + I    +
Sbjct: 180 PVYANRRLAQCGLLPRWRNLAAANQAVHELIGIAQFYV 217


>gi|300786369|ref|YP_003766660.1| hypothetical protein AMED_4488 [Amycolatopsis mediterranei U32]
 gi|299795883|gb|ADJ46258.1| conserved hypothetical protein [Amycolatopsis mediterranei U32]
          Length = 329

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 71/205 (34%), Gaps = 32/205 (15%)

Query: 5   WYGLFVCLIFFIMGFISF------IRYVKQMHIPDHPSVSAIVVLTGE----------PI 48
           W    V +   + G+  F      +  V    I       AI+VL               
Sbjct: 121 WGSALVAIAVVLGGYFGFLFLSLLVYSVVYSRIGRRGGFDAIIVLGCGLDGERVPPLLAG 180

Query: 49  RIERAFELLENQIGEKIFIS----GVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
           R+ERA  L + +    + +     G   +VS+   +      + + +  I    +A  TE
Sbjct: 181 RLERAIRLHDREPEPPLLVVSGGRGPGETVSEAEAMHAYLRDRGIPDDHIRREDRARTTE 240

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIF 164
            N + ++          V+ VT  YH+ R  +E +R+   + F      +      S   
Sbjct: 241 ENLRFSADLL-PAGARRVVAVTSSYHVFRAAVECRRL--GLPFHATGAPTARYFLPS--- 294

Query: 165 KIKILRVLLIEYLKILLLSIQLSLS 189
                  LL E+  ++L   + +++
Sbjct: 295 ------ALLREFAALILHYRRTTIA 313


>gi|228945317|ref|ZP_04107672.1| hypothetical protein bthur0007_14800 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228814289|gb|EEM60555.1| hypothetical protein bthur0007_14800 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
          Length = 159

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 66/165 (40%), Gaps = 25/165 (15%)

Query: 37  VSAIVVLTGE----------PIRIERAFELLENQIGEKIFISGVH---HSVSKDILLQKI 83
              I+VL  +            R+++A E L++       +SG       +S+ + ++  
Sbjct: 7   ADYIIVLGSKVNGTKPSYSLQYRMDKAAEYLKSHEKAIAIVSGGKGKGEDISEALAMKNE 66

Query: 84  PIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINS 143
            ++ ++AE  I +  K+ +T+ N + +      +N    +IVT+D+HM R      + N 
Sbjct: 67  LMKLNIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGMIVTNDFHMFRAKKIAAKQNL 125

Query: 144 TVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSL 188
            ++ +P       +  ++           + EYL I        +
Sbjct: 126 QLEGLPAATPKRIVIPSN-----------IREYLAITQYWFMDRI 159


>gi|254224848|ref|ZP_04918463.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125622536|gb|EAZ50855.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 215

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|324325732|gb|ADY20992.1| hypothetical protein YBT020_08730 [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 192

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 72/194 (37%), Gaps = 26/194 (13%)

Query: 8   LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELL 57
             + +    +GF+ +    K   +        I+VL  +            RI++A E L
Sbjct: 12  GIIMVCAVYVGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRIDKAAEYL 70

Query: 58  ENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWA 114
           ++       +SG       +S+ + ++   ++  + E  I +  K+ +T+ N + +    
Sbjct: 71  KSHEKAIAIVSGGKGKGEDISEALAMKNGLMKLKIEEDRIIMEDKSTSTDENIKFSKPLI 130

Query: 115 EKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLI 174
             +N    +IVT+D+HM R      +    ++ +P       +  ++           + 
Sbjct: 131 -PDNMKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAETPKRIVIPSN-----------IR 178

Query: 175 EYLKILLLSIQLSL 188
           EYL I        +
Sbjct: 179 EYLAITQYWFMNRI 192


>gi|238795861|ref|ZP_04639374.1| hypothetical protein ymoll0001_25330 [Yersinia mollaretii ATCC
           43969]
 gi|238720324|gb|EEQ12127.1| hypothetical protein ymoll0001_25330 [Yersinia mollaretii ATCC
           43969]
          Length = 263

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 57/207 (27%), Gaps = 32/207 (15%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP----------------- 47
           W  L +  +  +   +      +      +  V  IVVL G                   
Sbjct: 47  WLVLLLISLQPVADRLLLPLEKQYATYQGNDPVDYIVVLGGGYTFNPNWAPSANLFANSL 106

Query: 48  IRIERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
            R+     L       K+  +G    ++ S      ++     +    I +  +  +T  
Sbjct: 107 PRVTEGVRLYRAHPDAKMVFTGGSTANNQSSAKTAAQVAESLGVPAADIVVLEQPKDTHE 166

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE--ENSSI 163
            A   +           L+VT   H+PR       I   +  IP P     +    +S  
Sbjct: 167 EAAAVATLV---GDKPFLLVTSASHLPRAIKFFTAI--GLHPIPAPANQLAITTPLHSWE 221

Query: 164 FKIKILRVL------LIEYLKILLLSI 184
             I     L        E L ++   +
Sbjct: 222 RTIPAAVYLGHSERAWYETLGLMWQKL 248


>gi|302560768|ref|ZP_07313110.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302478386|gb|EFL41479.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 233

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/170 (11%), Positives = 45/170 (26%), Gaps = 19/170 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
                 L      ++      +     D P     VV                R++ A E
Sbjct: 25  VVTVCVLALLPATWLRLATDDRLRTTADVPRAEVAVVFGAGLWDGEPSPYLAHRLDAAAE 84

Query: 56  LLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
           L      E + ++G +      +   ++    R  +    I   Y   +T  +   A   
Sbjct: 85  LYRAGRIEVVLVTGDNSREEYDEPDAMRAYLTRHGVPGSRIVSDYAGFDTWDSCVRAKKI 144

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
                    ++++  +H+ R     +          Y +   D  + +  
Sbjct: 145 F---GVDRAVLISQGFHIRRAVALCETAG----VSSYGVGVDDRHDVTWY 187


>gi|284990206|ref|YP_003408760.1| hypothetical protein Gobs_1673 [Geodermatophilus obscurus DSM
           43160]
 gi|284063451|gb|ADB74389.1| protein of unknown function DUF218 [Geodermatophilus obscurus DSM
           43160]
          Length = 209

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 49/172 (28%), Gaps = 19/172 (11%)

Query: 26  VKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLENQIGEKIFISGVH---H 72
                    P+  AIVVL               R+E A  L E  +   +   G      
Sbjct: 32  WWTARQDAQPASDAIVVLGSAQYNGVPSSIFEARLEHALALYEEGVAPVVVTVGGKADGD 91

Query: 73  SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
             ++    +       + E  +    + ++T  + +   A  ++  +   ++VT  +H  
Sbjct: 92  QFTEAESGRAYLTEAGIPEDALLAVEEGVDTLESMRAVGAAFDERGWSSAVLVTDPWHAM 151

Query: 133 RTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           R     +     +     P       +          R +L E    LL   
Sbjct: 152 RAERMAEDA--GITADSSPTRQGPAVQTR----ATQFRYILRETAAYLLYRA 197


>gi|239787465|emb|CAX83936.1| conserved uncharacterized protein [uncultured bacterium]
          Length = 258

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 56/171 (32%), Gaps = 12/171 (7%)

Query: 22  FIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVH--HSVSKDIL 79
            + + +    P++       V TG   RI     L        +   G       S+  L
Sbjct: 85  ILGHGRYPAAPEYDGADT--VNTGGLARIRYGAWLHRRTGLPILTSGGKPFQEKESEAQL 142

Query: 80  LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQ 139
           +++   ++            + NT  NA+            HVL+VTH  HM R      
Sbjct: 143 MKRALEKEFGVPVR-WTEDSSDNTLENARNTQKILAAQGIDHVLLVTHGNHMVRALQTFH 201

Query: 140 RINSTVQFIPYPIISHDLEEN----SSIF-KIKILRVLLIEYLKILLLSIQ 185
           +    ++  P P +      N      +    + + V L EY+  L   ++
Sbjct: 202 QA--GLKITPAPTLFQTPTPNAGILDWLPLSCRGVWVPLHEYVGRLWYQLR 250


>gi|228900299|ref|ZP_04064529.1| hypothetical protein bthur0014_15050 [Bacillus thuringiensis IBL
           4222]
 gi|228859334|gb|EEN03764.1| hypothetical protein bthur0014_15050 [Bacillus thuringiensis IBL
           4222]
          Length = 172

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 72/184 (39%), Gaps = 26/184 (14%)

Query: 18  GFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIFI 67
           GF+ +    K  H+        I+VL  +            RI++A E L++       +
Sbjct: 2   GFLQY-HIYKHGHMNATYDADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHEKTIAIV 60

Query: 68  SGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
           SG       +S+ + +++  I+Q++AE  I +  K+ +T+ N   +       +    +I
Sbjct: 61  SGGQGKGEDISEALAMKQGLIKQNIAEDRIIMEDKSTSTDENITFSKPLI-PADMKKGMI 119

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSI 184
           VT+D+HM R      +    ++ +P       +  ++           + EYL I     
Sbjct: 120 VTNDFHMFRAKKIAAKQGLQLEGLPAKTPKPIIIPSN-----------VREYLAITQYWF 168

Query: 185 QLSL 188
              +
Sbjct: 169 MNRI 172


>gi|170703279|ref|ZP_02894076.1| protein of unknown function DUF218 [Burkholderia ambifaria
           IOP40-10]
 gi|170131818|gb|EDT00349.1| protein of unknown function DUF218 [Burkholderia ambifaria
           IOP40-10]
          Length = 219

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 59/200 (29%), Gaps = 14/200 (7%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             +   ++    G            I  +              R++              
Sbjct: 23  LWIVAAVVLVGAGMRMPSEPADVAVIFGNALDDHGAPKPVLAARLDVGVRCYREGQCPAF 82

Query: 66  FISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
            +SG      +++   ++   +   +    I +  +  NT   AQ   A+   +    VL
Sbjct: 83  LVSGAIDGPGLNEATAMRDYLVAHGVPADRIAVDDQGDNTLATAQHTRAYLLAHRMSRVL 142

Query: 124 IVTHDYHMPRTFLELQRI-NSTVQFI-PYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           I++  YH+ R  L  +R+  +       YP      +  SS  ++              +
Sbjct: 143 IISQYYHLARARLAFERVGIAGANISAAYPHHFQLRDIYSSWREVPA----------YAV 192

Query: 182 LSIQLSLSTQTASQFFITLI 201
             ++L L+       F  ++
Sbjct: 193 YVLRLWLNPDARPVSFRPML 212


>gi|313617350|gb|EFR89766.1| conserved hypothetical protein [Listeria innocua FSL S4-378]
          Length = 189

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/199 (16%), Positives = 69/199 (34%), Gaps = 27/199 (13%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSV----------SAIVVLTGEPIRIE 51
           + F+  L V    +++   +F+    +    ++ +                      R++
Sbjct: 5   KKFFVILIVIGFIYVLIVAAFMFSGTRAKPDENVNTVLILGAKINGDPATPSLVLEERLD 64

Query: 52  RAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
            A   L      K+ +SG      S ++  ++++  + + +A   I    K+  TE N +
Sbjct: 65  TAVAYLNEYPKAKVIVSGGQGADESTTEAAVMEEYLVNEGIARNRIKKETKSKRTEENIK 124

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKI 168
            ++    K +    +IVT DYHM R  +  +R    +     P  S              
Sbjct: 125 YSNE---KFDLGKTVIVTSDYHMYRALMLAKRQ--GINATGLPAKS---------RTPAK 170

Query: 169 LRVLLIEYLKILLLSIQLS 187
            + ++ E L I    +   
Sbjct: 171 YKGMMREVLSITYAWVFDR 189


>gi|212694703|ref|ZP_03302831.1| hypothetical protein BACDOR_04235 [Bacteroides dorei DSM 17855]
 gi|212662682|gb|EEB23256.1| hypothetical protein BACDOR_04235 [Bacteroides dorei DSM 17855]
          Length = 252

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/155 (12%), Positives = 41/155 (26%), Gaps = 14/155 (9%)

Query: 47  PIRIERAFELLENQIGEKIFIS---------GVHHSVSKDILLQKIPIRQDLAECCIDIG 97
             R+     L ++    K+ ++                    +++      +    + + 
Sbjct: 95  ADRLLEGIRLYKHGCIRKLVLASDGSIIESKDGKGLQGNAADMKQYLADLGMPLEDVILE 154

Query: 98  YKALNTEGNAQEASAWAEK-NNFHHVLIVTHDYHMPRTFLELQRIN--STVQFI-PYP-I 152
            +A NT  NA                L++T   HM R+                  +P I
Sbjct: 155 TRANNTWENATFTLELIGNSMKTESTLLITSATHMRRSLWTFHAAGLNPDTYITDTFPEI 214

Query: 153 ISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLS 187
                    S   +     L  E++  L   ++  
Sbjct: 215 KGEKTNFLPSWHVLASWPELTHEWVGYLYYRLRHK 249


>gi|313897329|ref|ZP_07830872.1| conserved hypothetical protein [Clostridium sp. HGF2]
 gi|312957699|gb|EFR39324.1| conserved hypothetical protein [Clostridium sp. HGF2]
          Length = 192

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 50/142 (35%), Gaps = 13/142 (9%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI-----------RIERAFELLENQIGEK 64
               I +  +               +VL                R++ A  L + +    
Sbjct: 13  AANLILYHYFPTPPKPQSDRVYDVAIVLGSPAEEDGSLSRVQKTRMDAAITLYKEKRVRC 72

Query: 65  IFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHV 122
           I ISG    ++ ++  ++    IR  +    + +  +A NT  N   A    + + + HV
Sbjct: 73  ILISGGSVRNTYTEADIMAAYAIRCSIPSTALLLERQAKNTYENLLYAKTLCDAHAWKHV 132

Query: 123 LIVTHDYHMPRTFLELQRINST 144
           ++VT  +H+ R    +++    
Sbjct: 133 IVVTSCFHVRRASYMVRKFFDD 154


>gi|253577135|ref|ZP_04854456.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251843517|gb|EES71544.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 228

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 70/212 (33%), Gaps = 36/212 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFISFI-------RYVKQMHIPDHPSVSAIVVLTGEPI------ 48
           R F +GL V      +G++ ++             +          +VL           
Sbjct: 26  RIFRWGLVVIS--LGIGWMLYVLAQIGSIERNPAANSDLSDPAEVGIVLGAALWGDEPSP 83

Query: 49  ----RIERAFELLENQIGEKIFISGVHH----SVSKDILLQKIPIRQDLAECCIDIGYKA 100
               R++++ +  +    +   ++G         ++   +     +  +    + +  KA
Sbjct: 84  GLRERLDQSLKDYKAGKFQWFLLTGGLDTATSQYTEAEGMANYLEQHGVPREKMLLENKA 143

Query: 101 LNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRIN---STVQFIPYPIISHDL 157
            +T  N + +    ++  F  VLIVTH +H  R +   Q +N     +      ++    
Sbjct: 144 TSTYENLKFSQEILKERGFTSVLIVTHTFHGNRAYEIAQALNYEQPRLSLTSSKVLKPL- 202

Query: 158 EENSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
                       R +L  Y K  L  + L++ 
Sbjct: 203 --------PNTFREILA-YTKWKLDQLGLAIG 225


>gi|297626919|ref|YP_003688682.1| hypothetical protein PFREUD_17520 [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296922684|emb|CBL57261.1| Hypothetical protein PFREUD_17520 [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 354

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 65/210 (30%), Gaps = 31/210 (14%)

Query: 1   MRYFWYGLFV---CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------P 47
           M  F    F+      F ++    F+           P    ++VL              
Sbjct: 135 MALFTLVTFIGTYLGTFLVVMLAQFVVRALFGGRRRVPDPDVLIVLGSGLINGKVPPLLA 194

Query: 48  IRIERAFELLE----NQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKA 100
            R++RA ++              +SG        ++   + +    + + +  I +  ++
Sbjct: 195 SRLDRALQVSAEEALQGRRPMFVVSGGRGSDEPRAEAEAMAEYLTSRGVPDERIIVEDRS 254

Query: 101 LNTEGNAQEASAWAEKNNFH-HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159
            +T  N   ++    +      +L VT  YH  RT +    +     F+           
Sbjct: 255 RSTRENLVNSTRLLRERGIGGPMLAVTSSYHTTRTDVLAADLRLDDVFV-------TGAH 307

Query: 160 NSSIFKIKILRVLLIEYLKILLLSIQLSLS 189
            +  +        L EY+ +L   + L++ 
Sbjct: 308 TAWYYAPGAY---LREYIGVLTYRLPLNIG 334


>gi|115372876|ref|ZP_01460181.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310818526|ref|YP_003950884.1| hypothetical protein STAUR_1253 [Stigmatella aurantiaca DW4/3-1]
 gi|115370143|gb|EAU69073.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309391598|gb|ADO69057.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 210

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 59/177 (33%), Gaps = 17/177 (9%)

Query: 16  IMGFISFIRYVKQMHIPDHPSVSAI---------VVLTGEPIRIERAFELLENQIGEKIF 66
           + G    +    Q        V  +         V       R+E+A  L    +  ++ 
Sbjct: 28  VFGLAWRVDRFGQQERAAPADVLVVLGARVLPGGVPSGALLARVEKAVALYHQGLASRLL 87

Query: 67  ISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLI 124
            SG    +  S+  +++ + +R  +      +  ++ +TE NA+ ++          V++
Sbjct: 88  FSGGVGVNPPSEAQVMRALAVRLGVPAEACFLEEQSHSTEQNARFSAQVLRALGAERVVV 147

Query: 125 VTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILL 181
           V+  YH+ R     +      +       S  L    ++         + E   +LL
Sbjct: 148 VSDPYHLLRARQYFR--LEGWEV----ATSPALLTERNLHAADRFYWTVREAFALLL 198


>gi|152975455|ref|YP_001374972.1| hypothetical protein Bcer98_1670 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152024207|gb|ABS21977.1| protein of unknown function DUF218 [Bacillus cytotoxicus NVH
           391-98]
          Length = 185

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/193 (13%), Positives = 66/193 (34%), Gaps = 27/193 (13%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAF 54
           W    + L+  +       +  K         +  I++L  +            R++ A 
Sbjct: 4   WIVCLLFLLPILYILYITYQMRKVAQKEVSNEIPYILILGAKLFGDKPSQSLQNRLDVAL 63

Query: 55  ELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
           + L      K  +SG       + +   ++   +   +    I I  ++ +T  N + + 
Sbjct: 64  KYLNENPKTKAIVSGGQGEDEDIPEAHSMRNYLVAHGINANRILIEDRSTSTYENLKFSK 123

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV 171
                    H +IV++ YH+ RT +  +R+   ++       +    +N         + 
Sbjct: 124 DLFH---ITHAIIVSNTYHLYRTKIIAKRL--GIKMEALAASTPARSKN---------KA 169

Query: 172 LLIEYLKILLLSI 184
            + EY+ I+   +
Sbjct: 170 YIREYIAIIKTLL 182


>gi|229029391|ref|ZP_04185475.1| hypothetical protein bcere0028_14820 [Bacillus cereus AH1271]
 gi|228731922|gb|EEL82820.1| hypothetical protein bcere0028_14820 [Bacillus cereus AH1271]
          Length = 194

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 70/185 (37%), Gaps = 26/185 (14%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIF 66
            GF+ +    K   +        I+VL  +            RI+ A E L++       
Sbjct: 23  AGFLQY-NIYKHGQMNATYDADYIIVLGSKVNGTTPSYSLQYRIDEAAEYLQSHEKTIAI 81

Query: 67  ISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           +SG       +S+ + ++   ++Q +AE  I +  K+ +T+ N + +      +N    +
Sbjct: 82  VSGGKGKGEDISEALAMKNGLMKQKIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGM 140

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           IVT+D+HM R      +    ++ +P       +  ++           + EYL I    
Sbjct: 141 IVTNDFHMFRAKKIAAKQGLQLEGLPAETPKRIVIPSN-----------IREYLAITQYW 189

Query: 184 IQLSL 188
               +
Sbjct: 190 FMNRI 194


>gi|171317689|ref|ZP_02906873.1| protein of unknown function DUF218 [Burkholderia ambifaria MEX-5]
 gi|171097164|gb|EDT42015.1| protein of unknown function DUF218 [Burkholderia ambifaria MEX-5]
          Length = 219

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 60/198 (30%), Gaps = 10/198 (5%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKI 65
             +   ++    G            I  +              R++       +      
Sbjct: 23  LWIVAAVVLVGAGMRMPSEPADVAVIFGNALDDHGAPKPVLAARLDVGVRCYRDGQCPAF 82

Query: 66  FISG--VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
            +SG      +++   ++   +   +    I +  +  NT   AQ A A+ + +    VL
Sbjct: 83  LVSGAIDGPGLNEATAMRDYLVAHGVPAGRIAVDDQGDNTLATAQHARAYLQAHRMSRVL 142

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           I++  YH+ R  L  +R+      I    IS     +     I        E     +  
Sbjct: 143 IISQYYHLARARLAFERVG-----IARANISAAYPHHFQWRDIYSS---WREVPAYAIYV 194

Query: 184 IQLSLSTQTASQFFITLI 201
           ++L L+       F  ++
Sbjct: 195 LRLWLNPDARPVSFRPML 212


>gi|153213889|ref|ZP_01949091.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|254285360|ref|ZP_04960325.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|124115627|gb|EAY34447.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|150424632|gb|EDN16568.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
          Length = 215

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|229523789|ref|ZP_04413194.1| hypothetical protein VCA_001366 [Vibrio cholerae bv. albensis
           VL426]
 gi|229337370|gb|EEO02387.1| hypothetical protein VCA_001366 [Vibrio cholerae bv. albensis
           VL426]
          Length = 215

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|297193393|ref|ZP_06910791.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197718291|gb|EDY62199.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 200

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/132 (14%), Positives = 47/132 (35%), Gaps = 12/132 (9%)

Query: 51  ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIPIRQDLAECCIDIGYKALNT 103
           +   +L    +   +  +G     +       +    ++  +   +    I +  +A NT
Sbjct: 19  DVTADLYRQGMAPVVVFTGATSRTTHDRMPRGEAEHYRERAVELGVPNDAILVEPRARNT 78

Query: 104 EGNAQEASAWAEKNNF--HHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENS 161
             N + + A  E+       VL+V+  Y   R +   +++    +F+     S  +    
Sbjct: 79  GENIRFSRALLEEQGIPVSSVLLVSKPYEERRAYATARKLWPEAEFVS---ASAPMTLAD 135

Query: 162 SIFKIKILRVLL 173
            I  I   R+++
Sbjct: 136 HIRSIGDARLVV 147


>gi|154482903|ref|ZP_02025351.1| hypothetical protein EUBVEN_00600 [Eubacterium ventriosum ATCC
           27560]
 gi|149736187|gb|EDM52073.1| hypothetical protein EUBVEN_00600 [Eubacterium ventriosum ATCC
           27560]
          Length = 224

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/201 (14%), Positives = 59/201 (29%), Gaps = 25/201 (12%)

Query: 5   WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE-----------PIRIERA 53
                +     I    +  + +  +      +   I+VL                RI   
Sbjct: 18  LVIALIVGAINIYMVTTTSKRIISVDDAKDINADCIIVLGAGVKPSGKPSWMLEDRIIVG 77

Query: 54  FELLENQIGEKIFISGVHHSVSKDIL--LQKIPIRQDLAECCIDIGYKALNTEGNAQEAS 111
            +L       K+ +SG H   + D +  ++   I   +    I + +    T  +   A 
Sbjct: 78  EQLYNVNAAPKLLMSGDHGRENYDEVNTMKNYAINDGIPSEDIFMDHAGFETYDSMYRAK 137

Query: 112 AWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRV 171
                     V+IV+  YH+ R+    +++        Y + S         +  K    
Sbjct: 138 KIF---GAKKVVIVSQKYHLYRSLYIAKKMGLD----AYGVSSDLR-----YYSKKQYYR 185

Query: 172 LLIEYLKILLLSIQLSLSTQT 192
              E+L  +   I+     Q 
Sbjct: 186 EAREWLARVKSFIKCIAKPQP 206


>gi|307298224|ref|ZP_07578028.1| protein of unknown function DUF218 [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306916310|gb|EFN46693.1| protein of unknown function DUF218 [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 252

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 68/207 (32%), Gaps = 29/207 (14%)

Query: 6   YGLFVCLIFFIMGF---ISFIRYVKQMHIPDHPSVSAIVVLTGEPI-------------- 48
             L         GF   +      +    P++ S  AIVVL+   I              
Sbjct: 46  IILCFFAYLLSTGFGTHLYLQPLERAYTAPNNVSGQAIVVLSSGIIISPEGQVLDNHSVA 105

Query: 49  RIERAFELLENQIGEKIF---ISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R+ +A+ L        I          +V+   L++   + + +A   + +   A  T  
Sbjct: 106 RLSKAYSLHLQTKLPIIVTGSFMPGRSTVAVSELMRDWLLDRGVASSKVIVEPMAQTTWE 165

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI----ISHDLEENS 161
           NA+ ++    + N+  +++VT   HM R     ++    ++  P+P         L    
Sbjct: 166 NARYSADICSQFNWSSIVLVTSAVHMKRAVTSFEKF--GLRVTPFPTDYLYDHTKLSFVD 223

Query: 162 SIFKIKILR---VLLIEYLKILLLSIQ 185
            +     L      + EY   L    +
Sbjct: 224 FLPNQGALDANLASIHEYFGQLWYLFK 250


>gi|160946740|ref|ZP_02093943.1| hypothetical protein PEPMIC_00699 [Parvimonas micra ATCC 33270]
 gi|158447124|gb|EDP24119.1| hypothetical protein PEPMIC_00699 [Parvimonas micra ATCC 33270]
          Length = 200

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 71/187 (37%), Gaps = 16/187 (8%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           M+  +  +    +  ++   S I + K+  I    +   ++VL  +            R+
Sbjct: 1   MKKLFKFIIFLCLCVVVLIQSLIYHSKKNDIDTFEN--YVLVLGAKANNGKLSKTLINRL 58

Query: 51  ERAFELLENQIGEKIFISGVHHSVSK---DILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +   E L      K  + G   + ++      +Q+  I + +++  +     + NT  N 
Sbjct: 59  DTTVEYLNKHKNAKAVLCGGKENNNELSQAEYMQRYLIEKGISKERLIAETNSKNTYENI 118

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIK 167
           + A    +K     +++++ DYH+ R  L L R     + +P    +  +  + +     
Sbjct: 119 KFALEKLDKKP-SEIMVISSDYHLFRAKLILYRFGILAKTVPAKTPTGAVVPSYARETFA 177

Query: 168 ILRVLLI 174
           +++  L 
Sbjct: 178 VVKTFLF 184


>gi|153800981|ref|ZP_01955567.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|124123451|gb|EAY42194.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 214

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|78187520|ref|YP_375563.1| hypothetical protein Plut_1666 [Chlorobium luteolum DSM 273]
 gi|78167422|gb|ABB24520.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 246

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/208 (16%), Positives = 67/208 (32%), Gaps = 33/208 (15%)

Query: 6   YGLFVCLIFFIMGFISFIR-YVKQMHIPDHPSVSAIVVLT---------------GEPIR 49
             L   +       I  +    +++         AIVVL                    R
Sbjct: 40  MLLIASMPVVGNSLIGILEGPARRVPAASVAHADAIVVLGGMTMQLPGAPLGEWGEAADR 99

Query: 50  IERAFELLENQIGEKIFISGVH-----HSVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
            E   +L        +  +G       + V +  LL    ++ D+    + +   A NT 
Sbjct: 100 FEAGIDLYREGKAPLLVFTGGRLPWRENFVPEGELLALRALQLDIPRASVLVTGIAGNTS 159

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI-----ISHDLEE 159
             A  A+     +    +++VT  +HMPR+ L   R       +P  +      +  +  
Sbjct: 160 DEAGAAAELLGPS--KKIILVTSAFHMPRSILLFHRA--GFSVVPCRVDYRVQPAERMTV 215

Query: 160 NSSIFKIKILR---VLLIEYLKILLLSI 184
            S +   + L+   + L E + I+   +
Sbjct: 216 LSFMPDPEALQQSFIALREIMGIVWYRV 243


>gi|256787907|ref|ZP_05526338.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 207

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/175 (13%), Positives = 53/175 (30%), Gaps = 21/175 (12%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           MR    G  + L+     ++  +   +   + D P     VV                R+
Sbjct: 1   MRVVVAGCVLALLPSA--WLRVVTDDRLRTVADVPRTEVAVVFGAGLWDGEPSPYLAHRL 58

Query: 51  ERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           + A EL        + ++G +      +   ++   +R  + +  I   Y   +T  +  
Sbjct: 59  DAAAELYRAGRIAVVLVTGDNSREEYDEPDAMRAYLVRHGVPDGRIVSDYAGFDTWDSCV 118

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
            A            ++++  +H+ R     Q          Y +   D  + +  
Sbjct: 119 RAKKIF---GVDRAVLISQGFHIRRAVALCQEAG----VASYGVGVADEHDVTWY 166


>gi|21220935|ref|NP_626714.1| integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|289771792|ref|ZP_06531170.1| integral membrane protein [Streptomyces lividans TK24]
 gi|6759567|emb|CAB69760.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|289701991|gb|EFD69420.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 228

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/175 (12%), Positives = 53/175 (30%), Gaps = 20/175 (11%)

Query: 2   RYFWYGLFVCLIFFI-MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRI 50
           R     +  C++  +   ++  +   +   + D P     VV                R+
Sbjct: 20  RLVRVVVAGCVLALLPSAWLRVVTDDRLRTVADVPRTEVAVVFGAGLWDGEPSPYLAHRL 79

Query: 51  ERAFELLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108
           + A EL        + ++G +      +   ++   +R  + +  I   Y   +T  +  
Sbjct: 80  DAAAELYRAGRIAVVLVTGDNSREEYDEPDAMRAYLVRHGVPDGRIVSDYAGFDTWDSCV 139

Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
            A            ++++  +H+ R     Q          Y +   D  + +  
Sbjct: 140 RAKKIF---GVDRAVLISQGFHIRRAVALCQEAG----VASYGVGVADEHDVTWY 187


>gi|87123192|ref|ZP_01079043.1| hypothetical protein RS9917_05015 [Synechococcus sp. RS9917]
 gi|86168912|gb|EAQ70168.1| hypothetical protein RS9917_05015 [Synechococcus sp. RS9917]
          Length = 250

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/221 (15%), Positives = 65/221 (29%), Gaps = 41/221 (18%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLTGEPI------- 48
           R+   G    L FF +G +            +++     P+  AIVVL+G          
Sbjct: 32  RWPLIGALALLWFFSLGLVSQVLWRWLEAPWQRLPAAAAPTADAIVVLSGGRHPAPGAAR 91

Query: 49  --------RIERAFELLENQIGEKIFISGV-----HHSVSKDILLQKIPIRQDLAECCID 95
                   R     +L       ++  +G           +         +  +    + 
Sbjct: 92  VSEWEDPDRFLAGLDLYRAGKAPRLLFTGGASPFRPGQPPEGQRYLAEAEQLGIPSEAMA 151

Query: 96  IGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII-- 153
                +NT   A       +      +L+VT  +HM R     +R    ++  P+P+   
Sbjct: 152 STPVVVNTAEEAVAIRRLLQA-PSARILLVTSAFHMRRAQRLFERQ--GLEVKPFPVDFQ 208

Query: 154 -------SHDLEENSSIFKIKIL---RVLLIEYLKILLLSI 184
                  S   + +  +   + L      L E L  L+   
Sbjct: 209 TRGAWAGSLWRDPSQWLPTAQALDHSSRALRELLGRLVYRA 249


>gi|28198681|ref|NP_778995.1| hypothetical protein PD0776 [Xylella fastidiosa Temecula1]
 gi|28056772|gb|AAO28644.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|307579820|gb|ADN63789.1| hypothetical protein XFLM_09510 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 202

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/175 (13%), Positives = 49/175 (28%), Gaps = 14/175 (8%)

Query: 2   RYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIE 51
           R++ +   + ++ F          V         S   I+VL               RI 
Sbjct: 9   RWWQWICVLVVLVFFWLVAVAGWIVWIGQRDQAASSDVIIVLGAAAYDAKPSPVFEERIR 68

Query: 52  RAFELLENQIGEKIFISGVHH----SVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
               L ++     +  +G         ++  + ++  +R D+    I I   +  T  N 
Sbjct: 69  HGLYLYQHGYAPTLIFTGGFGGSSARFAESQVARRYALRYDVPSRAILIETVSRTTRQNL 128

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSS 162
            +A            ++V+   HM R     + ++        P           
Sbjct: 129 IQARQLMRVYGLRRAIVVSDPLHMARALRLCRELDIDALASATPSTRFRSLHTRW 183


>gi|297579279|ref|ZP_06941207.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297536873|gb|EFH75706.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 215

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|229109172|ref|ZP_04238771.1| hypothetical protein bcere0018_14430 [Bacillus cereus Rock1-15]
 gi|228674182|gb|EEL29427.1| hypothetical protein bcere0018_14430 [Bacillus cereus Rock1-15]
          Length = 196

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 71/185 (38%), Gaps = 26/185 (14%)

Query: 17  MGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQIGEKIF 66
           +GF+ +    K   +        I+VL  +            RI++A E L++       
Sbjct: 25  VGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHDKAIAI 83

Query: 67  ISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVL 123
           +SG       +S+ + ++   ++  +AE  I +  K+ +T+ N + +      +N    +
Sbjct: 84  VSGGKGKGEDISEALAMKNELMKLKIAEDRIIMEDKSTSTDENIKFSKPLI-PDNMKKGM 142

Query: 124 IVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLS 183
           IVT+D+HM R      +    ++ +P       +  ++           + EYL I    
Sbjct: 143 IVTNDFHMFRAKKIAAKQGLQLEGLPAETPKRIVIPSN-----------IREYLAITQYW 191

Query: 184 IQLSL 188
               +
Sbjct: 192 FMNRI 196


>gi|15641702|ref|NP_231334.1| hypothetical protein VC1698 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121586956|ref|ZP_01676735.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|153817136|ref|ZP_01969803.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153821818|ref|ZP_01974485.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227081847|ref|YP_002810398.1| hypothetical protein VCM66_1638 [Vibrio cholerae M66-2]
 gi|229508193|ref|ZP_04397698.1| hypothetical protein VCF_003427 [Vibrio cholerae BX 330286]
 gi|229511569|ref|ZP_04401048.1| hypothetical protein VCE_002978 [Vibrio cholerae B33]
 gi|229518708|ref|ZP_04408151.1| hypothetical protein VCC_002733 [Vibrio cholerae RC9]
 gi|229607766|ref|YP_002878414.1| hypothetical protein VCD_002680 [Vibrio cholerae MJ-1236]
 gi|254848817|ref|ZP_05238167.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255744877|ref|ZP_05418827.1| hypothetical protein VCH_001204 [Vibrio cholera CIRS 101]
 gi|262161840|ref|ZP_06030858.1| hypothetical protein VIG_003008 [Vibrio cholerae INDRE 91/1]
 gi|298498223|ref|ZP_07008030.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656215|gb|AAF94848.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121548791|gb|EAX58836.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|126512285|gb|EAZ74879.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126520616|gb|EAZ77839.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227009735|gb|ACP05947.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|229343397|gb|EEO08372.1| hypothetical protein VCC_002733 [Vibrio cholerae RC9]
 gi|229351534|gb|EEO16475.1| hypothetical protein VCE_002978 [Vibrio cholerae B33]
 gi|229355698|gb|EEO20619.1| hypothetical protein VCF_003427 [Vibrio cholerae BX 330286]
 gi|229370421|gb|ACQ60844.1| hypothetical protein VCD_002680 [Vibrio cholerae MJ-1236]
 gi|254844522|gb|EET22936.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255737348|gb|EET92743.1| hypothetical protein VCH_001204 [Vibrio cholera CIRS 101]
 gi|262028572|gb|EEY47227.1| hypothetical protein VIG_003008 [Vibrio cholerae INDRE 91/1]
 gi|297542556|gb|EFH78606.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 215

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSV-------SKDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG            ++      I 
Sbjct: 21  QPNVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHNEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|331268940|ref|YP_004395432.1| hypothetical protein CbC4_0755 [Clostridium botulinum BKT015925]
 gi|329125490|gb|AEB75435.1| conserved protein [Clostridium botulinum BKT015925]
          Length = 262

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 57/165 (34%), Gaps = 16/165 (9%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RI 50
           +++    +F  +I      +     +             ++VL               R+
Sbjct: 69  IKFRTVIIFFIVIGLSSFILIEGLIIHSAISKTTDEKKYMIVLGAAVHGDYMSLILKKRM 128

Query: 51  ERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +   E L+     KI +SG       +++   +++  I+  +    I    K+ NT  N 
Sbjct: 129 DTTLEYLKKYPNTKIIVSGGKGPGELITEAEAMKRYLIQNGINHDQIIKEEKSRNTAENF 188

Query: 108 QEASAWAEKNNFH---HVLIVTHDYHMPRTFLELQRINSTVQFIP 149
           + +    ++        V +VT D+HM R     +R    V  +P
Sbjct: 189 KYSLEILKQREKKDNPSVCVVTTDFHMFRAKFLAKRAGINVHAVP 233


>gi|84388504|ref|ZP_00991051.1| hypothetical protein V12B01_06906 [Vibrio splendidus 12B01]
 gi|84377053|gb|EAP93924.1| hypothetical protein V12B01_06906 [Vibrio splendidus 12B01]
          Length = 284

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/226 (14%), Positives = 76/226 (33%), Gaps = 32/226 (14%)

Query: 7   GLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEP-----------------IR 49
              +         +  +       +P   ++  ++VL                     +R
Sbjct: 49  IFLIAFQPISSQLLMPMERQHTAFLPVDETIDYVMVLGSGHVVDDQIPPTSELSRTGLMR 108

Query: 50  IERAFELLENQIGEKIFISGV--HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNA 107
           +     +L    G K+ +SG      VS   ++ K+ +   +A+  I +   A +T   A
Sbjct: 109 LSEGIRILRLYPGAKLILSGYGAGTEVSNARMMAKVALALGVAKPDIILLETAKDTWEEA 168

Query: 108 QEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS--HDLEENSSIFK 165
           ++A+A+ +      +++VT   HM R   E       ++ +P P      +         
Sbjct: 169 RQAAAFVKN---KRMVLVTSASHMTRALNEFHAA--GMKPLPAPTNYLAQEGIVEPWNKY 223

Query: 166 IKILRVL------LIEYLKILLLSIQLSLSTQTASQFFITLIEEIT 205
           +     L        E + ++  S++  L T   +     ++ E +
Sbjct: 224 MPKALYLEQTERYWHETMGLMWQSLRDWLDTSNDTVEEPIVVPETS 269


>gi|269837462|ref|YP_003319690.1| hypothetical protein Sthe_1433 [Sphaerobacter thermophilus DSM
           20745]
 gi|269786725|gb|ACZ38868.1| protein of unknown function DUF218 [Sphaerobacter thermophilus DSM
           20745]
          Length = 216

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 60/196 (30%), Gaps = 20/196 (10%)

Query: 1   MRYFWYGLFVCLIFFIMGFISFIRYVK-QMHIPDHPSVSAIVVLTGEPI----------R 49
           +R         ++   +        +  Q    +     AIVVL               R
Sbjct: 22  LRAIVLVFVAAIMLGTLAAGLLALAIYHQARQDETAEADAIVVLGTAQFDGRPSPTFQAR 81

Query: 50  IERAFELLENQIGEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGN 106
           ++ A  L E      I ++G        S+    +   I Q +    +        +  +
Sbjct: 82  LDHARALFEAGYAPLIVLTGGAAEGDWTSEAEAGRNYLIEQGVPSGVLLSVPAGRTSSES 141

Query: 107 AQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKI 166
            +EA     +     +L+V+  +HM R     + +      +  P  S  + E+SS+   
Sbjct: 142 LREAEPELRERGISRILLVSDPFHMFRVKRIARDL--GFSPLASPTRSSPIREDSSLEY- 198

Query: 167 KILRVLLIEYLKILLL 182
              R +  E    L  
Sbjct: 199 ---RYMAREIGAYLAY 211


>gi|153825445|ref|ZP_01978112.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|149740857|gb|EDM54942.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
          Length = 215

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 43/151 (28%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHH-------SVSKDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG          + S+      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPDVLFSGGFGRFTQGVFNYSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVSSPAGSFFDYLTSELTSDFVL 170


>gi|121727311|ref|ZP_01680458.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|153830915|ref|ZP_01983582.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|229520700|ref|ZP_04410123.1| uncharacterized conserved protein [Vibrio cholerae TM 11079-80]
 gi|121630317|gb|EAX62714.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|148873594|gb|EDL71729.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|229342255|gb|EEO07250.1| uncharacterized conserved protein [Vibrio cholerae TM 11079-80]
          Length = 215

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQAWPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|302551238|ref|ZP_07303580.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302468856|gb|EFL31949.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 228

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/165 (10%), Positives = 46/165 (27%), Gaps = 19/165 (11%)

Query: 11  CLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQ 60
            L      ++  +   +     + P     VV                R++ A  L    
Sbjct: 30  VLALLPAAWMYVVAGDRLRTAAEVPRTDVAVVFGAGLWDGEPSPYLAHRLDAAAGLYREG 89

Query: 61  IGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
             E + ++G +      +   ++    R  + +  I   Y   +T  +   A        
Sbjct: 90  RVEVVLVTGDNSREDYDEPDAMRAYLTRHGVPDRRIVSDYAGFDTWDSCVRAKKIF---G 146

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
               ++++  +H+ R     Q          Y +    + + +  
Sbjct: 147 VDEAVLISQGFHIRRAVALCQAAG----VESYGVGVDAVHDATWY 187


>gi|319790359|ref|YP_004151992.1| protein of unknown function DUF218 [Thermovibrio ammonificans HB-1]
 gi|317114861|gb|ADU97351.1| protein of unknown function DUF218 [Thermovibrio ammonificans HB-1]
          Length = 261

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/232 (13%), Positives = 64/232 (27%), Gaps = 39/232 (16%)

Query: 2   RYFWYGLFVCLIFFIMGF---------ISFIRYVKQMHIPDHPSVSAIVVLTGE------ 46
           R   +      + F+  F         +  +            + + IVVL G       
Sbjct: 34  RKLAFFFAALSVAFLYFFSTEFGKDLTLKPLEDAYPYPKLSSLNCTYIVVLGGGIVPHSP 93

Query: 47  ------------PIRIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAEC 92
                         R+  A++L        +   GV +   +    ++ +      +   
Sbjct: 94  AAGGRATVRPQVAKRLLEAWKLWRVLKKPIVATGGVLYPNVESEAAVMARFLEGLGVPAS 153

Query: 93  CIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPI 152
            I +  K+  T  NA+             + +VT  YHMPR+    +      +  P P 
Sbjct: 154 QIKVEGKSRTTFENAEFTYRLI---GPQSICLVTSAYHMPRSVRIFKSF--GFKVTPVPT 208

Query: 153 ISHDLEENSSIFKIKILRVL-----LIEYLKILLLSIQLSLSTQTASQFFIT 199
                    +      +  +       E++ I    ++     +  S    T
Sbjct: 209 DYRVNRAGYNWLSFMPIYGVDTYFGFREWVGIAFFELRNLWRAREDSNLRPT 260


>gi|257063415|ref|YP_003143087.1| uncharacterized membrane protein [Slackia heliotrinireducens DSM
           20476]
 gi|256791068|gb|ACV21738.1| uncharacterized membrane protein [Slackia heliotrinireducens DSM
           20476]
          Length = 212

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 54/180 (30%), Gaps = 25/180 (13%)

Query: 4   FWYGLFVCLIFFIMGFISFI-------RYVKQMHIPDHPSVSAIVVLTGE---------- 46
           F   L +  +  + G  +++        Y  +           IVVL             
Sbjct: 8   FLLALLIAAVVVVGGLNAWVVMSATTDDYTLEQAQELDVQAECIVVLGASVLPDGTPSDI 67

Query: 47  -PIRIERAFELLENQIGEKIFISGVHHSVSKDI--LLQKIPIRQDLAECCIDIGYKALNT 103
              R++ A  L E+     I +SG     + D    +++  I Q +    I +     +T
Sbjct: 68  LKGRLDAAIALYESGAAPVIVMSGNGTESNYDEPFHMKQYAIEQGVPADAIVLDRAGYHT 127

Query: 104 EGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
                  +           +++T +YH+ R+       +  +  +     +    +    
Sbjct: 128 YDTMWRLANI---YGADSCIVITQEYHLYRS--VFDAKSCGMDAVGVVSDNGTYNDQLWY 182


>gi|262189669|ref|ZP_06048045.1| hypothetical protein VIH_000084 [Vibrio cholerae CT 5369-93]
 gi|262034450|gb|EEY52814.1| hypothetical protein VIH_000084 [Vibrio cholerae CT 5369-93]
          Length = 215

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQAWPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVSSPAGSFFDYLTSELTSDFVL 170


>gi|167947128|ref|ZP_02534202.1| probable transmembrane protein [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 250

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/214 (14%), Positives = 64/214 (29%), Gaps = 35/214 (16%)

Query: 3   YFWYGLFVCLIFFIMGFISFIRYVKQMHIPD---HPSVSAIVVLTGEPI----------- 48
           +    L+V  +      ++    +      +        AI+VL G              
Sbjct: 41  FALLLLWVTSLPITADLLAQGLEIHPALSEERLAESHPEAIIVLGGGRNLDAPEYGGDTV 100

Query: 49  ------RIERAFELLENQIGEKIFISGVHHSVSKDIL---LQKIPIRQDLAECCIDIGYK 99
                 R+  A +L        I   G      +       + +     ++   I     
Sbjct: 101 SARELERLRYAAKLARQTGLPVIPSGGAPIYFGEPEAKIAARILQDEFGVSVSQI--EAA 158

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII--SHDL 157
           +  T  NA+ ++   +K     VL+VT+  HM R     +R  + V+ I  P        
Sbjct: 159 SNTTWDNARLSAQLLKKLGIKQVLLVTNALHMRRAIYAFER--NGVEVIAAPTSFIHKTN 216

Query: 158 EENSSIFKIK------ILRVLLIEYLKILLLSIQ 185
             +  +  +        +   + EY+ +L    +
Sbjct: 217 TRHVWLEGLPNGLAVKNVAYAMHEYVGLLWYYFK 250


>gi|27366184|ref|NP_761712.1| hypothetical protein VV1_2906 [Vibrio vulnificus CMCP6]
 gi|27362384|gb|AAO11239.1| hypothetical protein VV1_2906 [Vibrio vulnificus CMCP6]
          Length = 212

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 38/120 (31%), Gaps = 10/120 (8%)

Query: 35  PSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVSK-------DILLQKIPIR 86
             V  ++V+    +R+ E A  L +      I  SG     ++            ++   
Sbjct: 21  TPVDCLLVMCSNDLRVAEHAANLYKQGYAPYILFSGGEGRFTEGLFEKSEAETFAELAKA 80

Query: 87  QDLAECCIDIGYKALNTEGNAQEASAWAEKNN--FHHVLIVTHDYHMPRTFLELQRINST 144
             + E  I +  K+ N+  N + +          F   ++V   +   R     ++    
Sbjct: 81  SGVPEEAILLETKSSNSGENVRFSEQLLIDKGLVFESFILVQKPFMERRALATFEKQWQG 140


>gi|302392084|ref|YP_003827904.1| hypothetical protein Acear_1326 [Acetohalobium arabaticum DSM 5501]
 gi|302204161|gb|ADL12839.1| protein of unknown function DUF218 [Acetohalobium arabaticum DSM
           5501]
          Length = 264

 Score = 66.4 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 59/146 (40%), Gaps = 10/146 (6%)

Query: 49  RIERAFELLENQIGEKIFISGVHHSVSK---DILLQKIPIRQDLAECCIDIGYKALNTEG 105
           R+ R +++ +    + +   GV           +++++ +   + E  I +  KA NT  
Sbjct: 120 RLYRTWQIHKETGLDLVVSGGVVPGADNTSGAEVMKEVLLDLGVKEDKIILEKKAKNTWQ 179

Query: 106 NAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFK 165
           NA   +   E+  +  +++VT   HM R     +R N   + IP P       + S +  
Sbjct: 180 NAVNTALLLEEREYEQIILVTSALHMKRAVYSFER-NCNQRLIPAPANYTFNTDVSLLDY 238

Query: 166 IKILRVL------LIEYLKILLLSIQ 185
           +     L      L E++ ++  S +
Sbjct: 239 LPNRESLDNSLAALHEWIGLVWYSFK 264


>gi|332676512|gb|AEE73328.1| conserved membrane-associated protein, OmpA family
           [Propionibacterium acnes 266]
          Length = 229

 Score = 66.0 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 57/179 (31%), Gaps = 21/179 (11%)

Query: 1   MRYFWYGLFVCLIFFIMG---FISFIRYVKQMHIPDHPSVSAIVVLTGE----------- 46
           +R       +     ++G       + Y K   + D       +VL  +           
Sbjct: 19  IRTVVVSTCIAAFVALLGPWALAGALSYGKVHDVADTEPRDVAIVLGAQVLPSGTPSAYL 78

Query: 47  PIRIERAFELLENQIGEKIFISGVHH--SVSKDILLQKIPIRQDLAECCIDIGYKALNTE 104
             R++ A +L  +   + I +SG H     ++  +++   + + +    I      L+T 
Sbjct: 79  RGRLDVAADLYRSGKAKVILVSGDHRETHYNEPKVMKTYLVSKGVPAARIVEDVAGLDTY 138

Query: 105 GNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
                A            ++VT DYH  RT    +   + +  +  P  +   +     
Sbjct: 139 DTCVRARRIF---GVDRAIMVTQDYHEIRTVATCR--MTGLDAVGVPDRTQPRDNVWWY 192


>gi|229515088|ref|ZP_04404548.1| hypothetical protein VCB_002743 [Vibrio cholerae TMA 21]
 gi|229347793|gb|EEO12752.1| hypothetical protein VCB_002743 [Vibrio cholerae TMA 21]
          Length = 214

 Score = 66.0 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 42/151 (27%), Gaps = 11/151 (7%)

Query: 33  DHPSVSAIVVLTGEPIRI-ERAFELLENQIGEKIFISGVHHSVS-------KDILLQKIP 84
                  I+VL    +R+ E A +L    +   +  SG     +       +      I 
Sbjct: 21  QPDVADLILVLGSNDLRVAEHAAKLYHQGLAPYVLFSGGFGRFTQGVFNHSEAETFAAIA 80

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWA--EKNNFHHVLIVTHDYHMPRTFLELQRIN 142
               + E  I +  ++ N+  N   +      +      +L+V   Y   R +    +  
Sbjct: 81  KDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRILLVQKPYMERRAYATFMQQW 140

Query: 143 STVQFIPYPIISHDLEENSSIFKIKILRVLL 173
                    + S        +        +L
Sbjct: 141 PE-SVESVQVTSPAGSFFDYLTSELTSDFVL 170


>gi|297160757|gb|ADI10469.1| integral membrane protein [Streptomyces bingchenggensis BCW-1]
          Length = 229

 Score = 66.0 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/170 (13%), Positives = 52/170 (30%), Gaps = 19/170 (11%)

Query: 6   YGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFE 55
                 +      ++      +   + D PS    VV                R++   E
Sbjct: 24  VMALSVVALLPATWLRLATDARVRTVADVPSAPVAVVFGAGLWNGEPSPYLAHRLDATAE 83

Query: 56  LLENQIGEKIFISGVH--HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113
           L E      I ++G +  H   +   ++   +R  + +  I   Y   +T  +   A   
Sbjct: 84  LYERGKIRAILVTGDNSRHDYDEPDAMRAYLVRHGVPDQRIVSDYAGFDTWDSCSRAERI 143

Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSI 163
                 H  ++V+ D+H+ R     +          Y +   +  + + +
Sbjct: 144 F---GVHRAVLVSQDFHIRRALALCEAAG----IDAYGVGVAEPHDATWL 186


>gi|229043469|ref|ZP_04191179.1| hypothetical protein bcere0027_15170 [Bacillus cereus AH676]
 gi|228725847|gb|EEL77094.1| hypothetical protein bcere0027_15170 [Bacillus cereus AH676]
          Length = 196

 Score = 66.0 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 72/190 (37%), Gaps = 26/190 (13%)

Query: 12  LIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGE----------PIRIERAFELLENQI 61
           +    +GF+ +    K   +        I+VL  +            RI++A E L++  
Sbjct: 20  VCAIYVGFLQY-NIYKHGQMNATYEADYIIVLGSKVNGTKPSYSLQYRIDKAAEYLKSHD 78

Query: 62  GEKIFISGVH---HSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNN 118
                +SG       +S+ + ++   ++  +AE  I +  K+ +T+ N + +      +N
Sbjct: 79  KAIAIVSGGKGKGEDISEALAMKNELMKLKIAEDRIIMEDKSTSTDENIKFSKPLI-PDN 137

Query: 119 FHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
               +IVT+D+HM R      +    ++ +P       +  ++           + EYL 
Sbjct: 138 MKKGMIVTNDFHMFRAKKIAAKQGLQLEGLPAETPKRIVIPSN-----------IREYLA 186

Query: 179 ILLLSIQLSL 188
           I        +
Sbjct: 187 ITQYWFMNRI 196


>gi|170702081|ref|ZP_02892995.1| protein of unknown function DUF218 [Burkholderia ambifaria
           IOP40-10]
 gi|170133010|gb|EDT01424.1| protein of unknown function DUF218 [Burkholderia ambifaria
           IOP40-10]
          Length = 224

 Score = 66.0 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/209 (12%), Positives = 57/209 (27%), Gaps = 35/209 (16%)

Query: 2   RYFWYGLFVCLIFFIMGFI------SFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFE 55
           R               G++           V  +  PD    + ++ L     R E    
Sbjct: 8   RQIAIAGVAVFWLLATGWLAAPLIAWTEAGVTPVEHPDMHGRTTLITLGIGTRRGETGLR 67

Query: 56  ------------------LLENQIGEKIFISGVHHSVS---KDILLQKIPIRQDLAECCI 94
                              L+      + +SG         +  +  +  + + +A   +
Sbjct: 68  APPDGEARIRKTAALYRTCLQQATRCTVVMSGGDPQHHGETEAAVYGRRLVAEGVAPGDL 127

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIIS 154
            +   +  T  NA+  ++     +    ++V   Y M R  L+ +         P P+ S
Sbjct: 128 VLEPNSRTTYENAKFTASILRSQHDDTRILVASSYQMRRALLDFRHFG----IDPQPVYS 183

Query: 155 HDLEEN-SS---IFKIKILRVLLIEYLKI 179
           +              ++     L E + I
Sbjct: 184 NRRRAQLGWLPRWRNLEDANQALHELVGI 212


>gi|294789429|ref|ZP_06754666.1| putative periplasmic protein [Simonsiella muelleri ATCC 29453]
 gi|294482642|gb|EFG30332.1| putative periplasmic protein [Simonsiella muelleri ATCC 29453]
          Length = 224

 Score = 66.0 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 45/126 (35%), Gaps = 14/126 (11%)

Query: 20  ISFIRYVKQMHIPDHPSVSAIVVLTGEPI----------RIERAFELLENQIGEKIFISG 69
              +    Q   P      A+VVL               RI    +L +    +K+  +G
Sbjct: 27  AWQVYDYAQHEKPLPQKADAVVVLGAAAWGNNPSPVLRERINYGIKLYQQHTVQKMIFTG 86

Query: 70  VHH---SVSKDILLQKIPIRQ-DLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIV 125
                   ++  + Q+  +++ ++ +  I +  ++ +T