RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|99750 cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.. Length = 150 Score = 95.1 bits (237), Expect = 1e-20 Identities = 40/154 (25%), Positives = 66/154 (42%), Gaps = 18/154 (11%) Query: 39 AIVVLTGEPI----------RIERAFELLENQIGEKIFISGV---HHSVSKDILLQKIPI 85 AIVVL G R++ A EL K+ +SG S+ + + I Sbjct: 2 AIVVLGGGVNGDGPSPILAERLDAAAELYRAGPAPKLIVSGGQGPGEGYSEAEAMARYLI 61 Query: 86 RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTV 145 + I + ++ NT NA+ ++ + VL+VT YHMPR L ++ V Sbjct: 62 ELGVPAEAILLEDRSTNTYENARFSAELLRERGIRSVLLVTSAYHMPRALLIFRKAGLDV 121 Query: 146 QFIPYPIISHDLEENSSIFKIKILRVLLIEYLKI 179 + +P P + L +++LR+ L EYL + Sbjct: 122 EVVPAPTDFYSLSSA-----LRLLRLALREYLGL 150 >gnl|CDD|145708 pfam02698, DUF218, DUF218 domain. This large family of proteins contains several highly conserved charged amino acids, suggesting this may be an enzymatic domain (Bateman A pers. obs). The family includes SanA, which is involved in Vancomycin resistance. This protein may be involved in murein synthesis. Length = 148 Score = 85.4 bits (212), Expect = 9e-18 Identities = 36/149 (24%), Positives = 63/149 (42%), Gaps = 12/149 (8%) Query: 39 AIVVLTGEPI-----RIERAFELLENQIGEKIFISG---VHHSVSKDILLQKIPIRQDLA 90 AIVVL G R++ A EL +I +SG VS+ ++++ + + Sbjct: 4 AIVVL-GGGSPALAARLDAAAELYRAGPAPRIIVSGGAGGGEPVSEAEVMRRYLVELGVP 62 Query: 91 ECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPY 150 I + ++ NT NA+ ++ + VL+VT +HM R L +R V +P Sbjct: 63 AEAILLEPQSRNTYENARFSAELLRERGLRRVLLVTSAFHMRRALLLFRRAGPEVVPVPA 122 Query: 151 PIISHDLEENSSIFKIKILRVLLIEYLKI 179 + +++ R L EYL + Sbjct: 123 DYPTPL---PPRALWLRLARAALREYLGL 148 >gnl|CDD|31623 COG1434, COG1434, Uncharacterized conserved protein [Function unknown]. Length = 223 Score = 66.7 bits (162), Expect = 5e-12 Identities = 34/158 (21%), Positives = 64/158 (40%), Gaps = 6/158 (3%) Query: 5 WYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLEN--QIG 62 L + + + GF+ + P ++ +V+ G R+ L ++ Sbjct: 32 LIILLLAALLILGGFLLRPLEARSAAALLLPGLADAIVVLGGGSRLTDHLIRLLEAARLA 91 Query: 63 EKIFISGVHHS--VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120 + + ISGV S V + ++ + I + ++ NT NA+ + Sbjct: 92 KILPISGVLESGGVIEIQATRRYLENLGVPAERIILEDRSRNTVENARFSRRLLRTQGPE 151 Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLE 158 V++VT YHMPR L +++ +V IPYP+ D Sbjct: 152 SVILVTSPYHMPRALLLFRKLGISV--IPYPVGFLDRN 187 >gnl|CDD|146239 pfam03486, HI0933_like, HI0933-like protein. Length = 405 Score = 31.0 bits (71), Expect = 0.27 Identities = 19/70 (27%), Positives = 27/70 (38%), Gaps = 15/70 (21%) Query: 56 LLE--NQIGEKIFISG-----VHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQ 108 L+E ++G KI ISG V +SV D L + P AL+ Sbjct: 28 LIEKGKKLGRKILISGGGRCNVTNSVEPDNFLSRYPGNP--HFL-----KSALSRFTP-W 79 Query: 109 EASAWAEKNN 118 + AW E+ Sbjct: 80 DFIAWFEELG 89 >gnl|CDD|39844 KOG4645, KOG4645, KOG4645, MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]. Length = 1509 Score = 30.4 bits (68), Expect = 0.39 Identities = 21/102 (20%), Positives = 31/102 (30%), Gaps = 3/102 (2%) Query: 57 LENQIGEKIFISGVHHSV--SKDIL-LQKIPIRQDLAECCIDIGYKALNTEGNAQEASAW 113 Q +I I G K ++ L + IRQ + + I Y L E W Sbjct: 980 ALYQYDREIQIQGYSFGFEYHKSVVRLMEGEIRQKINKAYIRFAYVVLKCESGRGTRPRW 1039 Query: 114 AEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISH 155 A + N I FL L + ++ H Sbjct: 1040 ASQGNEFLNAIFAFGRDFGDDFLRLNAFMNECISHVIGLMPH 1081 >gnl|CDD|38405 KOG3195, KOG3195, KOG3195, Uncharacterized membrane protein NPD008/CGI-148 [General function prediction only]. Length = 213 Score = 28.4 bits (63), Expect = 1.5 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 2 RYFWYGLFVC-LIFFIMGFISFIRY 25 R FW GL++C +I+ I + R+ Sbjct: 123 RIFWLGLYLCPVIWIIFAVFALFRF 147 >gnl|CDD|39609 KOG4408, KOG4408, KOG4408, Putative Mg2+ and Co2+ transporter CorD [Inorganic ion transport and metabolism]. Length = 386 Score = 26.9 bits (59), Expect = 4.4 Identities = 27/126 (21%), Positives = 47/126 (37%), Gaps = 20/126 (15%) Query: 64 KIFISGVHHSVSKDIL----LQKIPIRQDLAECCIDIGYKALNTEGNAQEAS--AWAEKN 117 K I G+ + +DIL + +P + +L + D+ + + AW E Sbjct: 180 KYAIPGLDYVSHEDILPYTSSEAVPGQHELFDQFPDLARDPAAIPPFVIQDTLTAWQESK 239 Query: 118 NFHHVLIVTHDYHMPRT----------FL-ELQRINSTVQFIPYPI-ISHDLEENSSIFK 165 N H + D H T +L E ++ V + Y I I + L E S + Sbjct: 240 N--HGWLPIRDVHRETTENIRVTVSTFYLGERSSVHPPVYWWRYCIRIENALPEKSVQLR 297 Query: 166 IKILRV 171 + R+ Sbjct: 298 ERHWRI 303 >gnl|CDD|99799 cd06202, Nitric_oxide_synthase, The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain. The reductase portion is similar in structure to NADPH dependent cytochrome-450 reductase (CYPOR), having an inserted connecting sub-domain within the FAD binding portion of FNR. NOS differs from CYPOR in a requirement for the cofactor tetrahydrobiopterin and unlike most CYPOR is dimeric. Nitric oxide synthase produces nitric oxide in the conversion of L-arginine to L-citruline. NOS has been implicated in a variety of processes including cytotoxicity, anti-inflamation, neurotransmission, and vascular smooth muscle relaxation.. Length = 406 Score = 25.8 bits (57), Expect = 9.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 22 FIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAF 54 F+R H+P+ PSV I+V G I R+F Sbjct: 232 FVRSAPSFHLPEDPSVPVIMVGPGTGIAPFRSF 264 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.328 0.142 0.420 Gapped Lambda K H 0.267 0.0746 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,542,674 Number of extensions: 133121 Number of successful extensions: 685 Number of sequences better than 10.0: 1 Number of HSP's gapped: 683 Number of HSP's successfully gapped: 36 Length of query: 207 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,340,536 Effective search space: 512183248 Effective search space used: 512183248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (24.9 bits)