RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780579|ref|YP_003064992.1| hypothetical protein
CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62]
         (207 letters)



>3ca8_A Protein YDCF; two domains, alpha/beta fold, helix bundle,
           structural genomics, structure 2 function project, S2F,
           unknown function; 1.80A {Escherichia coli K12}
          Length = 266

 Score = 67.3 bits (164), Expect = 2e-12
 Identities = 25/163 (15%), Positives = 48/163 (29%), Gaps = 37/163 (22%)

Query: 32  PDHPSVSAIVVLTG-EPIRIERAFELLENQIGEKIFISGVHHS----------------- 73
                   +++        I+ A ++  +Q    +   G+ HS                 
Sbjct: 32  EVPYQADCVILAGNAVMPTIDAACKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTI 91

Query: 74  ---------VSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKN--NFHHV 122
                    +  DI  Q   I        I I  ++ N   NA+ + A   +     H  
Sbjct: 92  RTTGRAEATILADIAHQFWHI----PHEKIWIEDQSTNCGENARFSIALLNQAVERVHTA 147

Query: 123 LIVTHDYHMPRTFLELQRI----NSTVQFIPYPIISHDLEENS 161
           ++V       RT    +R+        +++ YP     L  N+
Sbjct: 148 IVVQDPTMQRRTMATFRRMTGDNPDAPRWLSYPGFVPQLGNNA 190


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 48.4 bits (115), Expect = 1e-06
 Identities = 41/220 (18%), Positives = 68/220 (30%), Gaps = 71/220 (32%)

Query: 21  SFIRYVKQMHIPDHPSVSAIV--VLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDI 78
            F+ YV  +  P        V  +   E    E  + L  N I          H+++  +
Sbjct: 63  KFLGYVSSLVEPSKVGQFDQVLNLCLTE---FENCY-LEGNDI----------HALAAKL 108

Query: 79  LLQ---KIPIRQDLAECCIDIGYKA---LNTEGNAQEASAW---AEKNNFHHVLI----- 124
           L +    +   ++L    I     A        + +  SA      + N   V I     
Sbjct: 109 LQENDTTLVKTKEL----IKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQG 164

Query: 125 VTHDYHMPRTFLELQRINSTVQ-FIPYPII----------SHDLEENSSIFKIKILRVL- 172
            T DY     F EL+ +  T    +   +I               +   +F  + L +L 
Sbjct: 165 NTDDY-----FEELRDLYQTYHVLVG-DLIKFSAETLSELIRTTLDAEKVFT-QGLNILE 217

Query: 173 -L--------IEYLKILLLSIQLSLS----TQTASQFFIT 199
            L         +Y    LLSI +S       Q A  + +T
Sbjct: 218 WLENPSNTPDKDY----LLSIPISCPLIGVIQLA-HYVVT 252



 Score = 32.2 bits (73), Expect = 0.080
 Identities = 33/194 (17%), Positives = 62/194 (31%), Gaps = 72/194 (37%)

Query: 12  LIFFIMGFISFIRYVKQMHIPDH---PSVSAIVVLTGE--P-----IR-IERAFELLENQ 60
           ++FFI G             P+    PS+    +   E  P     I  + +    +++ 
Sbjct: 302 VLFFI-GVRC------YEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQ--VQDY 352

Query: 61  IG---------EKIFIS---GVHHSV---------SKDILLQKIPIRQDLAECCIDIGYK 99
           +          +++ IS   G  + V           ++ L+K                K
Sbjct: 353 VNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKA---------------K 397

Query: 100 ALNTEGNAQEASAWAE-KNNFHHV-LIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDL 157
           A    G  Q    ++E K  F +  L V   +H     L               +I+ DL
Sbjct: 398 A--PSGLDQSRIPFSERKLKFSNRFLPVASPFHSH--LLV----------PASDLINKDL 443

Query: 158 EENSSIFKIKILRV 171
            +N+  F  K +++
Sbjct: 444 VKNNVSFNAKDIQI 457


>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia
           coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A
           1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A
           1djm_A 1kmi_Y* 1d4z_A 1cye_A 2che_A 2chf_A 2pl9_A*
           2pmc_A ...
          Length = 128

 Score = 29.8 bits (67), Expect = 0.42
 Identities = 12/81 (14%), Positives = 32/81 (39%), Gaps = 8/81 (9%)

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRIN 142
           +R+ +     ++G+  +    +  +A    +   +  V+    D++MP       L+ I 
Sbjct: 16  MRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVIS---DWNMPNMDGLELLKTIR 72

Query: 143 STVQFIPYPII---SHDLEEN 160
           +       P++   +   +EN
Sbjct: 73  AXXAMSALPVLMVTAEAKKEN 93


>1s8n_A Putative antiterminator; structural genomics, transcriptional
           antiterminator, two component system, PSI; 1.48A
           {Mycobacterium tuberculosis H37RV} SCOP: c.23.1.1 PDB:
           1sd5_A
          Length = 205

 Score = 29.0 bits (64), Expect = 0.77
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTF-LELQRINS 143
           IR DLAE   + GY+ +   G+ QEA   AE +    V++   D  MPR   ++     +
Sbjct: 25  IRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIM---DVKMPRRDGIDAASEIA 81

Query: 144 TVQFIPYPIIS 154
           + +  P  +++
Sbjct: 82  SKRIAPIVVLT 92


>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator,
           structural proteomics in europe, spine, structural
           genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1
           PDB: 1p6u_A
          Length = 129

 Score = 28.3 bits (63), Expect = 1.4
 Identities = 14/71 (19%), Positives = 28/71 (39%), Gaps = 5/71 (7%)

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRIN 142
            R  L +    +G+K +   G+ ++      +N  H V+    D++MP+      LQ + 
Sbjct: 18  SRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVI---SDFNMPKMDGLGLLQAVR 74

Query: 143 STVQFIPYPII 153
           +         I
Sbjct: 75  ANPATKKAAFI 85


>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase
           family S9, hydrolase; 2.80A {Stenotrophomonas
           maltophilia}
          Length = 741

 Score = 28.3 bits (61), Expect = 1.5
 Identities = 16/98 (16%), Positives = 33/98 (33%), Gaps = 14/98 (14%)

Query: 95  DIGYKALNTEGNAQEASAWAEKNNFHHV-------LIV--THDYHMP-----RTFLELQR 140
           D  Y     +  A+  + + E     H+       L++    D ++           LQ+
Sbjct: 643 DSHYTERYMDLPARNDAGYREARVLTHIEGLRSPLLLIHGMADDNVLFTNSTSLMSALQK 702

Query: 141 INSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLK 178
                + + YP   H L    ++ + ++    L   LK
Sbjct: 703 RGQPFELMTYPGAKHGLSGADALHRYRVAEAFLGRCLK 740


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 27.9 bits (61), Expect = 1.8
 Identities = 22/113 (19%), Positives = 41/113 (36%), Gaps = 28/113 (24%)

Query: 55   ELLENQIGEKIFISGVHHSVSKDILLQKIPIRQDLAEC---------------------C 93
            E ++N I ++ FI+ +   V+  ++    PI+  +  C                     C
Sbjct: 1069 EPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATSVESVDIGVETILSGKARIC 1128

Query: 94   IDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQ 146
            I  GY     EG+ +  +  A  N          ++   RT  E+ R  +T +
Sbjct: 1129 IVGGYDDFQEEGSFEFGNMKATSNTL-------EEFEHGRTPAEMSRPATTTR 1174



 Score = 27.5 bits (60), Expect = 2.0
 Identities = 24/104 (23%), Positives = 49/104 (47%), Gaps = 22/104 (21%)

Query: 2   RYFW----YGLFV---CL-IFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPI---RI 50
           R  W    +G F    C+ + +IMGFIS+       ++   P    +   T EP+    +
Sbjct: 835 RTRWEMEAFGEFSLEGCVEMAWIMGFISY----HNGNLKGRPYTGWVDSKTKEPVDDKDV 890

Query: 51  ERAFE--LLEN---QIGEKIFISGVHHSVSKDILLQKIPIRQDL 89
           +  +E  +LE+   ++ E    +G  ++  K  ++Q++ + +DL
Sbjct: 891 KAKYETSILEHSGIRLIEPELFNG--YNPEKKEMIQEVIVEEDL 932


>2wwb_B SEC61gamma, protein transport protein SEC61 subunit gamma;
          ribosome, protein EXIT tunnel, cotranslational protein
          translocation, protein conducting channel; 6.48A {Canis
          lupus familiaris}
          Length = 68

 Score = 27.7 bits (62), Expect = 2.1
 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 3/30 (10%)

Query: 4  FWYGLFVCLI-FFIMGFISFIRYVKQMHIP 32
          F        I F IMGFI F   VK +HIP
Sbjct: 33 FQKIAMATAIGFAIMGFIGFF--VKLIHIP 60


>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol
          metabolism, beta-alpha-alpha-beta-BETA-alpha structure,
          structural genomics, NPPSFA; NMR {Homo sapiens} SCOP:
          d.51.1.1
          Length = 104

 Score = 27.6 bits (61), Expect = 2.2
 Identities = 10/36 (27%), Positives = 18/36 (50%)

Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
           +H+P     S I+ +TG    ++RA   L  ++ E
Sbjct: 49 NIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKE 84


>2ww9_B Protein transport protein SSS1; ribonucleoprotein, transmembrane,
          phosphoprotein, signal sequence, membrane, ribosome,
          cytoplasm; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_B
          Length = 80

 Score = 27.0 bits (60), Expect = 2.9
 Identities = 7/19 (36%), Positives = 11/19 (57%), Gaps = 2/19 (10%)

Query: 14 FFIMGFISFIRYVKQMHIP 32
          F  +G I +   +K +HIP
Sbjct: 58 FIAVGIIGYA--IKLIHIP 74


>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm,
           flagellar rotatio magnesium, metal-binding,
           phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A
           3h1e_A 3h1f_A
          Length = 129

 Score = 27.3 bits (61), Expect = 2.9
 Identities = 14/71 (19%), Positives = 31/71 (43%), Gaps = 4/71 (5%)

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT--FLELQRIN 142
           +R+ +      +GY+ +    +  EA    + N      ++  D++MP       ++++ 
Sbjct: 17  MRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDAN--ADTKVLITDWNMPEMNGLDLVKKVR 74

Query: 143 STVQFIPYPII 153
           S  +F   PII
Sbjct: 75  SDSRFKEIPII 85


>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol
          metabolism, beta-alpha-alpha-beta-BETA-alpha structure,
          structural genomics, NPPSFA; NMR {Homo sapiens} SCOP:
          d.51.1.1
          Length = 94

 Score = 26.7 bits (59), Expect = 3.7
 Identities = 9/37 (24%), Positives = 16/37 (43%)

Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEK 64
          ++ IP     S  + +TG    IE+A   +     E+
Sbjct: 49 KIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQ 85


>3f6c_A Positive transcription regulator EVGA; structural genomics, ,
           PSI-2, protein structure initiative; 1.45A {Escherichia
           coli k-12}
          Length = 134

 Score = 26.6 bits (59), Expect = 4.4
 Identities = 8/48 (16%), Positives = 12/48 (25%), Gaps = 3/48 (6%)

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMP 132
               +    I    + L        A    E      V+I   D  +P
Sbjct: 13  AIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVII---DVDIP 57


>3cg0_A Response regulator receiver modulated diguanylate cyclase with
           PAS/PAC sensor; signal receiver domain; 2.15A
           {Desulfovibrio desulfuricans subsp}
          Length = 140

 Score = 26.2 bits (57), Expect = 5.8
 Identities = 13/76 (17%), Positives = 18/76 (23%)

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINST 144
               L      +GY  L    N +EA   A        L+               R+ + 
Sbjct: 21  AAATLRIQLESLGYDVLGVFDNGEEAVRCAPDLRPDIALVDIMLCGALDGVETAARLAAG 80

Query: 145 VQFIPYPIISHDLEEN 160
                  I S    E 
Sbjct: 81  CNLPIIFITSSQDVET 96


>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA
          binding protein; NMR {Homo sapiens}
          Length = 107

 Score = 26.2 bits (57), Expect = 5.9
 Identities = 9/51 (17%), Positives = 21/51 (41%)

Query: 25 YVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIFISGVHHSVS 75
           + +   P+      + ++ G P +I+ A +L+E +I   +   G      
Sbjct: 41 EISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGP 91


>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea
           batatas} SCOP: c.1.8.1
          Length = 498

 Score = 25.9 bits (57), Expect = 6.6
 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 4/41 (9%)

Query: 19  FISFIRYVKQMHIPDHPSVSAIVVL----TGEPIRIERAFE 55
           F  F ++VK+MH    PS +AI       +   I I+   E
Sbjct: 433 FELFKKFVKKMHADLDPSPNAISPAVLERSNSAITIDELME 473


>3bi8_A Dihydrodipicolinate synthase; TIM-barrel, amino-acid biosynthesis,
           cytoplasm, diaminopimelate biosynthesis, lyase, lysine
           biosynthesis; HET: MLT; 1.96A {Clostridium botulinum}
           PDB: 3ird_A*
          Length = 291

 Score = 25.9 bits (56), Expect = 7.6
 Identities = 22/114 (19%), Positives = 42/114 (36%), Gaps = 9/114 (7%)

Query: 48  IRIERAFELLENQIGEK---IFISG-----VHHSVSKDILLQKIPIRQDLAECCIDIGYK 99
           +  ++  EL+E  I  K   I + G        + ++     K  I +      +  G  
Sbjct: 19  VDFDKLSELIEWHIKSKTDAIIVCGTTGEATTMTETERKETIKFVIDKVNKRIPVIAGTG 78

Query: 100 ALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153
           + NT   +   S WAE      +L++T  Y+       ++   +    +  PII
Sbjct: 79  SNNTA-ASIAMSKWAESIGVDGLLVITPYYNKTTQKGLVKHFKAVSDAVSTPII 131


>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding
          protein/DNA complex; 1.70A {Homo sapiens} SCOP:
          d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A
          Length = 73

 Score = 25.5 bits (56), Expect = 8.3
 Identities = 8/36 (22%), Positives = 19/36 (52%)

Query: 28 QMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGE 63
          +++I +      I+ L G    I +AF ++ +++ E
Sbjct: 37 RINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE 72


>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal
           transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1
           PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y
          Length = 120

 Score = 25.6 bits (56), Expect = 8.9
 Identities = 14/81 (17%), Positives = 27/81 (33%), Gaps = 10/81 (12%)

Query: 85  IRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHHVLIVTHDYHMPRT-----FLELQ 139
           +R  L +     GY+      N +EA    ++     V +   D  MP         E+ 
Sbjct: 14  MRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTM---DITMPEMNGIDAIKEIM 70

Query: 140 RINSTVQFIPYPIISHDLEEN 160
           +I+   + I     +   +  
Sbjct: 71  KIDPNAKII--VCSAMGQQAM 89


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.328    0.142    0.420 

Gapped
Lambda     K      H
   0.267   0.0516    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,815,527
Number of extensions: 81535
Number of successful extensions: 405
Number of sequences better than 10.0: 1
Number of HSP's gapped: 401
Number of HSP's successfully gapped: 45
Length of query: 207
Length of database: 5,693,230
Length adjustment: 88
Effective length of query: 119
Effective length of database: 3,559,758
Effective search space: 423611202
Effective search space used: 423611202
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.1 bits)