BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780581|ref|YP_003064994.1| hypothetical protein CLIBASIA_02340 [Candidatus Liberibacter asiaticus str. psy62] (33 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780581|ref|YP_003064994.1| hypothetical protein CLIBASIA_02340 [Candidatus Liberibacter asiaticus str. psy62] Length = 33 Score = 70.1 bits (170), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 33/33 (100%), Positives = 33/33 (100%) Query: 1 MYGFNFCGFLPKRAGDLSMLAVENDFEWNLMLF 33 MYGFNFCGFLPKRAGDLSMLAVENDFEWNLMLF Sbjct: 1 MYGFNFCGFLPKRAGDLSMLAVENDFEWNLMLF 33 >gi|254780279|ref|YP_003064692.1| dihydrodipicolinate reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Score = 23.9 bits (50), Expect = 0.52, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 3 GFNFCGFLPKRAGDLSMLAVENDFE 27 G NF GFL + A + + A + DFE Sbjct: 131 GINFLGFLVETAAEYLLPAKDWDFE 155 >gi|254780280|ref|YP_003064693.1| glucokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 21.6 bits (44), Expect = 2.6, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 12/15 (80%) Query: 6 FCGFLPKRAGDLSML 20 FC +L + AGDL+++ Sbjct: 251 FCEYLGRVAGDLALI 265 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.333 0.148 0.506 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,807 Number of Sequences: 1233 Number of extensions: 326 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 33 length of database: 328,796 effective HSP length: 7 effective length of query: 26 effective length of database: 320,165 effective search space: 8324290 effective search space used: 8324290 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 31 (16.5 bits)