BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 422 bits (1086), Expect = e-120, Method: Compositional matrix adjust. Identities = 207/207 (100%), Positives = 207/207 (100%) Query: 1 MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60 MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ Sbjct: 1 MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ 60 Query: 61 IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120 IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH Sbjct: 61 IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH 120 Query: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL Sbjct: 121 HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL 180 Query: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207 LLSIQLSLSTQTASQFFITLIEEITVK Sbjct: 181 LLSIQLSLSTQTASQFFITLIEEITVK 207 >gi|254780187|ref|YP_003064600.1| 30S ribosomal protein S4 [Candidatus Liberibacter asiaticus str. psy62] Length = 206 Score = 26.9 bits (58), Expect = 0.25, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Query: 109 EASAWAEKNNFHHVLIVTHDYHMPRTFLELQRINSTVQFIPYPII 153 EAS AE++ + V HD +M TF+ RI S+++ +PYP+I Sbjct: 155 EASQLAERD-VPEYISVNHD-NMVATFV---RIPSSLKDVPYPVI 194 >gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Score = 26.9 bits (58), Expect = 0.26, Method: Compositional matrix adjust. Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Query: 65 IFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121 I ISG H +++ I+ + + I + ++L+T NAQ +S+ + + Sbjct: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175 Query: 122 VLIVTHDYHMPRTFLELQ 139 +++V+ YH+ R+ L Q Sbjct: 176 IILVSSAYHLKRSQLYFQ 193 >gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 26.9 bits (58), Expect = 0.28, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Query: 46 EPIRIERAFELLENQIGEKIF------ISGVHHSVSKD 77 E I + E+ +N++GE+ F ++ HHS+ KD Sbjct: 182 EEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKD 219 >gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 373 Score = 23.9 bits (50), Expect = 2.0, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 18 GFI-SFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66 GF+ S IR + + + P V I +TG I + AF+L +Q G +IF Sbjct: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL--SQFGAEIF 198 >gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Score = 23.1 bits (48), Expect = 3.8, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 169 LRVLLIEYLKILLLSIQLSLSTQTASQFFITLIEE 203 +R+LLIE K L SI+L L ++ + + L E+ Sbjct: 1 MRILLIEDDKALAHSIELMLKSENFNVYVTDLGED 35 >gi|255764478|ref|YP_003065205.2| aminopeptidase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 22.7 bits (47), Expect = 4.9, Method: Compositional matrix adjust. Identities = 8/11 (72%), Positives = 9/11 (81%) Query: 111 SAWAEKNNFHH 121 +AWAE NNF H Sbjct: 194 AAWAEHNNFLH 204 >gi|254781038|ref|YP_003065451.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Candidatus Liberibacter asiaticus str. psy62] Length = 363 Score = 22.7 bits (47), Expect = 5.0, Method: Compositional matrix adjust. Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 4/74 (5%) Query: 22 FIRYVKQMHIPDHPSVSAI--VVLTGEPIRIERAFELLENQIGEKIFISGVHHSVSKDIL 79 F + K + +P +P I L G+ R + L++ + + F SG+ SV K I Sbjct: 173 FDKIAKSLGLP-YPGGVEIEKAALMGDGKRFKFPCPLVQGTLCDFSF-SGLKTSVQKTIC 230 Query: 80 LQKIPIRQDLAECC 93 + +QD+A+ C Sbjct: 231 AFDVLEKQDIADIC 244 >gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str. psy62] Length = 329 Score = 22.7 bits (47), Expect = 5.3, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 8 LFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVL 43 L V +IF I+G I Y K + P V A++++ Sbjct: 121 LVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILI 156 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.142 0.420 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 129,377 Number of Sequences: 1233 Number of extensions: 5264 Number of successful extensions: 19 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 10 length of query: 207 length of database: 328,796 effective HSP length: 70 effective length of query: 137 effective length of database: 242,486 effective search space: 33220582 effective search space used: 33220582 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 36 (18.5 bits)