Query gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 97 No_of_seqs 107 out of 724 Neff 5.3 Searched_HMMs 39220 Date Sun May 29 21:43:44 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780584.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK00359 rpmB 50S ribosomal pr 99.9 2E-28 5E-33 190.9 6.2 73 1-74 1-73 (78) 2 CHL00112 rpl28 ribosomal prote 99.9 8.2E-28 2.1E-32 187.2 5.7 69 1-70 1-69 (70) 3 COG0227 RpmB Ribosomal protein 99.9 1.2E-27 3.1E-32 186.2 6.1 74 1-74 1-74 (77) 4 TIGR00009 L28 ribosomal protei 99.9 1.4E-24 3.5E-29 167.9 4.4 58 1-58 1-70 (70) 5 pfam00830 Ribosomal_L28 Riboso 99.9 8.8E-24 2.2E-28 163.1 5.0 61 3-63 1-61 (61) 6 KOG3278 consensus 99.8 3.3E-22 8.3E-27 153.7 2.3 92 3-94 44-139 (215) 7 KOG3279 consensus 99.2 3.6E-13 9.1E-18 99.7 -1.7 91 6-96 86-178 (283) 8 TIGR00770 Dcu transporter, ana 40.9 11 0.00029 18.9 0.9 23 54-77 55-77 (447) 9 PRK04005 50S ribosomal protein 36.3 27 0.00068 16.7 2.2 41 34-74 56-103 (111) 10 PTZ00195 60S ribosomal protein 32.2 40 0.001 15.6 2.5 27 48-74 109-139 (198) 11 COG1813 Predicted transcriptio 27.9 23 0.00059 17.1 0.7 17 3-19 4-20 (165) 12 PRK05462 S-adenosylmethionine 26.2 56 0.0014 14.8 3.1 37 57-93 218-255 (266) 13 TIGR03331 SAM_DCase_Eco S-aden 24.9 59 0.0015 14.7 3.0 36 57-92 214-250 (259) 14 cd03816 GT1_ALG1_like This fam 24.8 16 0.00041 18.0 -0.6 56 4-63 271-339 (415) 15 pfam10621 FpoO F420H2 dehydrog 21.9 14 0.00035 18.5 -1.4 16 48-63 90-105 (119) No 1 >PRK00359 rpmB 50S ribosomal protein L28; Reviewed Probab=99.95 E-value=2e-28 Score=190.91 Aligned_cols=73 Identities=51% Similarity=0.774 Sum_probs=70.3 Q ss_pred CCCCCCCCCCCCCCCCCCCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHHHCCH Q ss_conf 98541011785536772233230237425552489999855778689999972453023641887799972984 Q gi|254780584|r 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74 (97) Q Consensus 1 Msr~C~itGk~~~~Gn~vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl~~~~ 74 (97) |||+||||||+|++||+||||+++|+|+|.||||+++||||++|++|+|+|||++||||+|.| ||.||.+++. T Consensus 1 Msr~C~itGK~~~~Gn~vShs~~kTkR~~~pNlq~kr~~~~~~~~~v~lkvst~~lRtI~K~G-i~~~l~~~~~ 73 (78) T PRK00359 1 MSRVCQLTGKKPMFGNNVSHANNKTKRRFLPNLQKVRFWSEEEGRFVRLRVSARALRTIDKKG-LDAVLAELRA 73 (78) T ss_pred CCCCCCCCCCCCCCCCEEECCCCCCCCEECCCEEEEEEEECCCCEEEEEEEEHHHHHHHHHCC-HHHHHHHHHH T ss_conf 986632479855668646520253365653543899999723691999999948701103618-9999999997 No 2 >CHL00112 rpl28 ribosomal protein L28; Provisional Probab=99.94 E-value=8.2e-28 Score=187.20 Aligned_cols=69 Identities=30% Similarity=0.393 Sum_probs=67.0 Q ss_pred CCCCCCCCCCCCCCCCCCCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHH Q ss_conf 9854101178553677223323023742555248999985577868999997245302364188779997 Q gi|254780584|r 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70 (97) Q Consensus 1 Msr~C~itGk~~~~Gn~vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl 70 (97) |||+||||||+|++||+||||+++|+|+|.||||+++||+|++++||+|+|||+|||||||.| ||.++. T Consensus 1 Msr~C~lTGKk~~~G~~VShs~~rtkRr~~pNLq~kr~~~~~~~r~V~LrvStkaiktI~K~G-i~~~~K 69 (70) T CHL00112 1 MSRVCQLTGKKANNGYAVSHSHKRTKKLQKVNLQTKRIWSTEQNRWIKLKISTKAIKTLKKKL-LKSKTK 69 (70) T ss_pred CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCEEEEEEECCCCEEEEEEEEHHHHEEEHHHC-HHHHHC T ss_conf 975633458755678602504653455404652568899537884999999847712113427-787743 No 3 >COG0227 RpmB Ribosomal protein L28 [Translation, ribosomal structure and biogenesis] Probab=99.94 E-value=1.2e-27 Score=186.18 Aligned_cols=74 Identities=46% Similarity=0.705 Sum_probs=72.2 Q ss_pred CCCCCCCCCCCCCCCCCCCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHHHCCH Q ss_conf 98541011785536772233230237425552489999855778689999972453023641887799972984 Q gi|254780584|r 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74 (97) Q Consensus 1 Msr~C~itGk~~~~Gn~vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl~~~~ 74 (97) |||+|+|||++|++||+||||+++|+|+|.||||.++||++++|++++|+|||+|||+||+.||+|.|+.++.. T Consensus 1 Msr~C~lTGk~~~~GnnvShs~~kTkRr~~pNlq~~~~~~~~~g~~~~l~Vsa~~Lrtidk~G~~~~~~~~~~~ 74 (77) T COG0227 1 MSRRCQLTGKGPMSGNNVSHSHNKTKRRFLPNLQKVRFWSLSDGRFKRLRVSAKALRTIDKKGKIDAVLAKARA 74 (77) T ss_pred CCCEEEECCCCCCCCCCCCCCCCCCCEEECCCEEEEEEEECCCCEEEEEEEEHHHHHCCCCCCCHHHHHHHHCC T ss_conf 97331332544333653230056540354476079889983599089999995882202103553436454210 No 4 >TIGR00009 L28 ribosomal protein L28; InterPro: IPR001383 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . The ribosomal L28 protein family include proteins from bacteria and chloroplasts. The L24 protein from yeast, found in the large subunit of the mitochodrial ribosome, contains a region similar to the bacterial L28 protein.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome. Probab=99.90 E-value=1.4e-24 Score=167.94 Aligned_cols=58 Identities=45% Similarity=0.653 Sum_probs=57.3 Q ss_pred CCCCCCCCCCCCCCCCCCC------------HHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHH Q ss_conf 9854101178553677223------------323023742555248999985577868999997245302 Q gi|254780584|r 1 MSRVCELTKKTVMSGNKVS------------HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58 (97) Q Consensus 1 Msr~C~itGk~~~~Gn~vs------------hs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrt 58 (97) |||+||||||+|++||+|| ||+++|+|+|+||||+++||+|.++++++|+|||+|||+ T Consensus 1 Msr~C~lTGK~p~~Gn~vSrrG~AkkgG~G~Hs~~~tkRrf~PNLq~~r~~~~~~~~~~rl~vsa~~Lr~ 70 (70) T TIGR00009 1 MSRKCELTGKGPLFGNNVSRRGLAKKGGVGRHSHRKTKRRFKPNLQKVRVVVPGEGRVKRLRVSAKCLRT 70 (70) T ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCEEEEEECCCCEEEEEEEEEEECCC T ss_conf 9853221047343232101355313487160104663224366622678987799868999886102169 No 5 >pfam00830 Ribosomal_L28 Ribosomal L28 family. The ribosomal 28 family includes L28 proteins from bacteria and chloroplasts. The L24 protein from yeast also contains a region of similarity to prokaryotic L28 proteins. L24 from yeast is also found in the large ribosomal subunit Probab=99.89 E-value=8.8e-24 Score=163.09 Aligned_cols=61 Identities=46% Similarity=0.719 Sum_probs=60.0 Q ss_pred CCCCCCCCCCCCCCCCCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCC Q ss_conf 5410117855367722332302374255524899998557786899999724530236418 Q gi|254780584|r 3 RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63 (97) Q Consensus 3 r~C~itGk~~~~Gn~vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~G 63 (97) |+|++|||+|++||+||||+++|+|+|.||||+++||||+||++++++|||+|||||||.| T Consensus 1 r~C~~~GK~~~~Gn~vShs~~kTkR~~~pNlq~~~~~~~~l~~~v~lkvst~~Lrti~K~G 61 (61) T pfam00830 1 RRCQLTGKGPMFGNNVSHSNNKTKRRWKPNLQKKRLWSESLGRWVRLKVSTKALRTIDKKG 61 (61) T ss_pred CCCCCCCCCCCCCCEECCCCCCCCCEECCCCEEEEEEECCCCCEEEEEEECHHEEEECCCC T ss_conf 9862468766547512203552476034660899999856893899999854124451369 No 6 >KOG3278 consensus Probab=99.84 E-value=3.3e-22 Score=153.72 Aligned_cols=92 Identities=25% Similarity=0.459 Sum_probs=84.6 Q ss_pred CCCCCCCCCCCCCCC-CCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHHHCCH---HHHH Q ss_conf 541011785536772-233230237425552489999855778689999972453023641887799972984---4553 Q gi|254780584|r 3 RVCELTKKTVMSGNK-VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK---ENLS 78 (97) Q Consensus 3 r~C~itGk~~~~Gn~-vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl~~~~---~~Ls 78 (97) ++-...|..+++||| ++.+.+||+|.|.||+|.+.+||++|++.+.++||+++||||||.||||+||+++++ +.|+ T Consensus 44 ~~gLYgGs~iq~GNn~i~~~g~KTRr~W~PNv~~K~L~S~il~~ki~vkvTt~vLrtIdKeGGiDeYL~K~~sar~K~lg 123 (215) T KOG3278 44 KRGLYGGSHIQYGNNVIEDGGNKTRRCWKPNVQEKRLFSYILDSKIKVKVTTHVLRTIDKEGGIDEYLLKTPSARQKMLG 123 (215) T ss_pred CCCCCCCCCEECCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHEEEEEEHHHHHHHCCCCCHHHHHHCCCHHHHHHCC T ss_conf 13463653000176536555764302105751366889998754135666367776412024755777538578776403 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999987 Q gi|254780584|r 79 ARMRTLRSQILKKMSE 94 (97) Q Consensus 79 ~~~~klk~~i~~~l~~ 94 (97) +.|+++|..++.+.+. T Consensus 124 ~~G~~lr~~Vl~r~~i 139 (215) T KOG3278 124 EMGLYLRTKVLARYAI 139 (215) T ss_pred CCHHHHHHHHHHHHHC T ss_conf 1027899999998621 No 7 >KOG3279 consensus Probab=99.25 E-value=3.6e-13 Score=99.66 Aligned_cols=91 Identities=16% Similarity=0.301 Sum_probs=79.2 Q ss_pred CCCCCCCCCCCCCCH-HHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHHHCCHHHH-HHHHHH Q ss_conf 011785536772233-230237425552489999855778689999972453023641887799972984455-399999 Q gi|254780584|r 6 ELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-SARMRT 83 (97) Q Consensus 6 ~itGk~~~~Gn~vsh-s~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl~~~~~~L-s~~~~k 83 (97) .|.|..+..|-.-|. ..++..|.|-|||.++.++|++|+.++++.||.|+|+.||...|+|.|+|+++..+| |.++.+ T Consensus 86 ~wgge~vikg~~~~~~tk~~~p~~wvp~l~~~v~~s~ild~y~~v~vteRtl~LIDE~~GLD~YILk~~~~DL~SKFa~~ 165 (283) T KOG3279 86 IWGGEAVIKGFQKREQTKRRVPHFWVPNLRRSVVHSHVLDCYMSVVVTERTLELIDECHGLDHYILKNRACDLRSKFALK 165 (283) T ss_pred CCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHEEEEEHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHH T ss_conf 43418999889987776603873225204456679998755632543098999999864852366437302067798888 Q ss_pred HHHHHHHHHHHHH Q ss_conf 9999999998740 Q gi|254780584|r 84 LRSQILKKMSEKS 96 (97) Q Consensus 84 lk~~i~~~l~~k~ 96 (97) |++.|+.+|+... T Consensus 166 LKReMLL~L~~~~ 178 (283) T KOG3279 166 LKREMLLALQNGV 178 (283) T ss_pred HHHHHHHHHHCCC T ss_conf 8999999873179 No 8 >TIGR00770 Dcu transporter, anaerobic C4-dicarboxylate uptake (Dcu) family; InterPro: IPR004668 These proteins are members of the C4-Dicarboxylate Uptake (Dcu) family. Most proteins in this family are predicted to have 12 GES predicted transmembrane regions; however the one member whose membrane topology has been experimentally determined has 10 transmembrane regions, with both the N- and C-termini localized to the periplasm . The DcuA and DcuB proteins are involved in the transport of aspartate, malate, fumarate and succinate in many species , , , and are thought to function as antiporters with any two of these substrates. Since DcuA is encoded in an operon with the gene for aspartase, and DcuB is encoded in an operon with the gene for fumarase, their physiological functions may be to catalyze aspartate:fumarate and fumarate:malate exchange during the anaerobic utilization of aspartate and fumarate, respectively . The Escherichia coli DcuA and DcuB proteins have very different expression patterns . DcuA is constitutively expressed; DcuB is strongly induced anaerobically by FNR and C4-dicarboxylates, while it is repressed by nitrate and subject to CRP-mediated catabolite repression.; GO: 0015556 C4-dicarboxylate transmembrane transporter activity, 0015740 C4-dicarboxylate transport, 0016021 integral to membrane. Probab=40.90 E-value=11 Score=18.93 Aligned_cols=23 Identities=30% Similarity=0.590 Sum_probs=16.4 Q ss_pred HHHHHHHHCCCHHHHHHHCCHHHH Q ss_conf 453023641887799972984455 Q gi|254780584|r 54 CALRSVERQGGLDRFLSNSKKENL 77 (97) Q Consensus 54 ~~lrtI~K~GGlD~yLl~~~~~~L 77 (97) .|+=++..+|||| ||++.-+|-| T Consensus 55 AAiaAmQ~AGGLD-Ylv~iAEKlL 77 (447) T TIGR00770 55 AAIAAMQAAGGLD-YLVKIAEKLL 77 (447) T ss_pred HHHHHHHHHCCHH-HHHHHHHHHH T ss_conf 9999987513336-7999998974 No 9 >PRK04005 50S ribosomal protein L18e; Provisional Probab=36.30 E-value=27 Score=16.70 Aligned_cols=41 Identities=24% Similarity=0.371 Sum_probs=27.4 Q ss_pred EEEEEEECCCCCEEE---EEEEHHHHHHHHHCCC----HHHHHHHCCH Q ss_conf 899998557786899---9997245302364188----7799972984 Q gi|254780584|r 34 CRITLISDIMEQKYQ---LRISKCALRSVERQGG----LDRFLSNSKK 74 (97) Q Consensus 34 q~~~~~s~~l~~~v~---l~vst~~lrtI~K~GG----lD~yLl~~~~ 74 (97) --+-+-+..+...++ +++|.+|..-|.++|| ||+.+.+.|. T Consensus 56 pGKVLg~g~l~~kvtV~A~~fS~~A~~kI~~aGG~~it~~ql~~~nP~ 103 (111) T PRK04005 56 PGKVLGSGKLDKKVTVAALSFSETAKEKIEEAGGECLTIEELVEENPK 103 (111) T ss_pred EEEECCCCEECCCEEEEEEECCHHHHHHHHHCCCEEEEHHHHHHHCCC T ss_conf 888818877867779999757989999999809989779999987899 No 10 >PTZ00195 60S ribosomal protein L18; Provisional Probab=32.23 E-value=40 Score=15.65 Aligned_cols=27 Identities=33% Similarity=0.469 Sum_probs=23.0 Q ss_pred EEEEEHHHHHHHHHCCC----HHHHHHHCCH Q ss_conf 99997245302364188----7799972984 Q gi|254780584|r 48 QLRISKCALRSVERQGG----LDRFLSNSKK 74 (97) Q Consensus 48 ~l~vst~~lrtI~K~GG----lD~yLl~~~~ 74 (97) -|++|..|=.-|.++|| ||+.-+.+|. T Consensus 109 ALrfT~~AR~RIlkaGGe~lTfDQLAl~aP~ 139 (198) T PTZ00195 109 ALRFSKSARQSIVAAGGECLTFDQLAMIAPT 139 (198) T ss_pred EEEECHHHHHHHHHCCCEEEEHHHHHHHCCC T ss_conf 7651388999999639858867898985889 No 11 >COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription] Probab=27.89 E-value=23 Score=17.08 Aligned_cols=17 Identities=29% Similarity=0.347 Sum_probs=13.3 Q ss_pred CCCCCCCCCCCCCCCCC Q ss_conf 54101178553677223 Q gi|254780584|r 3 RVCELTKKTVMSGNKVS 19 (97) Q Consensus 3 r~C~itGk~~~~Gn~vs 19 (97) -.|+|||+.+..+..|. T Consensus 4 ~~CEiCG~~i~~~~~v~ 20 (165) T COG1813 4 MGCELCGREIDKPIKVK 20 (165) T ss_pred CCEECCCCCCCCCEEEE T ss_conf 61240465057772587 No 12 >PRK05462 S-adenosylmethionine decarboxylase; Provisional Probab=26.19 E-value=56 Score=14.81 Aligned_cols=37 Identities=30% Similarity=0.439 Sum_probs=24.4 Q ss_pred HHHHHCCCHHHHHHHCCHHHHHHH-HHHHHHHHHHHHH Q ss_conf 023641887799972984455399-9999999999998 Q gi|254780584|r 57 RSVERQGGLDRFLSNSKKENLSAR-MRTLRSQILKKMS 93 (97) Q Consensus 57 rtI~K~GGlD~yLl~~~~~~Ls~~-~~klk~~i~~~l~ 93 (97) |.+-|.-.+|+||......+|++. ...++.++...+. T Consensus 218 KM~lkefdl~nYLF~~~~~~ls~~e~~~i~~~L~~EM~ 255 (266) T PRK05462 218 KMLLKEFDLDNYLFNTKPEDLSAEERQEITALLKKEMR 255 (266) T ss_pred HHHHHHCCHHHCCCCCCCHHCCHHHHHHHHHHHHHHHH T ss_conf 88876437222023799002898999999999999999 No 13 >TIGR03331 SAM_DCase_Eco S-adenosylmethionine decarboxylase proenzyme, Escherichia coli form. Members of this protein family are the single chain precursor of the S-adenosylmethionine decarboxylase as found in Escherichia coli. This form shows a substantially different architecture from the form shared by the Archaea, Bacillus, and many other species (TIGR03330). It shows little or no similarity to the form found in eukaryotes (TIGR00535). Probab=24.90 E-value=59 Score=14.66 Aligned_cols=36 Identities=28% Similarity=0.453 Sum_probs=23.3 Q ss_pred HHHHHCCCHHHHHHHCCHHHHHHH-HHHHHHHHHHHH Q ss_conf 023641887799972984455399-999999999999 Q gi|254780584|r 57 RSVERQGGLDRFLSNSKKENLSAR-MRTLRSQILKKM 92 (97) Q Consensus 57 rtI~K~GGlD~yLl~~~~~~Ls~~-~~klk~~i~~~l 92 (97) |.+-|.-.+|+||.++...+|++. ...+...+...+ T Consensus 214 Km~lke~dL~nYLF~~~~~~ls~~e~~~I~~~L~~EM 250 (259) T TIGR03331 214 KMMLKDFDLDNYLFGTAKEDLSPEERREITARLKKEM 250 (259) T ss_pred HHHHHHCCHHHCCCCCCCHHCCHHHHHHHHHHHHHHH T ss_conf 8876315700014579802389999999999999999 No 14 >cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik. Probab=24.79 E-value=16 Score=18.01 Aligned_cols=56 Identities=16% Similarity=0.165 Sum_probs=32.7 Q ss_pred CCCCCCCCCCCCCCCCHHHCCCCCEECCCEEEEEEEECCCCCE---------EEEEEEHHH----HHHHHHCC Q ss_conf 4101178553677223323023742555248999985577868---------999997245----30236418 Q gi|254780584|r 4 VCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQK---------YQLRISKCA----LRSVERQG 63 (97) Q Consensus 4 ~C~itGk~~~~Gn~vshs~~kTkR~~~PNlq~~~~~s~~l~~~---------v~l~vst~~----lrtI~K~G 63 (97) .|-||||+|+...-...-. ..-..|++-.+.|.+..|-. |.+.-|+++ ||-+|=.| T Consensus 271 l~iITGKGP~K~~y~~~I~----~~~l~~V~i~t~wL~~eDYP~lL~~ADLGVsLHtSSSGlDLPMKVVDMfG 339 (415) T cd03816 271 LCIITGKGPLKEKYLERIK----ELKLKKVTIRTPWLSAEDYPKLLASADLGVSLHTSSSGLDLPMKVVDMFG 339 (415) T ss_pred EEEEECCCHHHHHHHHHHH----HCCCCCEEEEECCCCHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHCC T ss_conf 9999688530899999998----62888219972578878899987415347242126876677702101026 No 15 >pfam10621 FpoO F420H2 dehydrogenase subunit FpoO. This is the FpoO subunit of F420H2 dehydrogenase, an enzyme which oxidizes reduced coenzyme F420. Reduced coenzyme F420 is a universal electron carrier in methanogens. Probab=21.93 E-value=14 Score=18.46 Aligned_cols=16 Identities=13% Similarity=0.119 Sum_probs=11.3 Q ss_pred EEEEEHHHHHHHHHCC Q ss_conf 9999724530236418 Q gi|254780584|r 48 QLRISKCALRSVERQG 63 (97) Q Consensus 48 ~l~vst~~lrtI~K~G 63 (97) .++||.+||..++... T Consensus 90 ~v~iC~kCL~~~~E~y 105 (119) T pfam10621 90 TVKICLKCLEETSESY 105 (119) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 5889999998756999 Done!