RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780582|ref|YP_003064995.1| Methyltransferase type 11 [Candidatus Liberibacter asiaticus str. psy62] (242 letters) >gnl|CDD|149353 pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases. Length = 95 Score = 54.6 bits (132), Expect = 2e-08 Identities = 17/43 (39%), Positives = 23/43 (53%) Query: 88 NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130 +LP D S D V+ L DP L EI RVL GG++++ Sbjct: 53 DLPFPDESFDVVVSSLVLHHLPDPERALREIARVLKPGGKLVI 95 >gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional. Length = 241 Score = 41.8 bits (99), Expect = 2e-04 Identities = 20/47 (42%), Positives = 24/47 (51%) Query: 85 SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131 LP D S D V L+ EDP L EI RVL GGR++V+ Sbjct: 77 DADGLPFPDGSFDAVRSDRVLQHLEDPARALAEIARVLRPGGRVVVL 123 >gnl|CDD|162613 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases. Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases. Length = 223 Score = 38.0 bits (89), Expect = 0.002 Identities = 16/43 (37%), Positives = 23/43 (53%) Query: 88 NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130 LP D+S D V + L D L E++RVL GGR+++ Sbjct: 99 ALPFEDNSFDAVTIAFGLRNVTDIQKALREMYRVLKPGGRLVI 141 >gnl|CDD|183351 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed. Length = 272 Score = 36.1 bits (84), Expect = 0.007 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 10/48 (20%) Query: 88 NLPLADSSVD-----CVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130 LP+AD+SVD CV+ + D + E +RVL GGR + Sbjct: 139 ALPVADNSVDVIISNCVI-----NLSPDKERVFKEAFRVLKPGGRFAI 181 >gnl|CDD|178932 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed. Length = 239 Score = 33.6 bits (78), Expect = 0.051 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 12/49 (24%) Query: 88 NLPLADSSVDCVLM------VHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130 LP D+S D V + V D L E++RVL GGR+++ Sbjct: 114 ALPFPDNSFDAVTIAFGLRNVP------DIDKALREMYRVLKPGGRLVI 156 >gnl|CDD|115661 pfam07021, MetW, Methionine biosynthesis protein MetW. This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins. Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In Pseudomonas putida, as in gram-positive bacteria and certain fungi, the second and third steps are a direct sulfhydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells. Length = 193 Score = 33.6 bits (77), Expect = 0.053 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 12/72 (16%) Query: 92 ADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME-------H 144 D S D V++ L+ +P +L E+ R+ G R IV PN G W R+ Sbjct: 72 PDKSFDYVILSQTLQATRNPREVLDELLRI---GRRAIVSFPN-FGHW-RVRWSLLSRGR 126 Query: 145 TPFGSGQPYSWY 156 P PY+WY Sbjct: 127 MPVTDLLPYTWY 138 >gnl|CDD|149354 pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases. Length = 98 Score = 32.0 bits (73), Expect = 0.13 Identities = 12/37 (32%), Positives = 17/37 (45%) Query: 91 LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127 L S D V+ + L DP +L + R+L GG Sbjct: 61 LDPGSFDVVVASNVLHHLADPRAVLRNLRRLLKPGGV 97 >gnl|CDD|185563 PTZ00337, PTZ00337, surface protease GP63; Provisional. Length = 567 Score = 29.9 bits (67), Expect = 0.58 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 11/36 (30%) Query: 103 HYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138 H L F D FLMLH MI VPN RGM Sbjct: 239 HALGFVRDQFLMLH-----------MISEVPNVRGM 263 >gnl|CDD|165876 PLN02232, PLN02232, ubiquinone biosynthesis methyltransferase. Length = 160 Score = 29.7 bits (66), Expect = 0.77 Identities = 16/48 (33%), Positives = 24/48 (50%) Query: 88 NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135 +LP D D V M + L D + E++RVL G R+ ++ NK Sbjct: 37 DLPFDDCEFDAVTMGYGLRNVVDRLRAMKEMYRVLKPGSRVSILDFNK 84 >gnl|CDD|173476 PTZ00211, PTZ00211, ribonucleoside-diphosphate reductase small subunit; Provisional. Length = 330 Score = 28.6 bits (64), Expect = 1.5 Identities = 20/68 (29%), Positives = 26/68 (38%), Gaps = 25/68 (36%) Query: 100 LMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMI 159 LM Y+EF D R+L + G VP + S P+ W MI Sbjct: 260 LMAQYIEFVAD---------RLLVALG-----VPKI-----------YNSKNPFDWMDMI 294 Query: 160 SLLREANF 167 SL + NF Sbjct: 295 SLQGKTNF 302 >gnl|CDD|177877 PLN02233, PLN02233, ubiquinone biosynthesis methyltransferase. Length = 261 Score = 28.7 bits (64), Expect = 1.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Query: 88 NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135 +LP D D + M + L D + E++RVL G R+ ++ NK Sbjct: 138 DLPFDDCYFDAITMGYGLRNVVDRLKAMQEMYRVLKPGSRVSILDFNK 185 >gnl|CDD|178414 PLN02819, PLN02819, lysine-ketoglutarate reductase/saccharopine dehydrogenase. Length = 1042 Score = 27.8 bits (62), Expect = 2.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Query: 37 GCRLLGLGYAIPFFSC 52 G RLL LGY+ PF S Sbjct: 154 GQRLLSLGYSTPFLSL 169 >gnl|CDD|181600 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated. Length = 560 Score = 27.7 bits (62), Expect = 2.8 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Query: 23 AISKVLSTTWDDVTGCRLL---GLGYAIPFFSC 52 A+ + ++ W +TG LL GL P S Sbjct: 336 AVQQAVAERWVKLTGQYLLEGYGLTECSPLVSV 368 >gnl|CDD|115806 pfam07176, DUF1400, Alpha/beta hydrolase of unknown function (DUF1400). This family contains a number of hypothetical proteins of unknown function that seem to be specific to cyanobacteria. Members of this family have an alpha/beta hydrolase fold. Length = 127 Score = 27.7 bits (62), Expect = 3.0 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 1 MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWD 33 + ++ V L QF +S +GK +S+++ T D Sbjct: 57 LPLNPVTLSQFLNSPIGKDILAQLSQIIHTPSD 89 >gnl|CDD|178110 PLN02492, PLN02492, ribonucleoside-diphosphate reductase. Length = 324 Score = 26.2 bits (58), Expect = 7.1 Identities = 16/68 (23%), Positives = 27/68 (39%), Gaps = 25/68 (36%) Query: 100 LMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMI 159 LM Y+EF D R+L + G + ++ + P+ W ++I Sbjct: 249 LMSQYIEFVAD---------RLLVALG------------YEKV----YNVVNPFDWMELI 283 Query: 160 SLLREANF 167 SL + NF Sbjct: 284 SLQGKTNF 291 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.139 0.442 Gapped Lambda K H 0.267 0.0660 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,033,822 Number of extensions: 250295 Number of successful extensions: 509 Number of sequences better than 10.0: 1 Number of HSP's gapped: 506 Number of HSP's successfully gapped: 20 Length of query: 242 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 151 Effective length of database: 4,028,145 Effective search space: 608249895 Effective search space used: 608249895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 56 (25.5 bits)