RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >3ca8_A Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12} (A:32-182) Length = 151 Score = 73.6 bits (180), Expect = 2e-14 Identities = 18/143 (12%), Positives = 39/143 (27%), Gaps = 25/143 (17%) Query: 35 PSVSAIVVLT-GEPIRIERAFELLENQIGEKIFISGVHHSVSKDILLQKIPI-------- 85 +++ I+ A ++ +Q + G+ HS + Sbjct: 4 YQADCVILAGNAVMPTIDAACKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTT 63 Query: 86 --------------RQDLAECCIDIGYKALNTEGNAQEASAWAEKNNF--HHVLIVTHDY 129 + I I ++ N NA+ + A + H ++V Sbjct: 64 GRAEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPT 123 Query: 130 HMPRTFLELQRINSTVQFIPYPI 152 RT +R+ P + Sbjct: 124 MQRRTMATFRRMTGDNPDAPRWL 146 >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} (A:) Length = 128 Score = 31.7 bits (72), Expect = 0.075 Identities = 10/71 (14%), Positives = 28/71 (39%), Gaps = 5/71 (7%) Query: 85 IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRIN 142 +R+ + ++G+ + + +A + + V+ D++MP L+ I Sbjct: 16 MRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVIS---DWNMPNMDGLELLKTIR 72 Query: 143 STVQFIPYPII 153 + P++ Sbjct: 73 AXXAMSALPVL 83 >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} (A:) Length = 129 Score = 30.2 bits (68), Expect = 0.24 Identities = 15/79 (18%), Positives = 33/79 (41%), Gaps = 7/79 (8%) Query: 85 IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPR----TFLELQR 140 R L + +G+K + G+ ++ +N H V+ D++MP+ L+ R Sbjct: 18 SRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVIS---DFNMPKMDGLGLLQAVR 74 Query: 141 INSTVQFIPYPIISHDLEE 159 N + + I++ + Sbjct: 75 ANPATKKAAFIILTAQGDR 93 >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} (A:) Length = 120 Score = 29.4 bits (66), Expect = 0.43 Identities = 13/72 (18%), Positives = 23/72 (31%), Gaps = 5/72 (6%) Query: 85 IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRIN 142 +R L + GY+ N +EA ++ V + D MP ++ I Sbjct: 14 MRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTM---DITMPEMNGIDAIKEIM 70 Query: 143 STVQFIPYPIIS 154 + S Sbjct: 71 KIDPNAKIIVCS 82 >1s8n_A Putative antiterminator; structural genomics, transcriptional antiterminator, two component system, PSI; 1.48A {Mycobacterium tuberculosis H37RV} (A:1-143) Length = 143 Score = 29.1 bits (65), Expect = 0.44 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 85 IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132 IR DLAE + GY+ + G+ QEA AE + V++ D MP Sbjct: 25 IRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIM---DVKMP 69 >3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:1-326) Length = 326 Score = 28.2 bits (62), Expect = 0.84 Identities = 21/134 (15%), Positives = 50/134 (37%), Gaps = 9/134 (6%) Query: 78 ILLQKIPIRQDLAECCIDIG-YKALNTEGNAQEASAWAEKNNFHHVLIVTH---DYHMPR 133 L + + + + ++G Y + T +++ K + ++I T M R Sbjct: 194 CLAPSRELARQIMDVVTEMGKYTEVKTAFGIKDSVPKGAKID-AQIVIGTPGTVMDLMKR 252 Query: 134 TFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKILLLSIQLSLSTQTA 193 L+ + ++ + L++ + ++ LL +I+L S S + Sbjct: 253 RQLDARD----IKVFVLDEADNMLDQQGLGDQSMRIKHLLPRNTQIVLFSATFSERVEKY 308 Query: 194 SQFFITLIEEITVK 207 ++ F EI +K Sbjct: 309 AERFAPNANEIRLK 322 >3f6c_A Positive transcription regulator EVGA; structural genomics, , PSI-2, protein structure initiative; 1.45A {Escherichia coli k-12} (A:) Length = 134 Score = 27.5 bits (61), Expect = 1.6 Identities = 8/48 (16%), Positives = 12/48 (25%), Gaps = 3/48 (6%) Query: 85 IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132 + I + L A E V+I D +P Sbjct: 13 AIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVII---DVDIP 57 >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 94 Score = 26.7 bits (59), Expect = 2.2 Identities = 9/36 (25%), Positives = 15/36 (41%) Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63 ++ IP S + +TG IE+A + E Sbjct: 49 KIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAE 84 >2ww9_B Protein transport protein SSS1; ribonucleoprotein, transmembrane, phosphoprotein, signal sequence, membrane, ribosome, cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_B (B:) Length = 80 Score = 26.6 bits (59), Expect = 2.4 Identities = 7/19 (36%), Positives = 11/19 (57%), Gaps = 2/19 (10%) Query: 14 FFIMGFISFIRYVKQMHIP 32 F +G I + +K +HIP Sbjct: 58 FIAVGIIGYA--IKLIHIP 74 >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} (A:) Length = 157 Score = 26.4 bits (58), Expect = 3.1 Identities = 12/77 (15%), Positives = 28/77 (36%), Gaps = 3/77 (3%) Query: 85 IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRIN 142 + L + G+ ++T + +EA + + + ++ MP+ L I Sbjct: 48 TVKQLTQIFTSEGFNIIDTAADGEEAVIKYKNHYPNIDIVTL-XITMPKMDGITCLSNIM 106 Query: 143 STVQFIPYPIISHDLEE 159 + +IS +E Sbjct: 107 EFDKNARVIMISALGKE 123 >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 104 Score = 26.4 bits (58), Expect = 3.4 Identities = 10/36 (27%), Positives = 18/36 (50%) Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63 +H+P S I+ +TG ++RA L ++ E Sbjct: 49 NIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKE 84 >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein/DNA complex; 1.70A {Homo sapiens} (A:) Length = 73 Score = 26.2 bits (58), Expect = 3.7 Identities = 8/36 (22%), Positives = 18/36 (50%) Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63 +++I + I+ L G I +AF + +++ E Sbjct: 37 RINISEGNCPERIITLAGPTNAIFKAFAXIIDKLEE 72 >2wwb_B SEC61gamma, protein transport protein SEC61 subunit gamma; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris} (B:) Length = 68 Score = 25.8 bits (57), Expect = 4.1 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Query: 14 FFIMGFISFIRYVKQMHIP 32 F IMGFI F VK +HIP Sbjct: 44 FAIMGFIGFF--VKLIHIP 60 >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein/RNA complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* (A:) Length = 178 Score = 25.8 bits (55), Expect = 4.6 Identities = 11/72 (15%), Positives = 25/72 (34%), Gaps = 9/72 (12%) Query: 1 MRYFWYGLFVCLIFFIMGFISFIRYVKQM-----HIPDHPSVSA----IVVLTGEPIRIE 51 + I + ++ + + + P +V ++GEP + Sbjct: 104 NQVKIIVPNSTAGLIIGKGGATVKAIXEQSGAWVQLSQKPDGINLQNRVVTVSGEPEQNR 163 Query: 52 RAFELLENQIGE 63 +A EL+ +I E Sbjct: 164 KAVELIIQKIQE 175 >1jbq_A Cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} (A:138-245) Length = 108 Score = 25.8 bits (56), Expect = 4.7 Identities = 10/57 (17%), Positives = 17/57 (29%) Query: 103 TEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEE 159 T GN A A + +IV + L+ + + + P E Sbjct: 31 TSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPES 87 >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, cytoplasm, DNA-binding, nucleus, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Homo sapiens} (A:1-81) Length = 81 Score = 25.1 bits (55), Expect = 6.6 Identities = 8/36 (22%), Positives = 19/36 (52%) Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63 +++I + I+ L G I +AF ++ +++ E Sbjct: 37 RINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE 72 >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 95 Score = 25.2 bits (55), Expect = 6.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Query: 27 KQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63 +H P S S VV+ G +E+A + L + E Sbjct: 49 VHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEE 85 >1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} (A:1-172,A:333-381) Length = 221 Score = 25.0 bits (55), Expect = 8.3 Identities = 6/24 (25%), Positives = 14/24 (58%) Query: 107 AQEASAWAEKNNFHHVLIVTHDYH 130 ++E+ W E+ + + I+ H +H Sbjct: 196 SEESRRWRERYDSYLDGILRHHHH 219 >1rh5_B Preprotein translocase SECE subunit; protein translocation, SECY, membrane protein, protein channels, protein transport; 3.20A {Methanocaldococcus jannaschii} (B:) Length = 74 Score = 24.7 bits (54), Expect = 8.7 Identities = 4/30 (13%), Positives = 10/30 (33%), Gaps = 3/30 (10%) Query: 4 FWYGLFVCLI-FFIMGFISFIRYVKQMHIP 32 + V + ++G I +I + Sbjct: 34 YLAVAKVTALGISLLGIIGYI--IHVPATY 61 >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} (A:) Length = 71 Score = 24.7 bits (54), Expect = 8.8 Identities = 7/34 (20%), Positives = 15/34 (44%) Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQI 61 + IP S ++ + G+P +++A L Sbjct: 37 SVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELA 70 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.328 0.142 0.420 Gapped Lambda K H 0.267 0.0427 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,596,831 Number of extensions: 68550 Number of successful extensions: 245 Number of sequences better than 10.0: 1 Number of HSP's gapped: 243 Number of HSP's successfully gapped: 44 Length of query: 207 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 123 Effective length of database: 2,116,429 Effective search space: 260320767 Effective search space used: 260320767 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)