HHsearch alignment for GI: 254780584 and conserved domain: KOG3278

>KOG3278 consensus.
Probab=99.84  E-value=3.3e-22  Score=153.72  Aligned_cols=92  Identities=25%  Similarity=0.459  Sum_probs=84.6

Q ss_pred             CCCCCCCCCCCCCCC-CCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHHHCCH---HHHH
Q ss_conf             541011785536772-233230237425552489999855778689999972453023641887799972984---4553
Q gi|254780584|r    3 RVCELTKKTVMSGNK-VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK---ENLS   78 (97)
Q Consensus         3 r~C~itGk~~~~Gn~-vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl~~~~---~~Ls   78 (97)
T Consensus        44 ~~gLYgGs~iq~GNn~i~~~g~KTRr~W~PNv~~K~L~S~il~~ki~vkvTt~vLrtIdKeGGiDeYL~K~~sar~K~lg  123 (215)
T KOG3278          44 KRGLYGGSHIQYGNNVIEDGGNKTRRCWKPNVQEKRLFSYILDSKIKVKVTTHVLRTIDKEGGIDEYLLKTPSARQKMLG  123 (215)
T ss_pred             CCCCCCCCCEECCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHEEEEEEHHHHHHHCCCCCHHHHHHCCCHHHHHHCC
T ss_conf             13463653000176536555764302105751366889998754135666367776412024755777538578776403


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999987
Q gi|254780584|r   79 ARMRTLRSQILKKMSE   94 (97)
Q Consensus        79 ~~~~klk~~i~~~l~~   94 (97)
T Consensus       124 ~~G~~lr~~Vl~r~~i  139 (215)
T KOG3278         124 EMGLYLRTKVLARYAI  139 (215)
T ss_pred             CCHHHHHHHHHHHHHC
T ss_conf             1027899999998621