Query         gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 97
No_of_seqs    107 out of 724
Neff          5.3 
Searched_HMMs 33803
Date          Wed Jun  1 17:15:18 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780584.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2jl6_1 50S ribosomal protein   99.9 1.8E-27 5.4E-32  184.7  -4.2   76    1-78      1-89  (89)
  2 >3bbo_Y Ribosomal protein L28;  99.9 7.1E-27 2.1E-31  181.2  -3.8   76    1-77     74-149 (151)
  3 >2jz6_A 50S ribosomal protein   99.9 6.6E-25 1.9E-29  169.4   5.2   66    1-67      6-71  (77)
  4 >3i1n_X 50S ribosomal protein   99.4 2.6E-14 7.8E-19  106.1   1.7   33    1-33      1-33  (33)
  5 >2zjr_U 50S ribosomal protein   99.2 2.9E-12 8.5E-17   93.9   1.0   34    1-34      1-47  (47)
  6 >3i1n_X 50S ribosomal protein   98.6 8.1E-09 2.4E-13   73.2  -0.0   38   34-72      1-38  (45)
  7 >2j01_1 50S ribosomal protein   98.3 1.1E-07 3.2E-12   66.5   1.1   33    1-33      1-46  (46)
  8 >2zkr_o 60S ribosomal protein   48.2      15 0.00043   17.9   2.7   27   48-74     47-77  (133)
  9 >2j0j_A Focal adhesion kinase   42.5      13 0.00038   18.3   1.6   38   54-94     31-69  (90)
 10 >2al6_A Focal adhesion kinase   40.5      13 0.00038   18.3   1.4   38   54-94     31-69  (90)
 11 >3fss_A Histone chaperone RTT1  33.0      24  0.0007   16.6   1.8   34   38-71      5-45  (46)
 12 >1hxr_A Guanine nucleotide exc  27.2      19 0.00055   17.3   0.5   18    3-20     13-31  (32)
 13 >1vq8_O 50S ribosomal protein   25.7      47  0.0014   14.9   2.3   40   35-74     25-70  (78)
 14 >3jyw_O 60S ribosomal protein   23.8      23 0.00068   16.7   0.4   26   50-75     85-114 (121)
 15 >2k5c_A Uncharacterized protei  23.6      21 0.00062   17.0   0.2   11    1-12      8-18  (95)
 16 >3iuf_A Zinc finger protein UB  21.6      25 0.00074   16.5   0.2   20    4-23      9-32  (48)

No 1  
>>2jl6_1 50S ribosomal protein L28, 50S ribosomal protein L25; methylation, translation, paromomycin, tRNA-binding, tRNA, zinc, mRNA, ribosome, repressor, RNA-binding; 3.45A {Thermus thermophilus} PDB: 2jl8_1 (1:)
Probab=99.92  E-value=1.8e-27  Score=184.71  Aligned_cols=76  Identities=20%  Similarity=0.320  Sum_probs=73.7

Q ss_pred             CCCCCCCCCCCCCCCCCCC-------------HHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHH
Q ss_conf             9854101178553677223-------------323023742555248999985577868999997245302364188779
Q gi|254780584|r    1 MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR   67 (97)
Q Consensus         1 Msr~C~itGk~~~~Gn~vs-------------hs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~   67 (97)
                      ||++|+||||+|++||+||             ||+++|+|+|.||||+++||||  |++++++|||+|||||+|.||+|+
T Consensus         1 Ma~~C~itGK~~~~Gn~vs~~g~~~~~G~~~~hs~~kTkR~~~PNlq~kr~~~~--g~~v~lrvstk~LrtI~K~G~~~~   78 (89)
T 2jl6_1            1 MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVA--GQEITFRVAASHIPKVYELVERAA   78 (89)
T ss_dssp             --CCCSSSCCCCEEEEEEEEESCCTTTSSSCCEEEEEEEEEECCCBCCBCCEET--TEECCBCCBGGGHHHHHHHHSCCC
T ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEECCCCEEEEEEEC--CEEEEEEEEHHHHHHHHHHHHHCC
T ss_conf             977644369802547718744742224775212457533173378458999989--999999999699663999875112


Q ss_pred             HHHHCCHHHHH
Q ss_conf             99729844553
Q gi|254780584|r   68 FLSNSKKENLS   78 (97)
Q Consensus        68 yLl~~~~~~Ls   78 (97)
                      |++.+.+.+||
T Consensus        79 ~~~~~~~~~l~   89 (89)
T 2jl6_1           79 AAAAAAAAAAA   89 (89)
T ss_dssp             CHHHHHHHHCC
T ss_pred             CCCCCCCCCCC
T ss_conf             22212223579


No 2  
>>3bbo_Y Ribosomal protein L28; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Nicotiana tabacum} (Y:)
Probab=99.91  E-value=7.1e-27  Score=181.20  Aligned_cols=76  Identities=29%  Similarity=0.404  Sum_probs=73.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHHHCCHHHH
Q ss_conf             98541011785536772233230237425552489999855778689999972453023641887799972984455
Q gi|254780584|r    1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL   77 (97)
Q Consensus         1 Msr~C~itGk~~~~Gn~vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl~~~~~~L   77 (97)
                      ||++|++||+++++||+||||+++|+|.|+||||++++|||+||++|+++||++|||+|||.| ||+||+++++..+
T Consensus        74 ~s~~~~~~Gk~~~~G~~vs~s~~kt~R~w~PNl~~~~l~se~l~~~v~v~vt~r~LrtI~k~G-ld~yllk~~~~~~  149 (151)
T 3bbo_Y           74 ARRICPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIEKNG-LDAVAKKAGIDLS  149 (151)
T ss_dssp             --CCCCCSCCTTCCCCCCEECCSSSCCEECCCCCCCCBCCCTTSSCCCBCCCSSSTTTTTTST-TTCSCCSSSSCSS
T ss_pred             HCEEEECCCCCCCCCCEEECCCCCCCCEECCCCEEEEEEECCCCEEEEEEEECHHEEEEECCC-HHHHHHHCCCCCC
T ss_conf             210621368744568604204653342244675889999756897999999843103640318-9999997374436


No 3  
>>2jz6_A 50S ribosomal protein L28; structure, NESG, ribonucleoprotein, structural genomics, PSI-2, protein structure initiative; NMR {Thermotoga maritima MSB8} (A:)
Probab=99.91  E-value=6.6e-25  Score=169.44  Aligned_cols=66  Identities=29%  Similarity=0.468  Sum_probs=64.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHCCCCCEECCCEEEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHH
Q ss_conf             9854101178553677223323023742555248999985577868999997245302364188779
Q gi|254780584|r    1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR   67 (97)
Q Consensus         1 Msr~C~itGk~~~~Gn~vshs~~kTkR~~~PNlq~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~   67 (97)
                      ||++|++|||+|++||+||||+++|+|+|+||||++++|||+ |++++++|||+|||||++.||+|.
T Consensus         6 Mar~C~i~GK~~~~Gn~vShs~~kTkR~~~pNlq~~r~~~~~-g~~~ki~vstr~Lrti~k~g~~~~   71 (77)
T 2jz6_A            6 MAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPD-GTIKRMRVCTSCLKSGKVKKYVGQ   71 (77)
T ss_dssp             CCCCCTTTCCCCCCCCCCCCSCCCCSSSCBTTEEEEEEEETT-TEEEEEEEEHHHHHHCCSCCCCCC
T ss_pred             EEEECCCCCCCCCCCCCEEECCCCCCCEECCCEEEEEEEECC-CCEEEEEEEHHHHHHCCHHHHHHH
T ss_conf             763333057856558706675863576243762899999139-979999999799654378899997


No 4  
>>3i1n_X 50S ribosomal protein L28; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 2qao_Z* 2qba_Z* 2qbc_Z* 2qbe_Z 2qbg_Z 2qbi_Z* 2qbk_Z* 2qov_Z 2qox_Z 2qoz_Z* 2qp1_Z* 2z4l_Z* 2z4n_Z* 3df2_Z 3df4_Z 2qam_Z 3i1p_X 3i1r_X 3i1t_X 3i20_X ... (X:1-33)
Probab=99.43  E-value=2.6e-14  Score=106.06  Aligned_cols=33  Identities=64%  Similarity=0.974  Sum_probs=32.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHCCCCCEECCCE
Q ss_conf             985410117855367722332302374255524
Q gi|254780584|r    1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL   33 (97)
Q Consensus         1 Msr~C~itGk~~~~Gn~vshs~~kTkR~~~PNl   33 (97)
                      |||+||||||+|++||+||||+++|+|+|.|||
T Consensus         1 Mar~C~i~GK~~~~Gn~vSHS~~~tkR~~~pNL   33 (33)
T 3i1n_X            1 MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNL   33 (33)
T ss_dssp             -CCCCTTTCCCCEEECCCCTTCCCCCEEECCCB
T ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCEECCCE
T ss_conf             986642469855668623102554474674751


No 5  
>>2zjr_U 50S ribosomal protein L28; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} (U:1-47)
Probab=99.20  E-value=2.9e-12  Score=93.88  Aligned_cols=34  Identities=38%  Similarity=0.379  Sum_probs=33.6

Q ss_pred             CCCCCCCCCCCCCCCCCCC-------------HHHCCCCCEECCCEE
Q ss_conf             9854101178553677223-------------323023742555248
Q gi|254780584|r    1 MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLC   34 (97)
Q Consensus         1 Msr~C~itGk~~~~Gn~vs-------------hs~~kTkR~~~PNlq   34 (97)
                      |||+|+||||+|++||+||             |++++|+|+|.||||
T Consensus         1 Msr~C~itGK~p~~Gn~v~rrG~aKk~GGiG~h~~~~tkR~f~PNLq   47 (47)
T 2zjr_U            1 MSRECYLTGKKNLVVNSVIRRGKARADGGVGRKTTGITKRVQRANLH   47 (47)
T ss_dssp             -------CCSSSCCCCCCCCCCEESCCCTTTCSCCEECCCCCCCCCC
T ss_pred             CCCEEECCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEECCCCE
T ss_conf             97571016871354867721231112466400106623406536628


No 6  
>>3i1n_X 50S ribosomal protein L28; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 2qao_Z* 2qba_Z* 2qbc_Z* 2qbe_Z 2qbg_Z 2qbi_Z* 2qbk_Z* 2qov_Z 2qox_Z 2qoz_Z* 2qp1_Z* 2z4l_Z* 2z4n_Z* 3df2_Z 3df4_Z 2qam_Z 3i1p_X 3i1r_X 3i1t_X 3i20_X ... (X:34-78)
Probab=98.57  E-value=8.1e-09  Score=73.24  Aligned_cols=38  Identities=18%  Similarity=0.337  Sum_probs=34.8

Q ss_pred             EEEEEEECCCCCEEEEEEEHHHHHHHHHCCCHHHHHHHC
Q ss_conf             899998557786899999724530236418877999729
Q gi|254780584|r   34 CRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS   72 (97)
Q Consensus        34 q~~~~~s~~l~~~v~l~vst~~lrtI~K~GGlD~yLl~~   72 (97)
                      |+++||+|++++||+|+|||++||||||.| ||.++...
T Consensus         1 q~kR~w~~ee~r~V~LrvStk~lrtIdK~G-i~av~~~~   38 (45)
T 3i1n_X            1 HSHRFWVESEKRFVTLRVSAKGMRVIDKKG-IDTVLAEL   38 (45)
T ss_dssp             CCCCEECSSSSSEECCCCBTTHHHHHHHHC-HHHHTHHH
T ss_pred             EEEEEEECCCCEEEEEEEEHHHEEEHHHCC-HHHHHHHH
T ss_conf             899999856897999999815420125459-99999999


No 7  
>>2j01_1 50S ribosomal protein L28; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} (1:1-46)
Probab=98.34  E-value=1.1e-07  Score=66.49  Aligned_cols=33  Identities=36%  Similarity=0.684  Sum_probs=29.6

Q ss_pred             CCCCCCCCCCCCCCCCCCC-------------HHHCCCCCEECCCE
Q ss_conf             9854101178553677223-------------32302374255524
Q gi|254780584|r    1 MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNL   33 (97)
Q Consensus         1 Msr~C~itGk~~~~Gn~vs-------------hs~~kTkR~~~PNl   33 (97)
                      |||+|+||||+|.+||.|.             |-...|+|+|+|||
T Consensus         1 Msr~C~itGK~~~~gn~i~rrG~AKk~GGiG~kvtg~tkR~f~pNL   46 (46)
T 2j01_1            1 MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNL   46 (46)
T ss_dssp             -------CCCSSSCCCCCCCCCEECSCCSSSSCCCEEECCCCCCCC
T ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCEEECCCC
T ss_conf             9776334698555378787446332246641002575442663673


No 8  
>>2zkr_o 60S ribosomal protein L18; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} (o:56-188)
Probab=48.17  E-value=15  Score=17.89  Aligned_cols=27  Identities=33%  Similarity=0.496  Sum_probs=23.9

Q ss_pred             EEEEEHHHHHHHHHCCC----HHHHHHHCCH
Q ss_conf             99997245302364188----7799972984
Q gi|254780584|r   48 QLRISKCALRSVERQGG----LDRFLSNSKK   74 (97)
Q Consensus        48 ~l~vst~~lrtI~K~GG----lD~yLl~~~~   74 (97)
                      -+++|..|-.-|.++||    ||+..+..|.
T Consensus        47 AL~fS~~Ar~kI~~aGG~~ltfdqLa~~~P~   77 (133)
T 2zkr_o           47 ALRVSSRARSRILKAGGKILTFDQLALESPK   77 (133)
T ss_dssp             EEEECHHHHHHHHHHSSCEEEHHHHHHHCTT
T ss_pred             EEEECHHHHHHHHHCCCEEEEHHHHHHHCCC
T ss_conf             9973278999999759979649999986899


No 9  
>>2j0j_A Focal adhesion kinase 1; cell migration, phosphorylation, FERM, transferase, ATP-binding, integrin signaling, nucleotide-binding; HET: 4ST; 2.8A {Gallus gallus} PDB: 2j0k_A* (A:132-221)
Probab=42.49  E-value=13  Score=18.26  Aligned_cols=38  Identities=32%  Similarity=0.496  Sum_probs=26.6

Q ss_pred             HHHHHHHHCCCHHHHHHHCCHHHH-HHHHHHHHHHHHHHHHH
Q ss_conf             453023641887799972984455-39999999999999987
Q gi|254780584|r   54 CALRSVERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSE   94 (97)
Q Consensus        54 ~~lrtI~K~GGlD~yLl~~~~~~L-s~~~~klk~~i~~~l~~   94 (97)
                      ..++.|+|..||+.|+   |..-| +.+...+|+.|...+..
T Consensus        31 ~~l~~iEKE~GL~~Fl---P~slL~~~K~K~lRK~Iq~~~K~   69 (90)
T 2j0j_A           31 SNYEVLEKDVGLRRFF---PKSLLDSVKAKTLRKLIQQTFRQ   69 (90)
T ss_dssp             HHHHHHHHTTTGGGTS---CHHHHHHSCHHHHHHHHHHHHGG
T ss_pred             CCHHHHHHHHHHHHCC---CHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7999998773235038---98998764068899999999987


No 10 
>>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} (A:132-221)
Probab=40.52  E-value=13  Score=18.26  Aligned_cols=38  Identities=32%  Similarity=0.496  Sum_probs=25.9

Q ss_pred             HHHHHHHHCCCHHHHHHHCCHHHH-HHHHHHHHHHHHHHHHH
Q ss_conf             453023641887799972984455-39999999999999987
Q gi|254780584|r   54 CALRSVERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSE   94 (97)
Q Consensus        54 ~~lrtI~K~GGlD~yLl~~~~~~L-s~~~~klk~~i~~~l~~   94 (97)
                      ..++.|+|..||+.|+   |..-| +.+...+|+.|...+..
T Consensus        31 ~~l~~iEKE~GL~~Fl---P~slL~~~K~K~lRK~Iq~~~K~   69 (90)
T 2al6_A           31 SNYEVLEKDVGLRRFF---PKSLLDSVKAKTLRKLIQQTFRQ   69 (90)
T ss_dssp             HHHHHHHHTTCGGGTS---CHHHHHSSCHHHHHHHHHHHHHT
T ss_pred             CCHHHHHCCCCHHHHC---CHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             6656642014213319---97997542999999999999997


No 11 
>>3fss_A Histone chaperone RTT106; chromosomal protein, nucleus, phosphoprotein, transcription, transcription regulation, transposition; 1.43A {Saccharomyces cerevisiae} PDB: 3gyp_A 3gyo_A (A:192-237)
Probab=33.03  E-value=24  Score=16.63  Aligned_cols=34  Identities=9%  Similarity=0.136  Sum_probs=22.5

Q ss_pred             EEECCCCCEEEEEEEHHHHHHH-------HHCCCHHHHHHH
Q ss_conf             9855778689999972453023-------641887799972
Q gi|254780584|r   38 LISDIMEQKYQLRISKCALRSV-------ERQGGLDRFLSN   71 (97)
Q Consensus        38 ~~s~~l~~~v~l~vst~~lrtI-------~K~GGlD~yLl~   71 (97)
                      =|+.++.+.+.+.++++.=..+       +..+|||.|+.+
T Consensus         5 SYtsv~r~TFNl~i~~~~~~e~EFsMIDQ~~y~~ID~yik~   45 (46)
T 3fss_A            5 TYSSITRLTFNASLVTKDGEKYEFSXIDQTEYAKIDDYVKR   45 (46)
T ss_dssp             EEESCCSSEEEEEEEETTSCEEEEEEEEGGGHHHHHHHHHC
T ss_pred             EEEECCCCEEEEEEEECCCCEEEEECCCHHHHHHHHHHHHC
T ss_conf             99924675899999988897489806398998879999753


No 12 
>>1hxr_A Guanine nucleotide exchange factor MSS4; RAB GTPase, membrane trafficking, Zn binding site, metal binding protein; 1.65A {Rattus norvegicus} (A:1-27,A:111-115)
Probab=27.17  E-value=19  Score=17.25  Aligned_cols=18  Identities=33%  Similarity=0.617  Sum_probs=14.6

Q ss_pred             CCCCCCCCCC-CCCCCCCH
Q ss_conf             5410117855-36772233
Q gi|254780584|r    3 RVCELTKKTV-MSGNKVSH   20 (97)
Q Consensus         3 r~C~itGk~~-~~Gn~vsh   20 (97)
                      --|+-||.++ +.|..|||
T Consensus        13 vlc~rcgsrvlqpg~rvsh   31 (32)
T 1hxr_A           13 VLCQRCGSRVLQPGTRVSH   31 (32)
T ss_dssp             EEETTTCCEEECTTSGEEE
T ss_pred             HHHHHHCCCCCCCCHEECC
T ss_conf             1224406531368501036


No 13 
>>1vq8_O 50S ribosomal protein L18E; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} (O:39-116)
Probab=25.71  E-value=47  Score=14.86  Aligned_cols=40  Identities=18%  Similarity=0.298  Sum_probs=28.3

Q ss_pred             EEEEEECCCCCEEEE---EEEHHHHHHHHHCCC---HHHHHHHCCH
Q ss_conf             999985577868999---997245302364188---7799972984
Q gi|254780584|r   35 RITLISDIMEQKYQL---RISKCALRSVERQGG---LDRFLSNSKK   74 (97)
Q Consensus        35 ~~~~~s~~l~~~v~l---~vst~~lrtI~K~GG---lD~yLl~~~~   74 (97)
                      -+-+-...+.+.+++   .+|.+|..-|+++||   |+++-+..|.
T Consensus        25 ~KvLg~G~l~~~l~V~A~~fS~sA~ekIe~aGG~v~~~e~a~~~p~   70 (78)
T 1vq8_O           25 GKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPE   70 (78)
T ss_dssp             EEEECCSCCCSCCEEEEEEECHHHHHHHHHHSEEEEHHHHHHHCTT
T ss_pred             EEEECCCEECCCEEEEEEECCHHHHHHHHHCCCEEEHHHHHHHCCC
T ss_conf             6796678676887999863278899999980987988999987899


No 14 
>>3jyw_O 60S ribosomal protein L18(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_O (O:)
Probab=23.77  E-value=23  Score=16.70  Aligned_cols=26  Identities=27%  Similarity=0.445  Sum_probs=21.8

Q ss_pred             EEEHHHHHHHHHCCC----HHHHHHHCCHH
Q ss_conf             997245302364188----77999729844
Q gi|254780584|r   50 RISKCALRSVERQGG----LDRFLSNSKKE   75 (97)
Q Consensus        50 ~vst~~lrtI~K~GG----lD~yLl~~~~~   75 (97)
                      ++|.+|...|+++||    ||+.++..|..
T Consensus        85 ~~S~sA~~kIe~AGG~v~~~~~~~~~~p~g  114 (121)
T 3jyw_O           85 RFTAGARAKIVKAGGECITLDQLAVRAPKG  114 (121)
T ss_dssp             SBCTTTTTHHHHHTCCBCCSTTHHHHCTTC
T ss_pred             ECCHHHHHHHHHCCCEEEEHHHHHHHCCCC
T ss_conf             714789999997599798899999878998


No 15 
>>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} (A:)
Probab=23.56  E-value=21  Score=16.96  Aligned_cols=11  Identities=18%  Similarity=0.676  Sum_probs=6.0

Q ss_pred             CCCCCCCCCCCC
Q ss_conf             985410117855
Q gi|254780584|r    1 MSRVCELTKKTV   12 (97)
Q Consensus         1 Msr~C~itGk~~   12 (97)
                      ||| |.+||+..
T Consensus         8 Mak-CPlCG~~l   18 (95)
T 2k5c_A            8 MAK-CPICGSPL   18 (95)
T ss_dssp             CEE-CSSSCCEE
T ss_pred             HHC-CCCCCCCC
T ss_conf             423-88678826


No 16 
>>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, apoptosis, cytoplasm, metal-binding, nucleus, phosphoprotein, transcription; 1.80A {Homo sapiens} (A:)
Probab=21.56  E-value=25  Score=16.49  Aligned_cols=20  Identities=20%  Similarity=0.428  Sum_probs=12.1

Q ss_pred             CCCCCCCCC--CCCC--CCCHHHC
Q ss_conf             410117855--3677--2233230
Q gi|254780584|r    4 VCELTKKTV--MSGN--KVSHANN   23 (97)
Q Consensus         4 ~C~itGk~~--~~Gn--~vshs~~   23 (97)
                      +|+||||+-  +.|-  ...|++.
T Consensus         9 ~C~vCgKrYKN~~GL~YH~~H~h~   32 (48)
T 3iuf_A            9 ACDICGKRYKNRPGLSYHYAHSHL   32 (48)
T ss_dssp             ECTTTCCEESSHHHHHHHHHHSSC
T ss_pred             CCHHHHHHHCCCCCCHHHHHCCCC
T ss_conf             150455554378762066541665


Done!